Psyllid ID: psy15468
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 653 | ||||||
| 328719779 | 1680 | PREDICTED: protein polybromo-1-like [Acy | 0.790 | 0.307 | 0.446 | 1e-132 | |
| 270001742 | 1660 | hypothetical protein TcasGA2_TC000618 [T | 0.799 | 0.314 | 0.433 | 1e-123 | |
| 189234458 | 1648 | PREDICTED: similar to polybromo-1 [Tribo | 0.797 | 0.316 | 0.438 | 1e-122 | |
| 242010994 | 1673 | predicted protein [Pediculus humanus cor | 0.765 | 0.298 | 0.397 | 1e-113 | |
| 383852643 | 1651 | PREDICTED: protein polybromo-1-like [Meg | 0.785 | 0.310 | 0.437 | 1e-113 | |
| 350415036 | 1651 | PREDICTED: protein polybromo-1-like [Bom | 0.777 | 0.307 | 0.429 | 1e-112 | |
| 340714787 | 1649 | PREDICTED: LOW QUALITY PROTEIN: protein | 0.777 | 0.308 | 0.427 | 1e-111 | |
| 322790256 | 1587 | hypothetical protein SINV_09840 [Solenop | 0.767 | 0.315 | 0.418 | 1e-110 | |
| 307180267 | 1644 | Protein polybromo-1 [Camponotus floridan | 0.768 | 0.305 | 0.417 | 1e-110 | |
| 380016641 | 1651 | PREDICTED: protein polybromo-1-like [Api | 0.779 | 0.308 | 0.421 | 1e-110 |
| >gi|328719779|ref|XP_001944619.2| PREDICTED: protein polybromo-1-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 479 bits (1234), Expect = e-132, Method: Compositional matrix adjust.
Identities = 278/622 (44%), Positives = 372/622 (59%), Gaps = 106/622 (17%)
Query: 60 MGKRRRASSL-TRSVDDDDDSSSHTSETPTMQTRPKRKKIDPSDAMQQIYDVIRNFKKED 118
M +RRRASS+ +R+ DD+ +S P R KR+ +DP D +Q +YD +RNFKKED
Sbjct: 1 MNRRRRASSIASRATDDEVES------LPVEHIRKKRR-VDPVDIVQSVYDTVRNFKKED 53
Query: 119 GALLCDPFIRIPKKRQEPSYHEVVTNPIDFIKIQQKLKTDEYDDLSDFQADIELLVVTNP 178
G LLCD FIR PK+RQEP+Y++VV+N P
Sbjct: 54 GMLLCDSFIRAPKRRQEPTYYDVVSN---------------------------------P 80
Query: 179 IDFIKIQQKLKTDEYDDLSDFQADIELLVKNAKTFYKRNSQEHRDAQELMELFHSTRNKL 238
ID IKIQQK+KTDEYDD+ D Q D+ELL NAK+FYK+NSQE++DA EL ++F +T+N +
Sbjct: 81 IDLIKIQQKIKTDEYDDVDDLQTDLELLTNNAKSFYKKNSQEYKDAVELWDVFLATKNNI 140
Query: 239 LNPQSHEGTSQKR----------------SMDFMMASETEDSRDSSICTEDEQNQCEDLF 282
L EGT +++ SM ++ E+S S + +DE CE+LF
Sbjct: 141 L---EREGTPKEKLVIRVGKLGKRGGSAASMSKSEQTDEEESNSSVVGGDDELAMCEELF 197
Query: 283 NAVMTSTDADSRPLHEVFQLLPSKKRYPEYYDVIDVPIDLRTIARRIQDGKYASLGDMEK 342
AVM++TD ++R L FQLLPSKK YP YY+VI+ PIDLR+IAR+IQDGKYA+L +ME+
Sbjct: 198 TAVMSATDNENRLLSAAFQLLPSKKSYPNYYEVIENPIDLRSIARKIQDGKYANLAEMER 257
Query: 343 DLILMTKNACTFNEPGSQIYKDAKALKKLVQTKKMEIEQGKFTPAGKSERIRSKRIRGGQ 402
+L++MTKNAC FNEPGSQIYKDAK LKK++ +KK+E++ GK+ P+ SERIR+KR+RG Q
Sbjct: 258 ELLIMTKNACLFNEPGSQIYKDAKTLKKVITSKKIEVDHGKYAPSKSSERIRAKRMRGSQ 317
Query: 403 -SLSAITAALESEDDE-------SEDDEEIDQEDPNSPLWQVYDAIRNAKTQGVIFFFFG 454
S+SA+TAAL+SED+E + D + + + P++P WQ+Y+A+R+A
Sbjct: 318 TSMSAVTAALQSEDEEDSDLDEDTVTDSQSNVDGPDNPRWQLYNAVRSATGS-------- 369
Query: 455 VTAASLQKMRILYNTIKETCEPKTGRQLSHIFQRLPSRHDYPDYYEVIRKPVDMEMIASK 514
G LS F +LPS+ YP+YY IR P+ + I K
Sbjct: 370 -----------------------QGNLLSDTFWKLPSKRYYPNYYHEIRNPLSLMQIGKK 406
Query: 515 LRYNQYEHLDEMVADFIQMFDNACKYNEPDSHIYKDALSLQRIVLQTK----MHLREDED 570
LR Y + E+ D M +NA KY D+ YKDA+ LQ+ V+QTK + L
Sbjct: 407 LRNGDYGTVSEVAGDMNVMLENAKKYFTIDTKQYKDAVKLQK-VMQTKAQELLDLGHQYS 465
Query: 571 SVPDVPAAVQELLTSLFTSVYNHQKQCLGSFHVLNVDNKPLKRRLYTLCKCLMDYRDQDG 630
D A TS + + +CL LN N PLKRRLY LCKCLMDY + G
Sbjct: 466 DSEDDSADDDLQSTSRTSKKFARSPRCLTRGKYLN--NIPLKRRLYALCKCLMDYTTEHG 523
Query: 631 RQPMLMFMELPSAKIYPEYYKV 652
R PMLMFME+PS K+YP YYKV
Sbjct: 524 RVPMLMFMEIPSKKLYPAYYKV 545
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270001742|gb|EEZ98189.1| hypothetical protein TcasGA2_TC000618 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|189234458|ref|XP_001808258.1| PREDICTED: similar to polybromo-1 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|242010994|ref|XP_002426242.1| predicted protein [Pediculus humanus corporis] gi|212510305|gb|EEB13504.1| predicted protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|383852643|ref|XP_003701836.1| PREDICTED: protein polybromo-1-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|350415036|ref|XP_003490512.1| PREDICTED: protein polybromo-1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340714787|ref|XP_003395905.1| PREDICTED: LOW QUALITY PROTEIN: protein polybromo-1-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|322790256|gb|EFZ15255.1| hypothetical protein SINV_09840 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|307180267|gb|EFN68300.1| Protein polybromo-1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|380016641|ref|XP_003692286.1| PREDICTED: protein polybromo-1-like [Apis florea] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 653 | ||||||
| FB|FBgn0039227 | 1654 | polybromo "polybromo" [Drosoph | 0.390 | 0.154 | 0.478 | 2.4e-98 | |
| RGD|1565549 | 1704 | Pbrm1 "polybromo 1" [Rattus no | 0.704 | 0.269 | 0.333 | 1e-81 | |
| UNIPROTKB|E2RRR3 | 1635 | PBRM1 "Uncharacterized protein | 0.702 | 0.280 | 0.335 | 3.5e-80 | |
| UNIPROTKB|E2RRL7 | 1689 | PBRM1 "Uncharacterized protein | 0.702 | 0.271 | 0.335 | 4e-80 | |
| UNIPROTKB|H0Y5B5 | 1085 | PBRM1 "Protein polybromo-1" [H | 0.721 | 0.434 | 0.327 | 4e-80 | |
| UNIPROTKB|E7EVG2 | 1461 | PBRM1 "Protein polybromo-1" [H | 0.702 | 0.314 | 0.331 | 7.3e-80 | |
| MGI|MGI:1923998 | 1634 | Pbrm1 "polybromo 1" [Mus muscu | 0.684 | 0.273 | 0.343 | 1.2e-79 | |
| UNIPROTKB|Q86U86 | 1689 | PBRM1 "Protein polybromo-1" [H | 0.702 | 0.271 | 0.331 | 1.4e-79 | |
| UNIPROTKB|E1BNH8 | 1664 | E1BNH8 "Uncharacterized protei | 0.701 | 0.275 | 0.331 | 2.1e-79 | |
| ZFIN|ZDB-GENE-010501-3 | 1648 | pbrm1l "polybromo 1, like" [Da | 0.586 | 0.232 | 0.370 | 1.7e-78 |
| FB|FBgn0039227 polybromo "polybromo" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 584 (210.6 bits), Expect = 2.4e-98, Sum P(2) = 2.4e-98
Identities = 132/276 (47%), Positives = 172/276 (62%)
Query: 174 VVTNPIDFIKIQQKLKTDEYDDLSDFQADIELLVKNAKTFYKRNSQEHRDAQELMELFHS 233
VV NPID +K+QQKLKTD YDDL D AD+ELL+ NAK FY S EH+DA L + HS
Sbjct: 89 VVVNPIDLLKVQQKLKTDSYDDLDDLMADLELLIGNAKAFYIPGSSEHQDAVSLWQHIHS 148
Query: 234 TRNKLLNPQS---HEGTSQKRSMDFM-MASETEDSRDSSICTEDEQNQCEDLFNAVMTST 289
R +++ E +++ S M S TE D + T+DE NQ E+LF +VMT+T
Sbjct: 149 QRQRIMEANGLAEEEPRARRMSRQVRRMTSSTEPGGDGA--TDDEYNQYEELFASVMTAT 206
Query: 290 D-ADSRPLHEVFQLLPSKKRYPEYYDVIDVPIDLRTIARRIQDGKYASLGDMEKDLILMT 348
D R +H +FQLLPSKK YP+YYDVI+ PIDLR IA +IQ Y+SL +ME+DL+ MT
Sbjct: 207 DPVGDRLMHRMFQLLPSKKIYPDYYDVIEHPIDLRLIATKIQMNAYSSLAEMERDLLQMT 266
Query: 349 KNACTFNEPGSQIYKDAKALKKLVQTKKMEIEQGKFTPAGKSERIRSKRIRGGQSLS-AI 407
KNAC FNEPGSQIYKDAK+LK++ +++E+E GK GK +KR++ SLS A
Sbjct: 267 KNACLFNEPGSQIYKDAKSLKRIFTQRRIELEMGK----GKL----AKRVK---SLSSAA 315
Query: 408 TAALXXXXXXXXXXXXXXXXXPNSPLWQVYDAIRNA 443
AAL P+W ++D + NA
Sbjct: 316 IAALKEEVDSSDDEETSKKG--EGPMWALFDHLYNA 349
|
|
| RGD|1565549 Pbrm1 "polybromo 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RRR3 PBRM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RRL7 PBRM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0Y5B5 PBRM1 "Protein polybromo-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EVG2 PBRM1 "Protein polybromo-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1923998 Pbrm1 "polybromo 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q86U86 PBRM1 "Protein polybromo-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BNH8 E1BNH8 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-010501-3 pbrm1l "polybromo 1, like" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 653 | |||
| cd05515 | 105 | cd05515, Bromo_polybromo_V, Bromodomain, polybromo | 1e-46 | |
| cd05517 | 103 | cd05517, Bromo_polybromo_II, Bromodomain, polybrom | 4e-45 | |
| cd05524 | 113 | cd05524, Bromo_polybromo_I, Bromodomain, polybromo | 1e-41 | |
| cd05515 | 105 | cd05515, Bromo_polybromo_V, Bromodomain, polybromo | 1e-29 | |
| cd05520 | 103 | cd05520, Bromo_polybromo_III, Bromodomain, polybro | 7e-28 | |
| smart00297 | 107 | smart00297, BROMO, bromo domain | 2e-26 | |
| smart00297 | 107 | smart00297, BROMO, bromo domain | 3e-26 | |
| cd05516 | 107 | cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like su | 9e-26 | |
| cd05520 | 103 | cd05520, Bromo_polybromo_III, Bromodomain, polybro | 2e-24 | |
| cd04369 | 99 | cd04369, Bromodomain, Bromodomain | 2e-24 | |
| cd05518 | 103 | cd05518, Bromo_polybromo_IV, Bromodomain, polybrom | 4e-24 | |
| cd04369 | 99 | cd04369, Bromodomain, Bromodomain | 1e-23 | |
| cd05518 | 103 | cd05518, Bromo_polybromo_IV, Bromodomain, polybrom | 2e-23 | |
| cd05517 | 103 | cd05517, Bromo_polybromo_II, Bromodomain, polybrom | 1e-22 | |
| cd05519 | 103 | cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam | 2e-22 | |
| cd05519 | 103 | cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam | 1e-21 | |
| cd05522 | 104 | cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i | 4e-20 | |
| cd05516 | 107 | cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like su | 1e-19 | |
| cd05524 | 113 | cd05524, Bromo_polybromo_I, Bromodomain, polybromo | 9e-19 | |
| cd05521 | 106 | cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in | 1e-18 | |
| pfam00439 | 84 | pfam00439, Bromodomain, Bromodomain | 2e-18 | |
| pfam00439 | 84 | pfam00439, Bromodomain, Bromodomain | 9e-18 | |
| cd05524 | 113 | cd05524, Bromo_polybromo_I, Bromodomain, polybromo | 1e-17 | |
| COG5076 | 371 | COG5076, COG5076, Transcription factor involved in | 7e-17 | |
| smart00297 | 107 | smart00297, BROMO, bromo domain | 1e-16 | |
| cd05509 | 101 | cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s | 2e-16 | |
| cd05520 | 103 | cd05520, Bromo_polybromo_III, Bromodomain, polybro | 6e-16 | |
| cd05522 | 104 | cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i | 7e-16 | |
| cd05521 | 106 | cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in | 3e-15 | |
| COG5076 | 371 | COG5076, COG5076, Transcription factor involved in | 6e-15 | |
| cd04369 | 99 | cd04369, Bromodomain, Bromodomain | 1e-14 | |
| cd05522 | 104 | cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i | 1e-14 | |
| cd05498 | 102 | cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik | 2e-14 | |
| cd05499 | 102 | cd05499, Bromo_BDF1_2_II, Bromodomain | 3e-14 | |
| cd05516 | 107 | cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like su | 1e-13 | |
| cd05525 | 106 | cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-fa | 2e-13 | |
| cd05515 | 105 | cd05515, Bromo_polybromo_V, Bromodomain, polybromo | 4e-13 | |
| cd05509 | 101 | cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s | 5e-13 | |
| cd05500 | 103 | cd05500, Bromo_BDF1_2_I, Bromodomain | 1e-12 | |
| cd05504 | 115 | cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o | 1e-12 | |
| pfam00439 | 84 | pfam00439, Bromodomain, Bromodomain | 2e-12 | |
| COG5076 | 371 | COG5076, COG5076, Transcription factor involved in | 2e-12 | |
| cd05525 | 106 | cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-fa | 2e-12 | |
| cd05502 | 109 | cd05502, Bromo_tif1_like, Bromodomain; tif1_like s | 1e-11 | |
| cd05518 | 103 | cd05518, Bromo_polybromo_IV, Bromodomain, polybrom | 2e-11 | |
| cd05500 | 103 | cd05500, Bromo_BDF1_2_I, Bromodomain | 4e-11 | |
| cd05502 | 109 | cd05502, Bromo_tif1_like, Bromodomain; tif1_like s | 1e-10 | |
| cd05497 | 107 | cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like | 1e-10 | |
| cd05504 | 115 | cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o | 5e-10 | |
| cd05513 | 98 | cd05513, Bromo_brd7_like, Bromodomain, brd7_like s | 8e-10 | |
| cd05506 | 99 | cd05506, Bromo_plant1, Bromodomain, uncharacterize | 8e-10 | |
| cd05498 | 102 | cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik | 9e-10 | |
| cd05519 | 103 | cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam | 1e-09 | |
| cd05525 | 106 | cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-fa | 1e-09 | |
| cd05495 | 108 | cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub | 1e-09 | |
| cd05497 | 107 | cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like | 2e-09 | |
| cd05511 | 112 | cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf | 2e-09 | |
| cd05529 | 128 | cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe | 3e-09 | |
| cd05511 | 112 | cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf | 6e-09 | |
| cd05503 | 97 | cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA | 6e-09 | |
| cd05517 | 103 | cd05517, Bromo_polybromo_II, Bromodomain, polybrom | 1e-08 | |
| cd05499 | 102 | cd05499, Bromo_BDF1_2_II, Bromodomain | 2e-08 | |
| cd05512 | 98 | cd05512, Bromo_brd1_like, Bromodomain; brd1_like s | 2e-08 | |
| cd05506 | 99 | cd05506, Bromo_plant1, Bromodomain, uncharacterize | 3e-08 | |
| cd05496 | 119 | cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat I | 3e-08 | |
| cd05510 | 112 | cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like s | 3e-08 | |
| cd05504 | 115 | cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o | 6e-08 | |
| cd05503 | 97 | cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA | 8e-08 | |
| cd05509 | 101 | cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s | 1e-07 | |
| cd05495 | 108 | cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub | 1e-07 | |
| cd05505 | 97 | cd05505, Bromo_WSTF_like, Bromodomain; Williams sy | 1e-07 | |
| cd05515 | 105 | cd05515, Bromo_polybromo_V, Bromodomain, polybromo | 1e-06 | |
| cd05504 | 115 | cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o | 2e-06 | |
| cd05512 | 98 | cd05512, Bromo_brd1_like, Bromodomain; brd1_like s | 2e-06 | |
| cd05510 | 112 | cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like s | 2e-06 | |
| cd05528 | 112 | cd05528, Bromo_AAA, Bromodomain; sub-family co-occ | 2e-06 | |
| cd05513 | 98 | cd05513, Bromo_brd7_like, Bromodomain, brd7_like s | 3e-06 | |
| cd05507 | 104 | cd05507, Bromo_brd8_like, Bromodomain, brd8_like s | 4e-06 | |
| cd05529 | 128 | cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe | 5e-06 | |
| cd05499 | 102 | cd05499, Bromo_BDF1_2_II, Bromodomain | 6e-06 | |
| cd05528 | 112 | cd05528, Bromo_AAA, Bromodomain; sub-family co-occ | 8e-06 | |
| cd05518 | 103 | cd05518, Bromo_polybromo_IV, Bromodomain, polybrom | 2e-05 | |
| cd05498 | 102 | cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik | 2e-05 | |
| cd05499 | 102 | cd05499, Bromo_BDF1_2_II, Bromodomain | 2e-05 | |
| cd05511 | 112 | cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf | 2e-05 | |
| cd05505 | 97 | cd05505, Bromo_WSTF_like, Bromodomain; Williams sy | 2e-05 | |
| cd05500 | 103 | cd05500, Bromo_BDF1_2_I, Bromodomain | 3e-05 | |
| cd05510 | 112 | cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like s | 3e-05 | |
| cd05500 | 103 | cd05500, Bromo_BDF1_2_I, Bromodomain | 6e-05 | |
| cd05529 | 128 | cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe | 8e-05 | |
| cd05502 | 109 | cd05502, Bromo_tif1_like, Bromodomain; tif1_like s | 1e-04 | |
| cd05511 | 112 | cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf | 3e-04 | |
| cd05512 | 98 | cd05512, Bromo_brd1_like, Bromodomain; brd1_like s | 3e-04 | |
| cd05507 | 104 | cd05507, Bromo_brd8_like, Bromodomain, brd8_like s | 3e-04 | |
| cd05519 | 103 | cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam | 6e-04 | |
| cd05498 | 102 | cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik | 6e-04 | |
| cd05528 | 112 | cd05528, Bromo_AAA, Bromodomain; sub-family co-occ | 6e-04 | |
| cd05492 | 109 | cd05492, Bromo_ZMYND11, Bromodomain; ZMYND11_like | 6e-04 | |
| cd05503 | 97 | cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA | 7e-04 | |
| cd05512 | 98 | cd05512, Bromo_brd1_like, Bromodomain; brd1_like s | 7e-04 | |
| cd05513 | 98 | cd05513, Bromo_brd7_like, Bromodomain, brd7_like s | 8e-04 | |
| cd05506 | 99 | cd05506, Bromo_plant1, Bromodomain, uncharacterize | 8e-04 | |
| cd05521 | 106 | cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in | 9e-04 | |
| cd05505 | 97 | cd05505, Bromo_WSTF_like, Bromodomain; Williams sy | 0.001 | |
| cd05528 | 112 | cd05528, Bromo_AAA, Bromodomain; sub-family co-occ | 0.001 | |
| cd05513 | 98 | cd05513, Bromo_brd7_like, Bromodomain, brd7_like s | 0.002 | |
| cd05495 | 108 | cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub | 0.002 | |
| cd05503 | 97 | cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA | 0.002 | |
| cd05505 | 97 | cd05505, Bromo_WSTF_like, Bromodomain; Williams sy | 0.002 |
| >gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V | Back alignment and domain information |
|---|
Score = 159 bits (404), Expect = 1e-46
Identities = 64/102 (62%), Positives = 84/102 (82%), Gaps = 1/102 (0%)
Query: 461 QKMRILYNTIKETCEPKTGRQLSHIFQRLPSRHDYPDYYEVIRKPVDMEMIASKLRYNQY 520
QK+ LYN +K + + GR+LS IF RLPS+ +YPDYY+VI+KP+DME I SK+ NQY
Sbjct: 3 QKLWELYNAVKNYTDGR-GRRLSLIFMRLPSKSEYPDYYDVIKKPIDMEKIRSKIEGNQY 61
Query: 521 EHLDEMVADFIQMFDNACKYNEPDSHIYKDALSLQRIVLQTK 562
+ LD+MV+DF+ MFDNACKYNEPDS IYKDAL+LQ+++L+TK
Sbjct: 62 QSLDDMVSDFVLMFDNACKYNEPDSQIYKDALTLQKVLLETK 103
|
Polybromo is a nuclear protein of unknown function, which contains 6 bromodomains. The human ortholog BAF180 is part of a SWI/SNF chromatin-remodeling complex, and it may carry out the functions of Yeast Rsc-1 and Rsc-2. It was shown that polybromo bromodomains bind to histone H3 at specific acetyl-lysine positions. Bromodomains are found in many chromatin-associated proteins and in nuclear histone acetyltransferases. They interact specifically with acetylated lysine, but not all the bromodomains in polybromo may bind to acetyl-lysine. Length = 105 |
| >gnl|CDD|99948 cd05517, Bromo_polybromo_II, Bromodomain, polybromo repeat II | Back alignment and domain information |
|---|
| >gnl|CDD|99954 cd05524, Bromo_polybromo_I, Bromodomain, polybromo repeat I | Back alignment and domain information |
|---|
| >gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V | Back alignment and domain information |
|---|
| >gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III | Back alignment and domain information |
|---|
| >gnl|CDD|197636 smart00297, BROMO, bromo domain | Back alignment and domain information |
|---|
| >gnl|CDD|197636 smart00297, BROMO, bromo domain | Back alignment and domain information |
|---|
| >gnl|CDD|99947 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like subfamily, specific to animals | Back alignment and domain information |
|---|
| >gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III | Back alignment and domain information |
|---|
| >gnl|CDD|99922 cd04369, Bromodomain, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99949 cd05518, Bromo_polybromo_IV, Bromodomain, polybromo repeat IV | Back alignment and domain information |
|---|
| >gnl|CDD|99922 cd04369, Bromodomain, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99949 cd05518, Bromo_polybromo_IV, Bromodomain, polybromo repeat IV | Back alignment and domain information |
|---|
| >gnl|CDD|99948 cd05517, Bromo_polybromo_II, Bromodomain, polybromo repeat II | Back alignment and domain information |
|---|
| >gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >gnl|CDD|99947 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like subfamily, specific to animals | Back alignment and domain information |
|---|
| >gnl|CDD|99954 cd05524, Bromo_polybromo_I, Bromodomain, polybromo repeat I | Back alignment and domain information |
|---|
| >gnl|CDD|99952 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99954 cd05524, Bromo_polybromo_I, Bromodomain, polybromo repeat I | Back alignment and domain information |
|---|
| >gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|197636 smart00297, BROMO, bromo domain | Back alignment and domain information |
|---|
| >gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III | Back alignment and domain information |
|---|
| >gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >gnl|CDD|99952 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|99922 cd04369, Bromodomain, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II | Back alignment and domain information |
|---|
| >gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99947 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like subfamily, specific to animals | Back alignment and domain information |
|---|
| >gnl|CDD|99955 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-family | Back alignment and domain information |
|---|
| >gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V | Back alignment and domain information |
|---|
| >gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|99955 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-family | Back alignment and domain information |
|---|
| >gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99949 cd05518, Bromo_polybromo_IV, Bromodomain, polybromo repeat IV | Back alignment and domain information |
|---|
| >gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I | Back alignment and domain information |
|---|
| >gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99945 cd05513, Bromo_brd7_like, Bromodomain, brd7_like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants | Back alignment and domain information |
|---|
| >gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II | Back alignment and domain information |
|---|
| >gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >gnl|CDD|99955 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-family | Back alignment and domain information |
|---|
| >gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I | Back alignment and domain information |
|---|
| >gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99948 cd05517, Bromo_polybromo_II, Bromodomain, polybromo repeat II | Back alignment and domain information |
|---|
| >gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants | Back alignment and domain information |
|---|
| >gnl|CDD|99928 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat II_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99942 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) | Back alignment and domain information |
|---|
| >gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V | Back alignment and domain information |
|---|
| >gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99942 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99957 cd05528, Bromo_AAA, Bromodomain; sub-family co-occurring with AAA domains | Back alignment and domain information |
|---|
| >gnl|CDD|99945 cd05513, Bromo_brd7_like, Bromodomain, brd7_like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99957 cd05528, Bromo_AAA, Bromodomain; sub-family co-occurring with AAA domains | Back alignment and domain information |
|---|
| >gnl|CDD|99949 cd05518, Bromo_polybromo_IV, Bromodomain, polybromo repeat IV | Back alignment and domain information |
|---|
| >gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II | Back alignment and domain information |
|---|
| >gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) | Back alignment and domain information |
|---|
| >gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99942 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II | Back alignment and domain information |
|---|
| >gnl|CDD|99957 cd05528, Bromo_AAA, Bromodomain; sub-family co-occurring with AAA domains | Back alignment and domain information |
|---|
| >gnl|CDD|99924 cd05492, Bromo_ZMYND11, Bromodomain; ZMYND11_like sub-family | Back alignment and domain information |
|---|
| >gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99945 cd05513, Bromo_brd7_like, Bromodomain, brd7_like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants | Back alignment and domain information |
|---|
| >gnl|CDD|99952 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) | Back alignment and domain information |
|---|
| >gnl|CDD|99957 cd05528, Bromo_AAA, Bromodomain; sub-family co-occurring with AAA domains | Back alignment and domain information |
|---|
| >gnl|CDD|99945 cd05513, Bromo_brd7_like, Bromodomain, brd7_like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 653 | |||
| KOG1474|consensus | 640 | 99.95 | ||
| KOG0008|consensus | 1563 | 99.94 | ||
| KOG1474|consensus | 640 | 99.94 | ||
| cd05524 | 113 | Bromo_polybromo_I Bromodomain, polybromo repeat I. | 99.93 | |
| cd05516 | 107 | Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s | 99.93 | |
| cd05515 | 105 | Bromo_polybromo_V Bromodomain, polybromo repeat V. | 99.93 | |
| cd05525 | 106 | Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 | 99.93 | |
| cd05517 | 103 | Bromo_polybromo_II Bromodomain, polybromo repeat I | 99.93 | |
| cd05516 | 107 | Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s | 99.92 | |
| cd05525 | 106 | Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 | 99.92 | |
| cd05515 | 105 | Bromo_polybromo_V Bromodomain, polybromo repeat V. | 99.92 | |
| cd05524 | 113 | Bromo_polybromo_I Bromodomain, polybromo repeat I. | 99.92 | |
| cd05517 | 103 | Bromo_polybromo_II Bromodomain, polybromo repeat I | 99.92 | |
| cd05518 | 103 | Bromo_polybromo_IV Bromodomain, polybromo repeat I | 99.92 | |
| cd05520 | 103 | Bromo_polybromo_III Bromodomain, polybromo repeat | 99.92 | |
| cd05520 | 103 | Bromo_polybromo_III Bromodomain, polybromo repeat | 99.92 | |
| cd05518 | 103 | Bromo_polybromo_IV Bromodomain, polybromo repeat I | 99.91 | |
| cd05519 | 103 | Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci | 99.91 | |
| cd05519 | 103 | Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci | 99.91 | |
| cd05522 | 104 | Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l | 99.91 | |
| cd05526 | 110 | Bromo_polybromo_VI Bromodomain, polybromo repeat V | 99.91 | |
| cd05521 | 106 | Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik | 99.9 | |
| cd05505 | 97 | Bromo_WSTF_like Bromodomain; Williams syndrome tra | 99.9 | |
| cd05521 | 106 | Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik | 99.9 | |
| COG5076 | 371 | Transcription factor involved in chromatin remodel | 99.9 | |
| cd05522 | 104 | Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l | 99.89 | |
| cd05496 | 119 | Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub | 99.89 | |
| cd05505 | 97 | Bromo_WSTF_like Bromodomain; Williams syndrome tra | 99.89 | |
| cd05497 | 107 | Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily | 99.89 | |
| COG5076 | 371 | Transcription factor involved in chromatin remodel | 99.89 | |
| cd05504 | 115 | Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li | 99.88 | |
| cd05495 | 108 | Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb | 99.88 | |
| cd05497 | 107 | Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily | 99.88 | |
| cd05503 | 97 | Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s | 99.88 | |
| cd05496 | 119 | Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub | 99.88 | |
| cd05499 | 102 | Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam | 99.88 | |
| cd05504 | 115 | Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li | 99.87 | |
| cd05502 | 109 | Bromo_tif1_like Bromodomain; tif1_like subfamily. | 99.87 | |
| cd05503 | 97 | Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s | 99.87 | |
| cd05508 | 99 | Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC | 99.87 | |
| cd05507 | 104 | Bromo_brd8_like Bromodomain, brd8_like subgroup. I | 99.87 | |
| cd05510 | 112 | Bromo_SPT7_like Bromodomain; SPT7_like subfamily. | 99.87 | |
| cd05495 | 108 | Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb | 99.87 | |
| cd05501 | 102 | Bromo_SP100C_like Bromodomain, SP100C_like subfami | 99.87 | |
| cd05508 | 99 | Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC | 99.87 | |
| cd05509 | 101 | Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. | 99.87 | |
| cd05507 | 104 | Bromo_brd8_like Bromodomain, brd8_like subgroup. I | 99.86 | |
| cd05498 | 102 | Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil | 99.86 | |
| cd05526 | 110 | Bromo_polybromo_VI Bromodomain, polybromo repeat V | 99.86 | |
| cd05509 | 101 | Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. | 99.86 | |
| cd05510 | 112 | Bromo_SPT7_like Bromodomain; SPT7_like subfamily. | 99.86 | |
| cd05499 | 102 | Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam | 99.85 | |
| cd05511 | 112 | Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum | 99.85 | |
| cd05513 | 98 | Bromo_brd7_like Bromodomain, brd7_like subgroup. T | 99.85 | |
| cd05513 | 98 | Bromo_brd7_like Bromodomain, brd7_like subgroup. T | 99.85 | |
| cd05506 | 99 | Bromo_plant1 Bromodomain, uncharacterized subfamil | 99.85 | |
| cd05500 | 103 | Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami | 99.85 | |
| cd05511 | 112 | Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum | 99.85 | |
| cd05512 | 98 | Bromo_brd1_like Bromodomain; brd1_like subfamily. | 99.85 | |
| cd05528 | 112 | Bromo_AAA Bromodomain; sub-family co-occurring wit | 99.84 | |
| cd05501 | 102 | Bromo_SP100C_like Bromodomain, SP100C_like subfami | 99.84 | |
| cd05512 | 98 | Bromo_brd1_like Bromodomain; brd1_like subfamily. | 99.84 | |
| cd05502 | 109 | Bromo_tif1_like Bromodomain; tif1_like subfamily. | 99.84 | |
| cd05498 | 102 | Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil | 99.84 | |
| cd05528 | 112 | Bromo_AAA Bromodomain; sub-family co-occurring wit | 99.84 | |
| cd05529 | 128 | Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like | 99.84 | |
| cd05506 | 99 | Bromo_plant1 Bromodomain, uncharacterized subfamil | 99.83 | |
| cd05529 | 128 | Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like | 99.83 | |
| cd05500 | 103 | Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami | 99.82 | |
| smart00297 | 107 | BROMO bromo domain. | 99.81 | |
| smart00297 | 107 | BROMO bromo domain. | 99.81 | |
| KOG1827|consensus | 629 | 99.8 | ||
| KOG1472|consensus | 720 | 99.77 | ||
| PF00439 | 84 | Bromodomain: Bromodomain; InterPro: IPR001487 Brom | 99.76 | |
| cd05492 | 109 | Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family | 99.76 | |
| cd05492 | 109 | Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family | 99.76 | |
| cd04369 | 99 | Bromodomain Bromodomain. Bromodomains are found in | 99.75 | |
| PF00439 | 84 | Bromodomain: Bromodomain; InterPro: IPR001487 Brom | 99.75 | |
| KOG1827|consensus | 629 | 99.74 | ||
| cd04369 | 99 | Bromodomain Bromodomain. Bromodomains are found in | 99.74 | |
| KOG1472|consensus | 720 | 99.74 | ||
| KOG0008|consensus | 1563 | 99.7 | ||
| KOG1245|consensus | 1404 | 99.59 | ||
| KOG1245|consensus | 1404 | 99.5 | ||
| KOG0386|consensus | 1157 | 99.27 | ||
| KOG1828|consensus | 418 | 99.26 | ||
| KOG1828|consensus | 418 | 99.22 | ||
| KOG0386|consensus | 1157 | 99.16 | ||
| cd05494 | 114 | Bromodomain_1 Bromodomain; uncharacterized subfami | 98.95 | |
| cd05491 | 119 | Bromo_TBP7_like Bromodomain; TBP7_like subfamily, | 98.78 | |
| cd05494 | 114 | Bromodomain_1 Bromodomain; uncharacterized subfami | 98.73 | |
| cd05491 | 119 | Bromo_TBP7_like Bromodomain; TBP7_like subfamily, | 98.72 | |
| KOG0955|consensus | 1051 | 98.56 | ||
| KOG0955|consensus | 1051 | 98.49 | ||
| cd05493 | 131 | Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL- | 94.51 | |
| cd05493 | 131 | Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL- | 93.01 | |
| KOG0644|consensus | 1113 | 87.45 | ||
| KOG0644|consensus | 1113 | 80.1 |
| >KOG1474|consensus | Back alignment and domain information |
|---|
Probab=99.95 E-value=6.9e-28 Score=276.54 Aligned_cols=224 Identities=24% Similarity=0.380 Sum_probs=180.2
Q ss_pred ccccccccCCC--CCCCCccccccCCccchHHHHHHHhcCCCCChhhHHHHHHHHhhcCCchHHHHhhhcccCcCCCHHH
Q psy15468 121 LLCDPFIRIPK--KRQEPSYHEVVTNPIDFIKIQQKLKTDEYDDLSDFQADIELLVVTNPIDFIKIQQKLKTDEYDDLSD 198 (653)
Q Consensus 121 ~~~~~F~~~v~--~~~~PdYy~iI~~PmDL~tI~~kl~~~~y~~~~~~~~d~~l~~~~~P~d~~~~~~~~~~~~Y~~~~~ 198 (653)
.++|+|..||+ ....|+||++|++|||+.||..++.+ .| |....+
T Consensus 8 ~~~~~f~~~v~~v~l~~~~~~~~~~~~~d~~~~~~~~e~-n~--------------------------------~~~~~~ 54 (640)
T KOG1474|consen 8 KLAWPFLEPVDAVALNLPAYYEIIKRPMDIGTIEKRVEN-NY--------------------------------YFSASE 54 (640)
T ss_pred cccccccCccchhhccchhhhcccCCCCCchhhhhhhcc-Cc--------------------------------cccHhh
Confidence 46999999996 78999999999999999999999999 54 899999
Q ss_pred HHHHHHHHHHhhhccccCCCHHHHHHHHHHHHHHHHhhhccCCCCCCC--------------c---------cc------
Q psy15468 199 FQADIELLVKNAKTFYKRNSQEHRDAQELMELFHSTRNKLLNPQSHEG--------------T---------SQ------ 249 (653)
Q Consensus 199 f~~D~~li~~Na~~yn~~~s~~~~~a~~l~~~~~~~~~~~~~~~~~~~--------------~---------~~------ 249 (653)
..+|+..+|.||..||...-.+...+..+.+++.+....+........ + ..
T Consensus 55 ~~~~f~~~~sn~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~ 134 (640)
T KOG1474|consen 55 CIADFKTKFSNCYLFNDSGDDVVRMKQSLEKLFPKKLRSMPSDEEDKSSVGPKASKIPLDKDSSSQVRKLSERLKQELQQ 134 (640)
T ss_pred hhhhccccccchhcccCCccchhhccccchhhcccccccccccccCCcccccccccCcCCCCchhhhhhhhhcccccccc
Confidence 999999999999999999999999999999988766654432211100 0 00
Q ss_pred ----ccccc---------c---------------cCCC----------cccCC------C--C-----------------
Q psy15468 250 ----KRSMD---------F---------------MMAS----------ETEDS------R--D----------------- 266 (653)
Q Consensus 250 ----~r~~~---------~---------------~~~~----------~~~~~------~--~----------------- 266 (653)
..++. . ...+ ...++ . .
T Consensus 135 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 214 (640)
T KOG1474|consen 135 VRPLTKAVEFSPEPSVVSPVSPASQPFKSKNGVKKVADTCVKSYKSKSEREPSPGQKREGTVAPNSSRESGDSAAEEEAK 214 (640)
T ss_pred CCcccccccccccccccCCCCCcccccccccchhhhhccccccccccCcCCCCccccccccccCcccccccccccccccc
Confidence 00000 0 0000 00000 0 0
Q ss_pred -CCCCChHHHHHHHHHHHHHHhccCCCCccccccccccccc--CCCCCcccccCCcCCHHHHHHHhhCCCCCCHHHHHHH
Q psy15468 267 -SSICTEDEQNQCEDLFNAVMTSTDADSRPLHEVFQLLPSK--KRYPEYYDVIDVPIDLRTIARRIQDGKYASLGDMEKD 343 (653)
Q Consensus 267 -ss~~~~~~~~~~~~ll~~l~~~~d~~g~~~a~~F~~~p~~--~~~PdYy~iIk~PmDL~tI~~kl~~~~Y~s~~ef~~D 343 (653)
.+..+.+..+.|..||..|+.+++ +|||..||+. .++||||+||++||||+||+.||.++.|.++.+|..|
T Consensus 215 ~~~~~~~~~lk~C~~iLk~l~~~k~------awpF~~PVD~v~LgLpDY~~IIK~PMDLgTIK~kL~~~~Y~~~~eF~~D 288 (640)
T KOG1474|consen 215 PKSKLTVELLKQCLSILKRLMKHKH------AWPFNEPVDVVKLGLPDYHDIIKHPMDLGTIKKKLEKGEYKSAEEFAAD 288 (640)
T ss_pred ccccccHHHHHHHHHHHHHHHhccC------CCCcCCCcCHHhcCCcchhhhcCCCccHHHHHhhhcccccCCHHHHHHH
Confidence 011123457999999999999998 7999999875 6899999999999999999999999999999999999
Q ss_pred HHHHHHhhhhhCCCCCHHHHHHHHHHHHHHHHHHhhhcCC
Q psy15468 344 LILMTKNACTFNEPGSQIYKDAKALKKLVQTKKMEIEQGK 383 (653)
Q Consensus 344 v~Lmf~Na~~yN~~~S~i~~~A~~L~~~~~~~~~~i~~~~ 383 (653)
|+|||.||++||++|++||.+|..|+.+|+.+|+.+....
T Consensus 289 VRL~F~Ncm~YNp~g~dV~~Ma~~L~~~Fe~rw~~~~~~~ 328 (640)
T KOG1474|consen 289 VRLTFDNCMTYNPEGSDVYAMAKKLQEVFEERWASMPLEI 328 (640)
T ss_pred HHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHHHhhccccc
Confidence 9999999999999999999999999999999999876543
|
|
| >KOG0008|consensus | Back alignment and domain information |
|---|
| >KOG1474|consensus | Back alignment and domain information |
|---|
| >cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I | Back alignment and domain information |
|---|
| >cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals | Back alignment and domain information |
|---|
| >cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V | Back alignment and domain information |
|---|
| >cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family | Back alignment and domain information |
|---|
| >cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II | Back alignment and domain information |
|---|
| >cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals | Back alignment and domain information |
|---|
| >cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family | Back alignment and domain information |
|---|
| >cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V | Back alignment and domain information |
|---|
| >cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I | Back alignment and domain information |
|---|
| >cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II | Back alignment and domain information |
|---|
| >cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV | Back alignment and domain information |
|---|
| >cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III | Back alignment and domain information |
|---|
| >cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III | Back alignment and domain information |
|---|
| >cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV | Back alignment and domain information |
|---|
| >cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI | Back alignment and domain information |
|---|
| >cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) | Back alignment and domain information |
|---|
| >cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily | Back alignment and domain information |
|---|
| >cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) | Back alignment and domain information |
|---|
| >cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I | Back alignment and domain information |
|---|
| >COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily | Back alignment and domain information |
|---|
| >cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily | Back alignment and domain information |
|---|
| >cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I | Back alignment and domain information |
|---|
| >cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily | Back alignment and domain information |
|---|
| >cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily | Back alignment and domain information |
|---|
| >cd05499 Bromo_BDF1_2_II Bromodomain | Back alignment and domain information |
|---|
| >cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily | Back alignment and domain information |
|---|
| >cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily | Back alignment and domain information |
|---|
| >cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily | Back alignment and domain information |
|---|
| >cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily | Back alignment and domain information |
|---|
| >cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup | Back alignment and domain information |
|---|
| >cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily | Back alignment and domain information |
|---|
| >cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily | Back alignment and domain information |
|---|
| >cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily | Back alignment and domain information |
|---|
| >cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily | Back alignment and domain information |
|---|
| >cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily | Back alignment and domain information |
|---|
| >cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup | Back alignment and domain information |
|---|
| >cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II | Back alignment and domain information |
|---|
| >cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI | Back alignment and domain information |
|---|
| >cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily | Back alignment and domain information |
|---|
| >cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily | Back alignment and domain information |
|---|
| >cd05499 Bromo_BDF1_2_II Bromodomain | Back alignment and domain information |
|---|
| >cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily | Back alignment and domain information |
|---|
| >cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup | Back alignment and domain information |
|---|
| >cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup | Back alignment and domain information |
|---|
| >cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants | Back alignment and domain information |
|---|
| >cd05500 Bromo_BDF1_2_I Bromodomain | Back alignment and domain information |
|---|
| >cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily | Back alignment and domain information |
|---|
| >cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily | Back alignment and domain information |
|---|
| >cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains | Back alignment and domain information |
|---|
| >cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily | Back alignment and domain information |
|---|
| >cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily | Back alignment and domain information |
|---|
| >cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily | Back alignment and domain information |
|---|
| >cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II | Back alignment and domain information |
|---|
| >cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains | Back alignment and domain information |
|---|
| >cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily | Back alignment and domain information |
|---|
| >cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants | Back alignment and domain information |
|---|
| >cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily | Back alignment and domain information |
|---|
| >cd05500 Bromo_BDF1_2_I Bromodomain | Back alignment and domain information |
|---|
| >smart00297 BROMO bromo domain | Back alignment and domain information |
|---|
| >smart00297 BROMO bromo domain | Back alignment and domain information |
|---|
| >KOG1827|consensus | Back alignment and domain information |
|---|
| >KOG1472|consensus | Back alignment and domain information |
|---|
| >PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] | Back alignment and domain information |
|---|
| >cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family | Back alignment and domain information |
|---|
| >cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family | Back alignment and domain information |
|---|
| >cd04369 Bromodomain Bromodomain | Back alignment and domain information |
|---|
| >PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] | Back alignment and domain information |
|---|
| >KOG1827|consensus | Back alignment and domain information |
|---|
| >cd04369 Bromodomain Bromodomain | Back alignment and domain information |
|---|
| >KOG1472|consensus | Back alignment and domain information |
|---|
| >KOG0008|consensus | Back alignment and domain information |
|---|
| >KOG1245|consensus | Back alignment and domain information |
|---|
| >KOG1245|consensus | Back alignment and domain information |
|---|
| >KOG0386|consensus | Back alignment and domain information |
|---|
| >KOG1828|consensus | Back alignment and domain information |
|---|
| >KOG1828|consensus | Back alignment and domain information |
|---|
| >KOG0386|consensus | Back alignment and domain information |
|---|
| >cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily | Back alignment and domain information |
|---|
| >cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi | Back alignment and domain information |
|---|
| >cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily | Back alignment and domain information |
|---|
| >cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi | Back alignment and domain information |
|---|
| >KOG0955|consensus | Back alignment and domain information |
|---|
| >KOG0955|consensus | Back alignment and domain information |
|---|
| >cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins | Back alignment and domain information |
|---|
| >cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins | Back alignment and domain information |
|---|
| >KOG0644|consensus | Back alignment and domain information |
|---|
| >KOG0644|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 653 | ||||
| 2ktb_B | 121 | Solution Structure Of The Second Bromodomain Of Hum | 2e-26 | ||
| 2ktb_B | 121 | Solution Structure Of The Second Bromodomain Of Hum | 1e-15 | ||
| 3hmf_A | 116 | Crystal Structure Of The Second Bromodomain Of Huma | 2e-26 | ||
| 3hmf_A | 116 | Crystal Structure Of The Second Bromodomain Of Huma | 1e-15 | ||
| 3ljw_A | 120 | Crystal Structure Of The Second Bromodomain Of Huma | 2e-26 | ||
| 3ljw_A | 120 | Crystal Structure Of The Second Bromodomain Of Huma | 1e-15 | ||
| 3g0j_A | 124 | Crystal Structure Of The Fifth Bromodomain Of Human | 6e-26 | ||
| 2yqd_A | 120 | Solution Structure Of The Fifth Bromodomain From Mo | 3e-25 | ||
| 3iu5_A | 116 | Crystal Structure Of The First Bromodomain Of Human | 3e-21 | ||
| 3iu5_A | 116 | Crystal Structure Of The First Bromodomain Of Human | 2e-14 | ||
| 2dat_A | 123 | Solution Structure Of The Bromodomain Of Human SwiS | 5e-19 | ||
| 2dat_A | 123 | Solution Structure Of The Bromodomain Of Human SwiS | 1e-13 | ||
| 3tlp_A | 150 | Crystal Structure Of The Fourth Bromodomain Of Huma | 3e-18 | ||
| 3uvd_A | 124 | Crystal Structure Of The Bromodomain Of Human Trans | 2e-17 | ||
| 3uvd_A | 124 | Crystal Structure Of The Bromodomain Of Human Trans | 3e-15 | ||
| 2grc_A | 129 | 1.5 A Structure Of Bromodomain From Human Brg1 Prot | 2e-17 | ||
| 2grc_A | 129 | 1.5 A Structure Of Bromodomain From Human Brg1 Prot | 1e-15 | ||
| 2h60_A | 128 | Solution Structure Of Human Brg1 Bromodomain Length | 2e-17 | ||
| 2h60_A | 128 | Solution Structure Of Human Brg1 Bromodomain Length | 1e-15 | ||
| 3k2j_A | 130 | Crystal Structure Of The 3rd Bromodomain Of Human P | 2e-16 | ||
| 2r10_A | 361 | Structure Of An Acetylated Rsc4 Tandem Bromodomain | 4e-11 | ||
| 2r10_A | 361 | Structure Of An Acetylated Rsc4 Tandem Bromodomain | 1e-07 | ||
| 2r0v_A | 346 | Structure Of The Rsc4 Tandem Bromodomain Acetylated | 5e-11 | ||
| 2r0v_A | 346 | Structure Of The Rsc4 Tandem Bromodomain Acetylated | 1e-09 | ||
| 2r0s_A | 285 | Crystal Structure Of The Rsc4 Tandem Bromodomain Le | 3e-10 | ||
| 2r0s_A | 285 | Crystal Structure Of The Rsc4 Tandem Bromodomain Le | 4e-09 | ||
| 2r0y_A | 311 | Structure Of The Rsc4 Tandem Bromodomain In Complex | 3e-10 | ||
| 2r0y_A | 311 | Structure Of The Rsc4 Tandem Bromodomain In Complex | 4e-09 | ||
| 3qzt_A | 115 | Crystal Structure Of Bptf Bromo In Complex With His | 5e-08 | ||
| 3uv2_A | 126 | Crystal Structure Of The Bromodomain Of Human Nucle | 8e-08 | ||
| 3qzs_A | 115 | Crystal Structure Of Bptf Bromo In Complex With His | 8e-08 | ||
| 2ri7_A | 174 | Crystal Structure Of Phd Finger-Linker-Bromodomain | 8e-08 | ||
| 3qzv_A | 174 | Crystal Structure Of Bptf Phd-Linker-Bromo In Compl | 9e-08 | ||
| 3jvj_A | 131 | Crystal Structure Of The Bromodomain 1 In Mouse Brd | 1e-07 | ||
| 3aad_A | 292 | Structure Of The Histone Chaperone Cia/asf1-double | 1e-07 | ||
| 3aad_A | 292 | Structure Of The Histone Chaperone Cia/asf1-double | 1e-04 | ||
| 2oss_A | 127 | Crystal Structure Of The Bromo Domain 1 In Human Br | 2e-07 | ||
| 1eqf_A | 280 | Crystal Structure Of The Double Bromodomain Module | 2e-07 | ||
| 1eqf_A | 280 | Crystal Structure Of The Double Bromodomain Module | 1e-04 | ||
| 4hbw_A | 127 | Crystal Structure Of The First Bromodomain Of Human | 2e-07 | ||
| 3gg3_A | 119 | Crystal Structure Of The Bromodomain Of Human Pcaf | 2e-07 | ||
| 1n72_A | 118 | Structure And Ligand Of A Histone Acetyltransferase | 3e-07 | ||
| 3uv5_A | 265 | Crystal Structure Of The Tandem Bromodomains Of Hum | 3e-07 | ||
| 3uv5_A | 265 | Crystal Structure Of The Tandem Bromodomains Of Hum | 1e-04 | ||
| 4don_A | 145 | Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihy | 3e-07 | ||
| 2f6j_A | 174 | Crystal Structure Of Phd Finger-Linker-Bromodomain | 3e-07 | ||
| 2ydw_A | 153 | Crystal Structure Of The First Bromodomain Of Human | 3e-07 | ||
| 2yw5_A | 138 | Solution Structure Of The Bromodomain From Human Br | 3e-07 | ||
| 4a9e_A | 154 | N-Terminal Bromodomain Of Human Brd2 With 3-Methyl- | 4e-07 | ||
| 2l5e_A | 128 | Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Lengt | 4e-07 | ||
| 2yyn_A | 135 | Crystal Sturcture Of Human Bromodomain Protein Leng | 5e-07 | ||
| 2nxb_A | 123 | Crystal Structure Of Human Bromodomain Containing P | 6e-07 | ||
| 3o33_A | 184 | Crystal Structure Of Trim24 Phd-Bromo In The Free S | 6e-07 | ||
| 2rfj_A | 119 | Crystal Structure Of The Bromo Domain 1 In Human Br | 2e-06 | ||
| 2rfj_A | 119 | Crystal Structure Of The Bromo Domain 1 In Human Br | 3e-06 | ||
| 3fkm_X | 166 | Plasmodium Falciparum Bromodomain-Containing Protei | 2e-06 | ||
| 3d7c_A | 112 | Crystal Structure Of The Bromodomain Of Human Gcn5, | 4e-06 | ||
| 1f68_A | 103 | Nmr Solution Structure Of The Bromodomain From Huma | 5e-06 | ||
| 2wp2_A | 120 | Structure Of Brdt Bromodomain Bd1 Bound To A Diacet | 7e-06 | ||
| 3i3j_A | 124 | Crystal Structure Of The Bromodomain Of Human Ep300 | 1e-05 | ||
| 3mb3_A | 135 | Crystal Structure Of The Second Bromodomain Of Plec | 1e-05 | ||
| 1jsp_B | 121 | Nmr Structure Of Cbp Bromodomain In Complex With P5 | 2e-05 | ||
| 3dwy_A | 119 | Crystal Structure Of The Bromodomain Of Human Crebb | 2e-05 | ||
| 3aqa_A | 128 | Crystal Structure Of The Human Brd2 Bd1 Bromodomain | 2e-05 | ||
| 3uv4_A | 158 | Crystal Structure Of The Second Bromodomain Of Huma | 2e-05 | ||
| 3uv4_A | 158 | Crystal Structure Of The Second Bromodomain Of Huma | 2e-04 | ||
| 2ouo_A | 130 | Crystal Structure Of The Bromo Domain 2 In Human Br | 2e-05 | ||
| 2lsp_B | 128 | Solution Structures Of Brd4 Second Bromodomain With | 2e-05 | ||
| 3jvl_A | 120 | Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Le | 2e-05 | ||
| 1x0j_A | 122 | Crystal Structure Analysis Of The N-Terminal Bromod | 3e-05 | ||
| 3hmh_A | 155 | Crystal Structure Of The Second Bromodomain Of Huma | 3e-05 | ||
| 3hmh_A | 155 | Crystal Structure Of The Second Bromodomain Of Huma | 1e-04 | ||
| 3hme_A | 123 | Crystal Structure Of Human Bromodomain Containing 9 | 3e-05 | ||
| 2i8n_A | 114 | Solution Structure Of The Second Bromodomain Of Brd | 3e-05 | ||
| 1e6i_A | 121 | Bromodomain From Gcn5 Complexed With Acetylated H4 | 5e-05 | ||
| 1e6i_A | 121 | Bromodomain From Gcn5 Complexed With Acetylated H4 | 2e-04 | ||
| 3q2e_A | 123 | Crystal Structure Of The Second Bromodomain Of Huma | 9e-05 | ||
| 3rcw_A | 135 | Crystal Structure Of The Bromodomain Of Human Brd1 | 1e-04 | ||
| 3mqm_A | 126 | Crystal Structure Of The Bromodomain Of Human Ash1l | 1e-04 | ||
| 3g0l_A | 117 | Crystal Structure Of Human Bromodomain Adjacent To | 2e-04 | ||
| 2d9e_A | 121 | Solution Structure Of The Bromodomain Of Peregrin L | 2e-04 | ||
| 2wp1_A | 126 | Structure Of Brdt Bromodomain 2 Bound To An Acetyla | 2e-04 | ||
| 2e7o_A | 112 | Solution Structure Of The Bromodomain From Human Br | 2e-04 | ||
| 2i7k_A | 117 | Solution Structure Of The Bromodomain Of Human Brd7 | 4e-04 | ||
| 3oni_A | 114 | Crystal Structure Of The Second Bromodomain Of Huma | 5e-04 | ||
| 2dww_A | 114 | Crystal Structure Of Bromodomain-Containing Protein | 5e-04 | ||
| 2dvv_A | 112 | Crystal Structure Of The Second Bromodomain Of The | 6e-04 | ||
| 2g4a_A | 116 | Solution Structure Of A Bromodomain From Ring3 Prot | 7e-04 |
| >pdb|2KTB|B Chain B, Solution Structure Of The Second Bromodomain Of Human Polybr Complex With An Acetylated Peptide From Histone 3 Length = 121 | Back alignment and structure |
|
| >pdb|2KTB|B Chain B, Solution Structure Of The Second Bromodomain Of Human Polybr Complex With An Acetylated Peptide From Histone 3 Length = 121 | Back alignment and structure |
| >pdb|3HMF|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 | Back alignment and structure |
| >pdb|3HMF|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 | Back alignment and structure |
| >pdb|3LJW|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Polybromo Length = 120 | Back alignment and structure |
| >pdb|3LJW|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Polybromo Length = 120 | Back alignment and structure |
| >pdb|3G0J|A Chain A, Crystal Structure Of The Fifth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 124 | Back alignment and structure |
| >pdb|2YQD|A Chain A, Solution Structure Of The Fifth Bromodomain From Mouse Polybromo-1 Length = 120 | Back alignment and structure |
| >pdb|3IU5|A Chain A, Crystal Structure Of The First Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 | Back alignment and structure |
| >pdb|3IU5|A Chain A, Crystal Structure Of The First Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 | Back alignment and structure |
| >pdb|2DAT|A Chain A, Solution Structure Of The Bromodomain Of Human SwiSNF Related Matrix Associated Actin Dependent Regulator Of Cromatin Subfamily A Member 2 Length = 123 | Back alignment and structure |
| >pdb|2DAT|A Chain A, Solution Structure Of The Bromodomain Of Human SwiSNF Related Matrix Associated Actin Dependent Regulator Of Cromatin Subfamily A Member 2 Length = 123 | Back alignment and structure |
| >pdb|3TLP|A Chain A, Crystal Structure Of The Fourth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 150 | Back alignment and structure |
| >pdb|3UVD|A Chain A, Crystal Structure Of The Bromodomain Of Human Transcription Activator Brg1 (Smarca4) In Complex With N-Methyl-2-Pyrrolidone Length = 124 | Back alignment and structure |
| >pdb|3UVD|A Chain A, Crystal Structure Of The Bromodomain Of Human Transcription Activator Brg1 (Smarca4) In Complex With N-Methyl-2-Pyrrolidone Length = 124 | Back alignment and structure |
| >pdb|2GRC|A Chain A, 1.5 A Structure Of Bromodomain From Human Brg1 Protein, A Central Atpase Of SwiSNF REMODELING COMPLEX Length = 129 | Back alignment and structure |
| >pdb|2GRC|A Chain A, 1.5 A Structure Of Bromodomain From Human Brg1 Protein, A Central Atpase Of SwiSNF REMODELING COMPLEX Length = 129 | Back alignment and structure |
| >pdb|2H60|A Chain A, Solution Structure Of Human Brg1 Bromodomain Length = 128 | Back alignment and structure |
| >pdb|2H60|A Chain A, Solution Structure Of Human Brg1 Bromodomain Length = 128 | Back alignment and structure |
| >pdb|3K2J|A Chain A, Crystal Structure Of The 3rd Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 130 | Back alignment and structure |
| >pdb|2R10|A Chain A, Structure Of An Acetylated Rsc4 Tandem Bromodomain Histone Chimera Length = 361 | Back alignment and structure |
| >pdb|2R10|A Chain A, Structure Of An Acetylated Rsc4 Tandem Bromodomain Histone Chimera Length = 361 | Back alignment and structure |
| >pdb|2R0V|A Chain A, Structure Of The Rsc4 Tandem Bromodomain Acetylated At K25 Length = 346 | Back alignment and structure |
| >pdb|2R0V|A Chain A, Structure Of The Rsc4 Tandem Bromodomain Acetylated At K25 Length = 346 | Back alignment and structure |
| >pdb|2R0S|A Chain A, Crystal Structure Of The Rsc4 Tandem Bromodomain Length = 285 | Back alignment and structure |
| >pdb|2R0S|A Chain A, Crystal Structure Of The Rsc4 Tandem Bromodomain Length = 285 | Back alignment and structure |
| >pdb|2R0Y|A Chain A, Structure Of The Rsc4 Tandem Bromodomain In Complex With An Acetylated H3 Peptide Length = 311 | Back alignment and structure |
| >pdb|2R0Y|A Chain A, Structure Of The Rsc4 Tandem Bromodomain In Complex With An Acetylated H3 Peptide Length = 311 | Back alignment and structure |
| >pdb|3QZT|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form Ii Length = 115 | Back alignment and structure |
| >pdb|3UV2|A Chain A, Crystal Structure Of The Bromodomain Of Human Nucleosome-Remodeling Factor Subunit Bptf Length = 126 | Back alignment and structure |
| >pdb|3QZS|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form I Length = 115 | Back alignment and structure |
| >pdb|2RI7|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Y17e Mutant From Human Bptf In The H3(1-9)k4me2 Bound State Length = 174 | Back alignment and structure |
| >pdb|3QZV|A Chain A, Crystal Structure Of Bptf Phd-Linker-Bromo In Complex With Histone H4k12ac Peptide Length = 174 | Back alignment and structure |
| >pdb|3JVJ|A Chain A, Crystal Structure Of The Bromodomain 1 In Mouse Brd4 Length = 131 | Back alignment and structure |
| >pdb|3AAD|A Chain A, Structure Of The Histone Chaperone Cia/asf1-double Bromodomain Complex Linking Histone Modifications And Site-specific Histone Eviction Length = 292 | Back alignment and structure |
| >pdb|3AAD|A Chain A, Structure Of The Histone Chaperone Cia/asf1-double Bromodomain Complex Linking Histone Modifications And Site-specific Histone Eviction Length = 292 | Back alignment and structure |
| >pdb|2OSS|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein 4 (Brd4) Length = 127 | Back alignment and structure |
| >pdb|1EQF|A Chain A, Crystal Structure Of The Double Bromodomain Module From Human Tafii250 Length = 280 | Back alignment and structure |
| >pdb|1EQF|A Chain A, Crystal Structure Of The Double Bromodomain Module From Human Tafii250 Length = 280 | Back alignment and structure |
| >pdb|4HBW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd4 In Complex With A Quinazoline Ligand Length = 127 | Back alignment and structure |
| >pdb|3GG3|A Chain A, Crystal Structure Of The Bromodomain Of Human Pcaf Length = 119 | Back alignment and structure |
| >pdb|1N72|A Chain A, Structure And Ligand Of A Histone Acetyltransferase Bromodomain Length = 118 | Back alignment and structure |
| >pdb|3UV5|A Chain A, Crystal Structure Of The Tandem Bromodomains Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 265 | Back alignment and structure |
| >pdb|3UV5|A Chain A, Crystal Structure Of The Tandem Bromodomains Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 265 | Back alignment and structure |
| >pdb|4DON|A Chain A, Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihydro-3-methyl-2(1h)- Quinazolinon Length = 145 | Back alignment and structure |
| >pdb|2F6J|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Fragment Of Human Bptf In The H3(1-15)k4me3 Bound State Length = 174 | Back alignment and structure |
| >pdb|2YDW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd2 With The Inhibitor Gw841819x Length = 153 | Back alignment and structure |
| >pdb|2YW5|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Containing Protein 3 Length = 138 | Back alignment and structure |
| >pdb|4A9E|A Chain A, N-Terminal Bromodomain Of Human Brd2 With 3-Methyl-1,2,3,4- Tetrahydroquinazolin-2-One Length = 154 | Back alignment and structure |
| >pdb|2L5E|A Chain A, Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Length = 128 | Back alignment and structure |
| >pdb|2YYN|A Chain A, Crystal Sturcture Of Human Bromodomain Protein Length = 135 | Back alignment and structure |
| >pdb|2NXB|A Chain A, Crystal Structure Of Human Bromodomain Containing Protein 3 (Brd3) Length = 123 | Back alignment and structure |
| >pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 | Back alignment and structure |
| >pdb|2RFJ|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein, Testis Specific (Brdt) Length = 119 | Back alignment and structure |
| >pdb|2RFJ|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein, Testis Specific (Brdt) Length = 119 | Back alignment and structure |
| >pdb|3FKM|X Chain X, Plasmodium Falciparum Bromodomain-Containing Protein Pf10_0328 Length = 166 | Back alignment and structure |
| >pdb|3D7C|A Chain A, Crystal Structure Of The Bromodomain Of Human Gcn5, The General Control Of Amino-Acid Synthesis Protein 5-Like 2 Length = 112 | Back alignment and structure |
| >pdb|1F68|A Chain A, Nmr Solution Structure Of The Bromodomain From Human Gcn5 Length = 103 | Back alignment and structure |
| >pdb|2WP2|A Chain A, Structure Of Brdt Bromodomain Bd1 Bound To A Diacetylated Histone H4 Peptide. Length = 120 | Back alignment and structure |
| >pdb|3I3J|A Chain A, Crystal Structure Of The Bromodomain Of Human Ep300 Length = 124 | Back alignment and structure |
| >pdb|3MB3|A Chain A, Crystal Structure Of The Second Bromodomain Of Pleckstrin Homology Domain Interacting Protein (Phip) Length = 135 | Back alignment and structure |
| >pdb|1JSP|B Chain B, Nmr Structure Of Cbp Bromodomain In Complex With P53 Peptide Length = 121 | Back alignment and structure |
| >pdb|3DWY|A Chain A, Crystal Structure Of The Bromodomain Of Human Crebbp Length = 119 | Back alignment and structure |
| >pdb|3AQA|A Chain A, Crystal Structure Of The Human Brd2 Bd1 Bromodomain In Complex With A Brd2-Interactive Compound, Bic1 Length = 128 | Back alignment and structure |
| >pdb|3UV4|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 158 | Back alignment and structure |
| >pdb|3UV4|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 158 | Back alignment and structure |
| >pdb|2OUO|A Chain A, Crystal Structure Of The Bromo Domain 2 In Human Bromodomain Containing Protein 4 (Brd4) Length = 130 | Back alignment and structure |
| >pdb|2LSP|B Chain B, Solution Structures Of Brd4 Second Bromodomain With Nf-Kb-K310ac Peptide Length = 128 | Back alignment and structure |
| >pdb|3JVL|A Chain A, Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Length = 120 | Back alignment and structure |
| >pdb|1X0J|A Chain A, Crystal Structure Analysis Of The N-Terminal Bromodomain Of Human Brd2 Length = 122 | Back alignment and structure |
| >pdb|3HMH|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Tbp-Associated Factor Rna Polymerase 1-Like (Taf1l) Length = 155 | Back alignment and structure |
| >pdb|3HMH|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Tbp-Associated Factor Rna Polymerase 1-Like (Taf1l) Length = 155 | Back alignment and structure |
| >pdb|3HME|A Chain A, Crystal Structure Of Human Bromodomain Containing 9 Isoform 1 (Brd9) Length = 123 | Back alignment and structure |
| >pdb|2I8N|A Chain A, Solution Structure Of The Second Bromodomain Of Brd4 Length = 114 | Back alignment and structure |
| >pdb|1E6I|A Chain A, Bromodomain From Gcn5 Complexed With Acetylated H4 Peptide Length = 121 | Back alignment and structure |
| >pdb|1E6I|A Chain A, Bromodomain From Gcn5 Complexed With Acetylated H4 Peptide Length = 121 | Back alignment and structure |
| >pdb|3Q2E|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Bromodomain And Wd Repeat-Containing Protein 1 Isoform A (Wdr9) Length = 123 | Back alignment and structure |
| >pdb|3RCW|A Chain A, Crystal Structure Of The Bromodomain Of Human Brd1 Length = 135 | Back alignment and structure |
| >pdb|3MQM|A Chain A, Crystal Structure Of The Bromodomain Of Human Ash1l Length = 126 | Back alignment and structure |
| >pdb|3G0L|A Chain A, Crystal Structure Of Human Bromodomain Adjacent To Zinc Finger Domain 2b (Baz2b) Length = 117 | Back alignment and structure |
| >pdb|2D9E|A Chain A, Solution Structure Of The Bromodomain Of Peregrin Length = 121 | Back alignment and structure |
| >pdb|2WP1|A Chain A, Structure Of Brdt Bromodomain 2 Bound To An Acetylated Histone H3 Peptide Length = 126 | Back alignment and structure |
| >pdb|2E7O|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Adjacent To Zinc Finger Domain 2b Length = 112 | Back alignment and structure |
| >pdb|2I7K|A Chain A, Solution Structure Of The Bromodomain Of Human Brd7 Protein Length = 117 | Back alignment and structure |
| >pdb|3ONI|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Brd2 In Complex With The Inhibitor Jq1 Length = 114 | Back alignment and structure |
| >pdb|2DWW|A Chain A, Crystal Structure Of Bromodomain-Containing Protein 4 Length = 114 | Back alignment and structure |
| >pdb|2DVV|A Chain A, Crystal Structure Of The Second Bromodomain Of The Human Brd2 Protein Length = 112 | Back alignment and structure |
| >pdb|2G4A|A Chain A, Solution Structure Of A Bromodomain From Ring3 Protein Length = 116 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 653 | |||
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 4e-46 | |
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 1e-45 | |
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 9e-26 | |
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 2e-13 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 2e-45 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 3e-43 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 6e-24 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 4e-40 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 5e-27 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 1e-19 | |
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 2e-39 | |
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 3e-24 | |
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 1e-19 | |
| 2grc_A | 129 | Probable global transcription activator SNF2L4; br | 9e-37 | |
| 2grc_A | 129 | Probable global transcription activator SNF2L4; br | 3e-32 | |
| 2grc_A | 129 | Probable global transcription activator SNF2L4; br | 2e-19 | |
| 2grc_A | 129 | Probable global transcription activator SNF2L4; br | 7e-05 | |
| 3ljw_A | 120 | Protein polybromo-1; alpha helix, alternative spli | 1e-36 | |
| 3ljw_A | 120 | Protein polybromo-1; alpha helix, alternative spli | 3e-35 | |
| 3ljw_A | 120 | Protein polybromo-1; alpha helix, alternative spli | 3e-21 | |
| 3ljw_A | 120 | Protein polybromo-1; alpha helix, alternative spli | 4e-07 | |
| 3mb4_A | 124 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 2e-35 | |
| 3mb4_A | 124 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 8e-34 | |
| 3mb4_A | 124 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 4e-22 | |
| 3mb4_A | 124 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 5e-07 | |
| 2dat_A | 123 | Possible global transcription activator SNF2L2; br | 4e-35 | |
| 2dat_A | 123 | Possible global transcription activator SNF2L2; br | 3e-34 | |
| 2dat_A | 123 | Possible global transcription activator SNF2L2; br | 9e-23 | |
| 2dat_A | 123 | Possible global transcription activator SNF2L2; br | 2e-07 | |
| 3k2j_A | 130 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 8e-35 | |
| 3k2j_A | 130 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 1e-34 | |
| 3k2j_A | 130 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 1e-22 | |
| 3k2j_A | 130 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 8e-06 | |
| 3tlp_A | 150 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 2e-34 | |
| 3tlp_A | 150 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 1e-30 | |
| 3tlp_A | 150 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 2e-20 | |
| 3tlp_A | 150 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 1e-04 | |
| 3mqm_A | 126 | Probable histone-lysine N-methyltransferase ASH1L; | 3e-34 | |
| 3mqm_A | 126 | Probable histone-lysine N-methyltransferase ASH1L; | 1e-32 | |
| 3mqm_A | 126 | Probable histone-lysine N-methyltransferase ASH1L; | 6e-23 | |
| 3mqm_A | 126 | Probable histone-lysine N-methyltransferase ASH1L; | 9e-07 | |
| 3iu5_A | 116 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 5e-34 | |
| 3iu5_A | 116 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 2e-33 | |
| 3iu5_A | 116 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 3e-26 | |
| 3iu5_A | 116 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 7e-05 | |
| 3iu6_A | 147 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 7e-24 | |
| 3iu6_A | 147 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 3e-21 | |
| 3iu6_A | 147 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 2e-18 | |
| 1e6i_A | 121 | Transcriptional activator GCN5; gene regulation, b | 1e-20 | |
| 1e6i_A | 121 | Transcriptional activator GCN5; gene regulation, b | 5e-18 | |
| 1e6i_A | 121 | Transcriptional activator GCN5; gene regulation, b | 3e-09 | |
| 2d9e_A | 121 | Peregrin; four-helix bundle, transcription activat | 2e-20 | |
| 2d9e_A | 121 | Peregrin; four-helix bundle, transcription activat | 2e-17 | |
| 2d9e_A | 121 | Peregrin; four-helix bundle, transcription activat | 3e-10 | |
| 3d7c_A | 112 | General control of amino acid synthesis protein 5; | 2e-20 | |
| 3d7c_A | 112 | General control of amino acid synthesis protein 5; | 3e-19 | |
| 3d7c_A | 112 | General control of amino acid synthesis protein 5; | 1e-09 | |
| 3rcw_A | 135 | Bromodomain-containing protein 1; transcription, s | 1e-19 | |
| 3rcw_A | 135 | Bromodomain-containing protein 1; transcription, s | 5e-16 | |
| 3rcw_A | 135 | Bromodomain-containing protein 1; transcription, s | 1e-08 | |
| 3rcw_A | 135 | Bromodomain-containing protein 1; transcription, s | 3e-07 | |
| 2oss_A | 127 | HUNK1 protein, bromodomain-containing protein 4; B | 3e-19 | |
| 2oss_A | 127 | HUNK1 protein, bromodomain-containing protein 4; B | 2e-17 | |
| 2oss_A | 127 | HUNK1 protein, bromodomain-containing protein 4; B | 6e-10 | |
| 3g0l_A | 117 | Hwalp4, bromodomain adjacent to zinc finger domain | 6e-19 | |
| 3g0l_A | 117 | Hwalp4, bromodomain adjacent to zinc finger domain | 2e-17 | |
| 3g0l_A | 117 | Hwalp4, bromodomain adjacent to zinc finger domain | 1e-10 | |
| 2i7k_A | 117 | Bromodomain-containing protein 7; helix, LEFT-hand | 6e-19 | |
| 2i7k_A | 117 | Bromodomain-containing protein 7; helix, LEFT-hand | 4e-16 | |
| 2i7k_A | 117 | Bromodomain-containing protein 7; helix, LEFT-hand | 2e-09 | |
| 3fkm_X | 166 | Signaling protein; bromodomain, malaria, structura | 8e-19 | |
| 3fkm_X | 166 | Signaling protein; bromodomain, malaria, structura | 4e-18 | |
| 3fkm_X | 166 | Signaling protein; bromodomain, malaria, structura | 1e-09 | |
| 3nxb_A | 116 | CAT eye syndrome critical region protein 2; struct | 8e-19 | |
| 3nxb_A | 116 | CAT eye syndrome critical region protein 2; struct | 8e-18 | |
| 3nxb_A | 116 | CAT eye syndrome critical region protein 2; struct | 2e-09 | |
| 4alg_A | 154 | Bromodomain-containing protein 2; signaling protei | 1e-18 | |
| 4alg_A | 154 | Bromodomain-containing protein 2; signaling protei | 2e-16 | |
| 4alg_A | 154 | Bromodomain-containing protein 2; signaling protei | 6e-09 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 1e-18 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 1e-17 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 3e-09 | |
| 3uv4_A | 158 | Second bromodomain of human transcription initiat | 2e-18 | |
| 3uv4_A | 158 | Second bromodomain of human transcription initiat | 2e-15 | |
| 3uv4_A | 158 | Second bromodomain of human transcription initiat | 4e-08 | |
| 3uv4_A | 158 | Second bromodomain of human transcription initiat | 7e-07 | |
| 3p1f_A | 119 | CREB-binding protein; structural genomics consorti | 2e-18 | |
| 3p1f_A | 119 | CREB-binding protein; structural genomics consorti | 1e-15 | |
| 3p1f_A | 119 | CREB-binding protein; structural genomics consorti | 1e-08 | |
| 2ouo_A | 130 | HUNK1 protein, bromodomain-containing protein 4; B | 3e-18 | |
| 2ouo_A | 130 | HUNK1 protein, bromodomain-containing protein 4; B | 5e-15 | |
| 2ouo_A | 130 | HUNK1 protein, bromodomain-containing protein 4; B | 2e-09 | |
| 3jvl_A | 120 | Bromodomain-containing protein 4; alpha helical, N | 4e-18 | |
| 3jvl_A | 120 | Bromodomain-containing protein 4; alpha helical, N | 3e-15 | |
| 3jvl_A | 120 | Bromodomain-containing protein 4; alpha helical, N | 9e-09 | |
| 3jvl_A | 120 | Bromodomain-containing protein 4; alpha helical, N | 4e-08 | |
| 3hme_A | 123 | Bromodomain-containing protein 9; BRD9, bromodomai | 5e-18 | |
| 3hme_A | 123 | Bromodomain-containing protein 9; BRD9, bromodomai | 4e-16 | |
| 3hme_A | 123 | Bromodomain-containing protein 9; BRD9, bromodomai | 2e-09 | |
| 3q2e_A | 123 | Bromodomain and WD repeat-containing protein 1; st | 2e-17 | |
| 3q2e_A | 123 | Bromodomain and WD repeat-containing protein 1; st | 3e-16 | |
| 3q2e_A | 123 | Bromodomain and WD repeat-containing protein 1; st | 2e-07 | |
| 3q2e_A | 123 | Bromodomain and WD repeat-containing protein 1; st | 3e-06 | |
| 2yyn_A | 135 | Transcription intermediary factor 1-alpha; bromo d | 3e-17 | |
| 2yyn_A | 135 | Transcription intermediary factor 1-alpha; bromo d | 6e-17 | |
| 2yyn_A | 135 | Transcription intermediary factor 1-alpha; bromo d | 9e-09 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 1e-16 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 1e-14 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 1e-10 | |
| 3mb3_A | 135 | PH-interacting protein; PHIP, pleckstrin homology | 6e-16 | |
| 3mb3_A | 135 | PH-interacting protein; PHIP, pleckstrin homology | 1e-15 | |
| 3mb3_A | 135 | PH-interacting protein; PHIP, pleckstrin homology | 1e-08 | |
| 2dkw_A | 131 | Hypothetical protein KIAA1240; bromodomain-like, f | 4e-15 | |
| 2dkw_A | 131 | Hypothetical protein KIAA1240; bromodomain-like, f | 1e-13 | |
| 2dkw_A | 131 | Hypothetical protein KIAA1240; bromodomain-like, f | 3e-09 | |
| 2dkw_A | 131 | Hypothetical protein KIAA1240; bromodomain-like, f | 2e-06 | |
| 3dai_A | 130 | ATPase family AAA domain-containing protein 2; anc | 3e-14 | |
| 3dai_A | 130 | ATPase family AAA domain-containing protein 2; anc | 2e-12 | |
| 3dai_A | 130 | ATPase family AAA domain-containing protein 2; anc | 4e-08 | |
| 3dai_A | 130 | ATPase family AAA domain-containing protein 2; anc | 8e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-10 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 9e-12 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 2e-09 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 5e-05 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 4e-10 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 3e-06 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 1e-04 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 9e-10 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 3e-08 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 2e-06 |
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 | Back alignment and structure |
|---|
Score = 165 bits (418), Expect = 4e-46
Identities = 52/343 (15%), Positives = 111/343 (32%), Gaps = 41/343 (11%)
Query: 85 ETPTMQTRPKRKKIDPSDAMQQIYDVIRNFKKEDGALLCDPFIRIPKKRQEPSYHEVVTN 144
P + + + + FI++P ++ P Y+ +
Sbjct: 10 NAPLNPKSELFLDDWHIPKFNRFISFTLDVLIDKYKDIFKDFIKLPSRKFHPQYYYKIQQ 69
Query: 145 PIDFIKIQQKLKTDEYDDLSDFQADIELLVVTNPIDFIKIQQKLKTDEYDDLSDFQADIE 204
P+ +I+ + + D S+F D+E
Sbjct: 70 PMSINEIKSRDY----------------------------------EYEDGPSNFLLDVE 95
Query: 205 LLVKNAKTFYKRNSQEHRDAQELMELFHSTRNKLLNPQSHEGTSQKRSMDFMMASETEDS 264
LL KN + + + +S +++ +++ L ++ +
Sbjct: 96 LLTKNCQAYNEYDSLIVKNSMQVVMLIE-------FEVLKAKNLKRNYLINSEVKAKLLH 148
Query: 265 RDSSICTEDEQNQCEDLFNAVMTSTDADSRPLHEVFQLLPSKKRYPEYYDVIDVPIDLRT 324
+ + E+ + L A D L E F L K PEYY+++ P+ L
Sbjct: 149 YLNKLVDATEKKINQALLGASSPKNLDDKVKLSEPFMELVDKDELPEYYEIVHSPMALSI 208
Query: 325 IARRIQDGKYASLGDMEKDLILMTKNACTFNEPGSQIYKDAKALKKLVQTKKMEIEQGKF 384
+ + ++ G+Y+ + D D++L+ +NA FN+P + IYKDA L + +
Sbjct: 209 VKQNLEIGQYSKIYDFIIDMLLVFQNAHIFNDPSALIYKDATTLTNYFNYLIQKEFFPEL 268
Query: 385 TPAGKSERIRSKRIRGGQSLSAITAALESEDDESEDDEEIDQE 427
+ I + + + +D +
Sbjct: 269 QDLNERGEINLEFDKFEFENYLAIGGGGPAAAGALAISALDND 311
|
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 | Back alignment and structure |
|---|
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 | Back alignment and structure |
|---|
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 | Back alignment and structure |
|---|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 | Back alignment and structure |
|---|
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 | Back alignment and structure |
|---|
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 | Back alignment and structure |
|---|
| >2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 | Back alignment and structure |
|---|
| >2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 | Back alignment and structure |
|---|
| >2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 | Back alignment and structure |
|---|
| >2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 | Back alignment and structure |
|---|
| >3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 | Back alignment and structure |
|---|
| >3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 | Back alignment and structure |
|---|
| >3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 | Back alignment and structure |
|---|
| >3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 | Back alignment and structure |
|---|
| >3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 | Back alignment and structure |
|---|
| >3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 | Back alignment and structure |
|---|
| >3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 | Back alignment and structure |
|---|
| >3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 | Back alignment and structure |
|---|
| >2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 | Back alignment and structure |
|---|
| >3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 | Back alignment and structure |
|---|
| >3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 | Back alignment and structure |
|---|
| >3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 | Back alignment and structure |
|---|
| >3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 | Back alignment and structure |
|---|
| >1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 | Back alignment and structure |
|---|
| >1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 | Back alignment and structure |
|---|
| >2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 | Back alignment and structure |
|---|
| >3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 | Back alignment and structure |
|---|
| >3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 | Back alignment and structure |
|---|
| >3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 | Back alignment and structure |
|---|
| >2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 | Back alignment and structure |
|---|
| >2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 | Back alignment and structure |
|---|
| >3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 | Back alignment and structure |
|---|
| >3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 | Back alignment and structure |
|---|
| >3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 | Back alignment and structure |
|---|
| >2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 | Back alignment and structure |
|---|
| >3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 | Back alignment and structure |
|---|
| >3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 | Back alignment and structure |
|---|
| >3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 | Back alignment and structure |
|---|
| >4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 | Back alignment and structure |
|---|
| >4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 | Back alignment and structure |
|---|
| >3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 | Back alignment and structure |
|---|
| >3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 | Back alignment and structure |
|---|
| >3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 | Back alignment and structure |
|---|
| >3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 | Back alignment and structure |
|---|
| >3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 | Back alignment and structure |
|---|
| >3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 | Back alignment and structure |
|---|
| >3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 | Back alignment and structure |
|---|
| >2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 | Back alignment and structure |
|---|
| >2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 | Back alignment and structure |
|---|
| >2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 | Back alignment and structure |
|---|
| >3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 | Back alignment and structure |
|---|
| >3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 | Back alignment and structure |
|---|
| >3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 | Back alignment and structure |
|---|
| >3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 | Back alignment and structure |
|---|
| >3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 | Back alignment and structure |
|---|
| >3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 131 | Back alignment and structure |
|---|
| >2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 131 | Back alignment and structure |
|---|
| >2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 131 | Back alignment and structure |
|---|
| >2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 131 | Back alignment and structure |
|---|
| >3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Length = 130 | Back alignment and structure |
|---|
| >3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Length = 130 | Back alignment and structure |
|---|
| >3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Length = 130 | Back alignment and structure |
|---|
| >3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Length = 130 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 653 | |||
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 100.0 | |
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 100.0 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 100.0 | |
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 100.0 | |
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 100.0 | |
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 100.0 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 100.0 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 100.0 | |
| 2dat_A | 123 | Possible global transcription activator SNF2L2; br | 99.94 | |
| 3iu5_A | 116 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.94 | |
| 3mb4_A | 124 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.94 | |
| 3iu5_A | 116 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.93 | |
| 3ljw_A | 120 | Protein polybromo-1; alpha helix, alternative spli | 99.93 | |
| 3mb4_A | 124 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.93 | |
| 2dat_A | 123 | Possible global transcription activator SNF2L2; br | 99.93 | |
| 3k2j_A | 130 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.93 | |
| 3mqm_A | 126 | Probable histone-lysine N-methyltransferase ASH1L; | 99.93 | |
| 3ljw_A | 120 | Protein polybromo-1; alpha helix, alternative spli | 99.92 | |
| 3mqm_A | 126 | Probable histone-lysine N-methyltransferase ASH1L; | 99.92 | |
| 2grc_A | 129 | Probable global transcription activator SNF2L4; br | 99.92 | |
| 3k2j_A | 130 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.92 | |
| 2grc_A | 129 | Probable global transcription activator SNF2L4; br | 99.92 | |
| 3g0l_A | 117 | Hwalp4, bromodomain adjacent to zinc finger domain | 99.91 | |
| 3tlp_A | 150 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.91 | |
| 3g0l_A | 117 | Hwalp4, bromodomain adjacent to zinc finger domain | 99.91 | |
| 3d7c_A | 112 | General control of amino acid synthesis protein 5; | 99.9 | |
| 3tlp_A | 150 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.9 | |
| 2ouo_A | 130 | HUNK1 protein, bromodomain-containing protein 4; B | 99.9 | |
| 3jvl_A | 120 | Bromodomain-containing protein 4; alpha helical, N | 99.9 | |
| 2ouo_A | 130 | HUNK1 protein, bromodomain-containing protein 4; B | 99.9 | |
| 3d7c_A | 112 | General control of amino acid synthesis protein 5; | 99.9 | |
| 2oss_A | 127 | HUNK1 protein, bromodomain-containing protein 4; B | 99.9 | |
| 1e6i_A | 121 | Transcriptional activator GCN5; gene regulation, b | 99.9 | |
| 3iu6_A | 147 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.89 | |
| 2oss_A | 127 | HUNK1 protein, bromodomain-containing protein 4; B | 99.89 | |
| 1e6i_A | 121 | Transcriptional activator GCN5; gene regulation, b | 99.89 | |
| 2d9e_A | 121 | Peregrin; four-helix bundle, transcription activat | 99.89 | |
| 4alg_A | 154 | Bromodomain-containing protein 2; signaling protei | 99.89 | |
| 3nxb_A | 116 | CAT eye syndrome critical region protein 2; struct | 99.89 | |
| 3nxb_A | 116 | CAT eye syndrome critical region protein 2; struct | 99.89 | |
| 3q2e_A | 123 | Bromodomain and WD repeat-containing protein 1; st | 99.89 | |
| 2d9e_A | 121 | Peregrin; four-helix bundle, transcription activat | 99.89 | |
| 3mb3_A | 135 | PH-interacting protein; PHIP, pleckstrin homology | 99.89 | |
| 2i7k_A | 117 | Bromodomain-containing protein 7; helix, LEFT-hand | 99.89 | |
| 2i7k_A | 117 | Bromodomain-containing protein 7; helix, LEFT-hand | 99.88 | |
| 4alg_A | 154 | Bromodomain-containing protein 2; signaling protei | 99.88 | |
| 3mb3_A | 135 | PH-interacting protein; PHIP, pleckstrin homology | 99.88 | |
| 3q2e_A | 123 | Bromodomain and WD repeat-containing protein 1; st | 99.88 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 99.88 | |
| 3p1f_A | 119 | CREB-binding protein; structural genomics consorti | 99.88 | |
| 3jvl_A | 120 | Bromodomain-containing protein 4; alpha helical, N | 99.88 | |
| 2yyn_A | 135 | Transcription intermediary factor 1-alpha; bromo d | 99.88 | |
| 3uv4_A | 158 | Second bromodomain of human transcription initiat | 99.88 | |
| 3hme_A | 123 | Bromodomain-containing protein 9; BRD9, bromodomai | 99.88 | |
| 3hme_A | 123 | Bromodomain-containing protein 9; BRD9, bromodomai | 99.87 | |
| 3p1f_A | 119 | CREB-binding protein; structural genomics consorti | 99.87 | |
| 3rcw_A | 135 | Bromodomain-containing protein 1; transcription, s | 99.87 | |
| 3rcw_A | 135 | Bromodomain-containing protein 1; transcription, s | 99.87 | |
| 3fkm_X | 166 | Signaling protein; bromodomain, malaria, structura | 99.87 | |
| 3uv4_A | 158 | Second bromodomain of human transcription initiat | 99.86 | |
| 2yyn_A | 135 | Transcription intermediary factor 1-alpha; bromo d | 99.86 | |
| 3iu6_A | 147 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.86 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 99.86 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 99.85 | |
| 3fkm_X | 166 | Signaling protein; bromodomain, malaria, structura | 99.85 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 99.85 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 99.84 | |
| 3dai_A | 130 | ATPase family AAA domain-containing protein 2; anc | 99.84 | |
| 3dai_A | 130 | ATPase family AAA domain-containing protein 2; anc | 99.83 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 99.83 | |
| 2dkw_A | 131 | Hypothetical protein KIAA1240; bromodomain-like, f | 99.81 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 99.81 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 99.8 | |
| 2dkw_A | 131 | Hypothetical protein KIAA1240; bromodomain-like, f | 99.79 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 99.26 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 99.22 |
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=3e-45 Score=383.22 Aligned_cols=265 Identities=22% Similarity=0.349 Sum_probs=193.5
Q ss_pred CCCCCCccccccc-cCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCChHHHH----HHHHHHHHhhhhhcCCccc
Q psy15468 49 DCATLPPKRFIMG-KRRRASSLTRSVDDDDDSSSHTSETPTMQTRPKRKKIDPSDAM----QQIYDVIRNFKKEDGALLC 123 (653)
Q Consensus 49 ~~~~~~~~~~~~~-krr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~l~~~i~~~k~~~~~~~~ 123 (653)
+..+..||..+.+ ||||.++.++ +|.... +.+..+||+.+|...+ ..|++.|.++ ..+
T Consensus 3 ~~~~~~~k~~~~~kk~rr~~~~~~-----~d~~~~------~~~~~~rr~~~p~~~l~~~~~~il~~l~~~------~~a 65 (292)
T 3aad_A 3 HMVLKFPKQQLPPKKKRRVGTTVH-----CDYLNR------PHKSIHRRRTDPMVTLSSILESIINDMRDL------PNT 65 (292)
T ss_dssp -------------CCCCCSSCSCC-----CCC------------------CCHHHHHHHHHHHHHHHHSSS------TTC
T ss_pred ceEEecchhhcCccccCCCCCCCC-----CccccC------CcccccccccChHHHHHHHHHHHHHHHHhC------Ccc
Confidence 3455668887655 5556555543 333311 2345677888886544 5555555544 349
Q ss_pred cccccCCCCCCCCccccccCCccchHHHHHHHhcCCCCChhhHHHHHHHHhhcCCchHHHHhhhcccCcCCCHHHHHHHH
Q psy15468 124 DPFIRIPKKRQEPSYHEVVTNPIDFIKIQQKLKTDEYDDLSDFQADIELLVVTNPIDFIKIQQKLKTDEYDDLSDFQADI 203 (653)
Q Consensus 124 ~~F~~~v~~~~~PdYy~iI~~PmDL~tI~~kl~~~~y~~~~~~~~d~~l~~~~~P~d~~~~~~~~~~~~Y~~~~~f~~D~ 203 (653)
+||+.||+...+||||+||++||||+||++||+++. |.++.+|.+|+
T Consensus 66 ~~F~~pV~~~~~pdY~~iIk~PmDL~tIk~kl~~~~---------------------------------Y~s~~~f~~D~ 112 (292)
T 3aad_A 66 YPFHTPVNAKVVKDYYKIITRPMDLQTLRENVRKRL---------------------------------YPSREEFREHL 112 (292)
T ss_dssp GGGSSSCCTTTSTTHHHHCSSCCCHHHHHHHHHTTC---------------------------------CSSHHHHHHHH
T ss_pred hhhcCCCCchhcccHHHHcCCcCCHHHHHHHhhCCC---------------------------------cCCHHHHHHHH
Confidence 999999999999999999999999999999999999 99999999999
Q ss_pred HHHHHhhhccccCCCHHHHHHHHHHHHHHHHhhhccCCCCCCCccccccccccCCCcccCCCCCCCCChHHHHHHHHHHH
Q psy15468 204 ELLVKNAKTFYKRNSQEHRDAQELMELFHSTRNKLLNPQSHEGTSQKRSMDFMMASETEDSRDSSICTEDEQNQCEDLFN 283 (653)
Q Consensus 204 ~li~~Na~~yn~~~s~~~~~a~~l~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~ss~~~~~~~~~~~~ll~ 283 (653)
+|||+||..||+++|.++.+|..|.+.|.+.+.++... .....+.+.+..+ +++...|..+++
T Consensus 113 ~li~~Na~~yN~~~s~i~~~A~~L~~~~~~~~~~~~~~----~~~~e~~i~Pl~d-------------d~~~~~~~~~l~ 175 (292)
T 3aad_A 113 ELIVKNSATYNGPKHSLTQISQSMLDLCDEKLKEKEDK----LARLEKAINPLLD-------------DDDQVAFSFILD 175 (292)
T ss_dssp HHHHHHHHHHTCSSSHHHHHHTHHHHTTTTTGGGSHHH----HHHHHHTTSSSTT-------------CHHHHHHHHHHH
T ss_pred HHHHHHHHHHcCCchHHHHHHHHHHHHHHhhhhcchhh----hhhhhhccccccc-------------cchhHHHHHHHH
Confidence 99999999999999999999999999988877654110 0000011111111 122345666677
Q ss_pred HHHhccCCCCcccccccccccccCCCCCcccccCCcCCHHHHHHHhhCCCCCCHHHHHHHHHHHHHhhhhhCCCCCHHHH
Q psy15468 284 AVMTSTDADSRPLHEVFQLLPSKKRYPEYYDVIDVPIDLRTIARRIQDGKYASLGDMEKDLILMTKNACTFNEPGSQIYK 363 (653)
Q Consensus 284 ~l~~~~d~~g~~~a~~F~~~p~~~~~PdYy~iIk~PmDL~tI~~kl~~~~Y~s~~ef~~Dv~Lmf~Na~~yN~~~S~i~~ 363 (653)
.+...+- .++..+++|+.||+...+||||++|++||||+||++||++|.|.++++|..||+|||.||++||+++|.||.
T Consensus 176 ~i~~~~l-~~~~~s~~F~~pvd~~~~pdY~~iIk~PmdL~tI~~kl~~~~Y~s~~~f~~D~~Li~~Na~~yN~~~s~i~~ 254 (292)
T 3aad_A 176 NIVTQKM-MAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTK 254 (292)
T ss_dssp HHHHHTG-GGSTTCGGGTSCCCTTTSTTHHHHCSSCCCHHHHHHHHHTTCCSSHHHHHHHHHHHHHHHHHHHCTTSHHHH
T ss_pred HHhhhhh-hcCcchhHHHhcccccccccHHHHcCCcCCHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHHHHCCCCCHHHH
Confidence 6654321 245679999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHhhhc
Q psy15468 364 DAKALKKLVQTKKMEIEQ 381 (653)
Q Consensus 364 ~A~~L~~~~~~~~~~i~~ 381 (653)
+|..|+++|...+.++..
T Consensus 255 ~A~~L~~~~~~~~~~~~~ 272 (292)
T 3aad_A 255 TAQEIVNVCYQTLTEYDE 272 (292)
T ss_dssp HHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHH
Confidence 999999999999887753
|
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* | Back alignment and structure |
|---|
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A | Back alignment and structure |
|---|
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A | Back alignment and structure |
|---|
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* | Back alignment and structure |
|---|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} | Back alignment and structure |
|---|
| >3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A | Back alignment and structure |
|---|
| >3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} | Back alignment and structure |
|---|
| >3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A | Back alignment and structure |
|---|
| >3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A | Back alignment and structure |
|---|
| >2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} | Back alignment and structure |
|---|
| >3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A | Back alignment and structure |
|---|
| >3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} | Back alignment and structure |
|---|
| >2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A | Back alignment and structure |
|---|
| >3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A | Back alignment and structure |
|---|
| >3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A | Back alignment and structure |
|---|
| >3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A | Back alignment and structure |
|---|
| >3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A | Back alignment and structure |
|---|
| >3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* | Back alignment and structure |
|---|
| >3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* | Back alignment and structure |
|---|
| >2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* | Back alignment and structure |
|---|
| >3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A | Back alignment and structure |
|---|
| >2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... | Back alignment and structure |
|---|
| >1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 | Back alignment and structure |
|---|
| >3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} | Back alignment and structure |
|---|
| >2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... | Back alignment and structure |
|---|
| >1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 | Back alignment and structure |
|---|
| >2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A | Back alignment and structure |
|---|
| >3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 | Back alignment and structure |
|---|
| >3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 | Back alignment and structure |
|---|
| >3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A | Back alignment and structure |
|---|
| >3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A | Back alignment and structure |
|---|
| >3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* | Back alignment and structure |
|---|
| >2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A | Back alignment and structure |
|---|
| >3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} | Back alignment and structure |
|---|
| >3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} | Back alignment and structure |
|---|
| >3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A | Back alignment and structure |
|---|
| >3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A | Back alignment and structure |
|---|
| >2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A | Back alignment and structure |
|---|
| >3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 653 | ||||
| d3d7ca1 | 102 | a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T | 1e-21 | |
| d3d7ca1 | 102 | a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T | 2e-18 | |
| d3d7ca1 | 102 | a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T | 7e-10 | |
| d1eqfa2 | 128 | a.29.2.1 (A:1498-1625) TAFII250 double bromodomain | 7e-21 | |
| d1eqfa2 | 128 | a.29.2.1 (A:1498-1625) TAFII250 double bromodomain | 7e-19 | |
| d1eqfa2 | 128 | a.29.2.1 (A:1498-1625) TAFII250 double bromodomain | 7e-10 | |
| d1wuma1 | 118 | a.29.2.1 (A:715-832) P300/CAF histone acetyltransf | 2e-20 | |
| d1wuma1 | 118 | a.29.2.1 (A:715-832) P300/CAF histone acetyltransf | 2e-17 | |
| d1wuma1 | 118 | a.29.2.1 (A:715-832) P300/CAF histone acetyltransf | 8e-10 | |
| d1e6ia_ | 111 | a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c | 3e-20 | |
| d1e6ia_ | 111 | a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c | 1e-17 | |
| d1e6ia_ | 111 | a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c | 2e-09 | |
| d1eqfa1 | 139 | a.29.2.1 (A:1359-1497) TAFII250 double bromodomain | 6e-20 | |
| d1eqfa1 | 139 | a.29.2.1 (A:1359-1497) TAFII250 double bromodomain | 6e-20 | |
| d1eqfa1 | 139 | a.29.2.1 (A:1359-1497) TAFII250 double bromodomain | 6e-13 | |
| d3dwya1 | 114 | a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { | 6e-19 | |
| d3dwya1 | 114 | a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { | 2e-18 | |
| d3dwya1 | 114 | a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { | 2e-11 |
| >d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Bromodomain-like superfamily: Bromodomain family: Bromodomain domain: GCN5 species: Human (Homo sapiens) [TaxId: 9606]
Score = 87.7 bits (217), Expect = 1e-21
Identities = 29/95 (30%), Positives = 45/95 (47%)
Query: 466 LYNTIKETCEPKTGRQLSHIFQRLPSRHDYPDYYEVIRKPVDMEMIASKLRYNQYEHLDE 525
LY T+K + F + + PDYYEVIR P+D++ + +LR Y
Sbjct: 3 LYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKL 62
Query: 526 MVADFIQMFDNACKYNEPDSHIYKDALSLQRIVLQ 560
VAD ++ N +YN PDS + A +L++
Sbjct: 63 FVADLQRVIANCREYNPPDSEYCRCASALEKFFYF 97
|
| >d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
| >d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
| >d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
| >d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 | Back information, alignment and structure |
|---|
| >d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 | Back information, alignment and structure |
|---|
| >d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 | Back information, alignment and structure |
|---|
| >d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
| >d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
| >d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
| >d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 653 | |||
| d3d7ca1 | 102 | GCN5 {Human (Homo sapiens) [TaxId: 9606]} | 99.9 | |
| d1eqfa1 | 139 | TAFII250 double bromodomain module {Human (Homo sa | 99.89 | |
| d1e6ia_ | 111 | GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.89 | |
| d3d7ca1 | 102 | GCN5 {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d1eqfa2 | 128 | TAFII250 double bromodomain module {Human (Homo sa | 99.89 | |
| d1wuma1 | 118 | P300/CAF histone acetyltransferase bromodomain {Hu | 99.89 | |
| d1e6ia_ | 111 | GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.88 | |
| d1wuma1 | 118 | P300/CAF histone acetyltransferase bromodomain {Hu | 99.87 | |
| d1eqfa2 | 128 | TAFII250 double bromodomain module {Human (Homo sa | 99.87 | |
| d1eqfa1 | 139 | TAFII250 double bromodomain module {Human (Homo sa | 99.87 | |
| d3dwya1 | 114 | CREB-binding protein, CBP {Human (Homo sapiens) [T | 99.86 | |
| d3dwya1 | 114 | CREB-binding protein, CBP {Human (Homo sapiens) [T | 99.85 |
| >d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Bromodomain-like superfamily: Bromodomain family: Bromodomain domain: GCN5 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.90 E-value=4.9e-24 Score=186.78 Aligned_cols=99 Identities=27% Similarity=0.384 Sum_probs=94.1
Q ss_pred HHHHHHHHHHHHHhccCCCCcccccccccccccCCCCCcccccCCcCCHHHHHHHhhCCCCCCHHHHHHHHHHHHHhhhh
Q psy15468 274 EQNQCEDLFNAVMTSTDADSRPLHEVFQLLPSKKRYPEYYDVIDVPIDLRTIARRIQDGKYASLGDMEKDLILMTKNACT 353 (653)
Q Consensus 274 ~~~~~~~ll~~l~~~~d~~g~~~a~~F~~~p~~~~~PdYy~iIk~PmDL~tI~~kl~~~~Y~s~~ef~~Dv~Lmf~Na~~ 353 (653)
....|+.|+..|.++.+ +++|+.||++..+|+||++|++||||+||++||++|.|.++++|.+||+|||.||..
T Consensus 3 L~~~l~~il~~l~~~~~------s~~F~~pv~~~~~pdY~~~I~~PmdL~tI~~kl~~~~Y~s~~~f~~D~~li~~Na~~ 76 (102)
T d3d7ca1 3 LYTTLKNLLAQIKSHPS------AWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCRE 76 (102)
T ss_dssp HHHHHHHHHHHHHHSGG------GGGGSSCCCTTTSTTHHHHCSSCCCHHHHHHHHHTTCCCSHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHhCCC------CCccCCCCChhhCcCHHHHcCCccCHHHHHHHhccCccCCHHHHHHHHHHHHHHHHH
Confidence 35789999999998866 999999999999999999999999999999999999999999999999999999999
Q ss_pred hCCCCCHHHHHHHHHHHHHHHHHHh
Q psy15468 354 FNEPGSQIYKDAKALKKLVQTKKME 378 (653)
Q Consensus 354 yN~~~S~i~~~A~~L~~~~~~~~~~ 378 (653)
||+++|.+|.+|..|+++|.+++++
T Consensus 77 yN~~~s~~~~~A~~l~~~f~~~~ke 101 (102)
T d3d7ca1 77 YNPPDSEYCRCASALEKFFYFKLKE 101 (102)
T ss_dssp HSCTTSHHHHHHHHHHHHHHHHHHH
T ss_pred HCCCCCHHHHHHHHHHHHHHHHHhc
Confidence 9999999999999999999988764
|
| >d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|