Psyllid ID: psy15524


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930
MNITQVTTVQQLSIQPILDGGDVLVRSQTGSGKTLAYAIPIIQKLQEMRPKISRKDGIYAVIILPTRELALQTLEIFTKLCKSFTWIVPSWLTGGEKMKSEKARIRKGISILVATPGRLLDHCKHTETLKFSKVEHLVLDEADRILDQGYERDIAEFLEILKKQKPQFQSILLSATLTPATCWCKHTETLKFSKVEHLVLDEADRILDQGYERDIAEFLEILKKQKPQFQSVLLSATLTPAVQRLAGMTLQNPIQIDAADSTDIHNTTDSLVIPDSLKQHFIVTPPKLRLVALASFILGKCQNVNEDEESKMLVFMATQDMADYHTELLSTKKKIKKLKEYNIDPDNYEIPKKTEVKSGPISSLFQNNPDIPNVPTRRLKPVSEALFAPTSYEEFPGIHPFMKKNLNEGMNITQVTTVQQLSIQPILDGGDVLVRSQTGSGKTLAYAIPIIQKLQEMRPKISRKDGIYAVIILPTRELALQTLEIFTKLCKSFTWIVPSWLTGGEKMKSEKARIRKGISILVATPGRLLDHCKHTETLKFSKVEHLVLDEADRILDQGYERDIAEFLEILKKQKPQFQSILLSATLTPAVQRLAGMTLQNPIQIDAADSTDIHNTTDSLVIPDSLKQHFIVTPPKLRLVALASFILGKCQNVNEDEESKMLVFMATQDMADYHTELLSTVLGENIAFFKLHGSMSQSERTEVFKTFRSVKSGVLICTDVAARGLDLPLVDWIVQYTAPSSSTDYVHRVGRTARVGHEGSSLLFLIPSEVKLVEELQNRRIRIEEIKLKDCLQNLLSVKMEGDLSRLADGNVETAATALQMSFESAVLQQKILHTSACKGYTSWVRFYASYSKDLRHIFNFKQIHLGHFAKSFALRDAPSVISGIGKPKNKEELKNKKMAINKEKSFKQRGNFSKKQMLSEFDSGLPQRKP
cccccccHHHHHHHHHccccccEEEEcccccHHHHHHHHHHHHHHHHccccccccccEEEEEEcccHHHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHccccEEEEccccHHHHHcccccccccccEEEEEEcccHHcccccHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHccccccEEEEEEccHHHHHHHccHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHccccEEEEccccccccccccccccccccEEEEEEEcccHHHHHHHHHHHHHcccccccccccEEEEccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHHHHccccccccccEEEEEEcccHHHHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHccccEEEEcccHHHHHHccccccccccccEEEEEccccccccccHHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHHccccEEEEEcccccccccccccccccccEEEEEEEccccHHHHHHHHHHHcccccccccccEEEEEEcccHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHcccccEEEEccccccccccccccEEEEcccccccccccccccccccccccccEEEEEcHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHccccccEEHHHccccccccccccccccHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccc
cccccccHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHHcccccccccccEEEEEccHHHHHHHHHHHHHHHHcccccEEEEEEEcccccHHHHHHHHccccEEEEcccHHHHHHHccccEcHHHEEEEEEcHHHHHHHccccHHHHHHHHHccccccccEEEEEEccccHHHHHHHHHHHcccEEEEEEccccEEEEEEEccHHHHHHHHHHHHHcccccEEEEEEEccccHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHcccccEEEEcHHHHHHHHHHHHHHHHHccccccccEEEEEcccccHHHHHHHHHcccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccHcccccccHHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHHcccccccccccEEEEEccHHHHHHHHHHHHHHHHcccccEEEEEEEcccccHHHHHHHHccccEEEEcccHHHHHHHccccEcHHHEEEEEEcHHHHHHHccccHHHHHHHHHccccccccEEEEEEccccHHHHHHHHHHHcccEEEEEcccccccccccccccccccEEEEEEEccHHHHHHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHHHHHHcccccHHEcccccHHHHHHHHHHHHcccccEEEEEHHHHccccccccEEEEEEcccccHHHHEEEcccccccccccEEEEEEcccHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccHHHHHHHEHHHccHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccc
MNITQVTTVQqlsiqpildggdvlvrsqtgsgktlAYAIPIIQKLQEmrpkisrkdgiyaVIILPTRELALQTLEIFTKLCKSFTwivpswltggekmkSEKARIRKGISIlvatpgrlldhckhtetlkfskveHLVLDEADRILDQGYERDIAEFLEILKKQKPQFQSILLsatltpatcwckhtetlkfskveHLVLDEADRILDQGYERDIAEFLEILKKQKPQFQSVLLSATLTPAVQRLAgmtlqnpiqidaadstdihnttdslvipdslkqhfivtppKLRLVALASFILGkcqnvnedeESKMLVFMATQDMADYHTELLSTKKKIKKLKEynidpdnyeipkktevksgpisslfqnnpdipnvptrrlkpvsealfaptsyeefpgihpfmkknlnegmnitqVTTVQqlsiqpildggdvlvrsqtgsgktlAYAIPIIQKLQEmrpkisrkdgiyaVIILPTRELALQTLEIFTKLCKSFTwivpswltggekmkSEKARIRKGISIlvatpgrlldhckhtetlkfskveHLVLDEADRILDQGYERDIAEFLEILKKQKPQFQSILLSATLTPAVQRLAgmtlqnpiqidaadstdihnttdslvipdslkqhfivtppKLRLVALASFILGkcqnvnedeESKMLVFMATQDMADYHTELLSTVLGENIAFFklhgsmsqseRTEVFKTFRSVKSGVLICTDvaargldlplVDWIVqytapssstdyvhrvgrtarvghegssllFLIPSEVKLVEELQNRRIRIEEIKLKDCLQNLLSvkmegdlsrladgnVETAATALQMSFESAVLQQKILHTSACKGYTSWVRFYASYSKDLRHIFNfkqihlghfaksfalrdapsvisgigkpknkeELKNKKMAINKEKSfkqrgnfskKQMLSEfdsglpqrkp
mnitqvttvqqlsiqpildggDVLVRSQTGSGKTLAYAIPIIQKLQEMRPKISRKDGIYAVIILPTRELALQTLEIFTKLCKSFTWivpswltggekmksEKARIRKGISilvatpgrllDHCKHTEtlkfskvehlVLDEADRILDQGYERDIAEFLEILKKQKPQFQSILLSATLTPATCWCKHTETLKFSKVEHLVLDEADRILDQGYERDIAEFLEILKKQKPQFQSVLLSATLTPAVQRLAGMTLQNPIQIDAADSTDIHNTTDSLVIPDSLKQHFIVTPPKLRLVALASFILGKCQNVNEDEESKMLVFMATQDMADYHTELLSTKKKIKKLKeynidpdnyeipkktevksgpisslfqnnpdipnvptRRLKPVSEALFAPTSYEEFPGIHPFMKKNLNEGMNITQVTTVQQLSIQPILDGGDVLVRSQTGSGKTLAYAIPIIQKLQEMRPKISRKDGIYAVIILPTRELALQTLEIFTKLCKSFTWivpswltggekmksEKARIRKGISilvatpgrllDHCKHTEtlkfskvehlVLDEADRILDQGYERDIAEFLEILKKQKPQFQSILLSATLTPAVQRLAGMTLQNPIQIDAADSTDIHNTTDSLVIPDSLKQHFIVTPPKLRLVALASFILGKCQNVNEDEESKMLVFMATQDMADYHTELLSTVLGENIAFFKLHGSMSQSERTEVFKTFRSVKSGVLICTDVAARGLDLPLVDWIVQYtapssstdyvHRVGRTARVGHEGSSLLFLIPSEVKLVEELQNRririeeiklkDCLQNLLSVKMEGDLSRLADGNVETAATALQMSFESAVLQQKILHtsackgytsWVRFYASYSKDLRHIFNFKQIHLGHFAKSFALRDAPsvisgigkpknkeelknkkmainkeksfkqrgnfskkqmlsefdsglpqrkp
MNITQVTTVQQLSIQPILDGGDVLVRSQTGSGKTLAYAIPIIQKLQEMRPKISRKDGIYAVIILPTRELALQTLEIFTKLCKSFTWIVPSWLTGGEKMKSEKARIRKGISILVATPGRLLDHCKHTETLKFSKVEHLVLDEADRILDQGYERDIAEFLEILKKQKPQFQSILLSATLTPATCWCKHTETLKFSKVEHLVLDEADRILDQGYERDIAEFLEILKKQKPQFQSVLLSATLTPAVQRLAGMTLQNPIQIDAADSTDIHNTTDSLVIPDSLKQHFIVTPPKLRLVALASFILGKCQNVNEDEESKMLVFMATQDMADYHTELLSTkkkikklkEYNIDPDNYEIPKKTEVKSGPISSLFQNNPDIPNVPTRRLKPVSEALFAPTSYEEFPGIHPFMKKNLNEGMNITQVTTVQQLSIQPILDGGDVLVRSQTGSGKTLAYAIPIIQKLQEMRPKISRKDGIYAVIILPTRELALQTLEIFTKLCKSFTWIVPSWLTGGEKMKSEKARIRKGISILVATPGRLLDHCKHTETLKFSKVEHLVLDEADRILDQGYERDIAEFLEILKKQKPQFQSILLSATLTPAVQRLAGMTLQNPIQIDAADSTDIHNTTDSLVIPDSLKQHFIVTPPKLRLVALASFILGKCQNVNEDEESKMLVFMATQDMADYHTELLSTVLGENIAFFKLHGSMSQSERTEVFKTFRSVKSGVLICTDVAARGLDLPLVDWIVQYTAPSSSTDYVHRVGRTARVGHEGSSLLFLIPSEVKLVEELQNRRIRIEEIKLKDCLQNLLSVKMEGDLSRLADGNVETAATALQMSFESAVLQQKILHTSACKGYTSWVRFYASYSKDLRHIFNFKQIHLGHFAKSFALRDAPSVISGIGkpknkeelknkkMAINKEKSFKQRGNFSKKQMLSEFDSGLPQRKP
******TTVQQLSIQPILDGGDVLVRSQTGSGKTLAYAIPIIQKLQEMRPKISRKDGIYAVIILPTRELALQTLEIFTKLCKSFTWIVPSWLTGGEKMKSEKARIRKGISILVATPGRLLDHCKHTETLKFSKVEHLVLDEADRILDQGYERDIAEFLEILKKQKPQFQSILLSATLTPATCWCKHTETLKFSKVEHLVLDEADRILDQGYERDIAEFLEILKKQKPQFQSVLLSATLTPAVQRLAGMTLQNPIQIDAADSTDIHNTTDSLVIPDSLKQHFIVTPPKLRLVALASFILGKCQNVNEDEESKMLVFMATQDMADYHTELLSTKKKIKKLKEYNI*****************************************ALFAPTSYEEFPGIHPFMKKNLNEGMNITQVTTVQQLSIQPILDGGDVLVRSQTGSGKTLAYAIPIIQKLQEMRPKISRKDGIYAVIILPTRELALQTLEIFTKLCKSFTWIVPSWLTGGEKMKSEKARIRKGISILVATPGRLLDHCKHTETLKFSKVEHLVLDEADRILDQGYERDIAEFLEILKKQKPQFQSILLSATLTPAVQRLAGMTLQNPIQIDAADSTDIHNTTDSLVIPDSLKQHFIVTPPKLRLVALASFILGKCQNVNEDEESKMLVFMATQDMADYHTELLSTVLGENIAFFKLHGSMS**ERTEVFKTFRSVKSGVLICTDVAARGLDLPLVDWIVQYTAPSSSTDYVHRVGRTARVGHEGSSLLFLIPSEVKLVEELQNRRIRIEEIKLKDCLQNLLSVKMEGDLSRLADGNVETAATALQMSFESAVLQQKILHTSACKGYTSWVRFYASYSKDLRHIFNFKQIHLGHFAKSFALRDAPSVI*************************************************
MNITQVTTVQQLSIQPILDGGDVLVRSQTGSGKTLAYAIPIIQKLQEMRPK*SRKDGIYAVIILPTRELALQTLEIFTKLCKSFTWIVPSWLTGGEKMKS***RIRKGISILVATPGRLLDHCKHTETLKFSKVEHLVLDEADRILDQGYERDIAEFLEILKKQKPQFQSILLSATLTPATCWCKHTETLKFSKVEHLVLDEADRILDQGYERDIAEFLEILKKQKPQFQSVLLSATLTPAVQRLAGMTLQNPIQID*************LVIPDSLKQHFIVTPPKLRLVALASFIL*************************YHTELLSTKKKIKKLKEYNIDPDNYEIPKKTEVKSGPISSL*************************TSYEEFPGIHPFMKKNLNEGMNITQVTTVQQLSIQPILDGGDVLVRSQTGSGKTLAYAIPIIQKLQEMRP**SRKDGIYAVIILPTRELALQTLEIFTKLCKSFTWIVPSWLTGGEKMKSEKARIRKGISILVATPGRLLDHCKHTETLKFSKVEHLVLDEADRILDQGYERDIAEFLEILKKQKPQFQSILLSATLTPAVQRLAGMTLQNPIQIDAADST********LVIPDSLKQHFIVTPPKLRLVALASFILGKCQNVNEDEESKMLVFMATQDMADYHTELLSTVLGENIAFFKLHGSMSQSERTEVFKTFRSVKSGVLICTDVAARGLDLPLVDWIVQYTAPSSSTDYVHRVGRTARVGHEGSSLLFLIPSEVKLVEELQNRRIRIEEIKLKDCLQNLL*********************ALQMSFESAVLQQKILHTSACKGYTSWVRFYASYSKDLRHIFNFKQIHLGHFAKSFALRD***********************************************GL*****
*********QQLSIQPILDGGDVLVRSQTGSGKTLAYAIPIIQKLQEMRPKISRKDGIYAVIILPTRELALQTLEIFTKLCKSFTWIVPSWLTGGEKMKSEKARIRKGISILVATPGRLLDHCKHTETLKFSKVEHLVLDEADRILDQGYERDIAEFLEILKKQKPQFQSILLSATLTPATCWCKHTETLKFSKVEHLVLDEADRILDQGYERDIAEFLEILKKQKPQFQSVLLSATLTPAVQRLAGMTLQNPIQIDAADSTDIHNTTDSLVIPDSLKQHFIVTPPKLRLVALASFILGKCQNVNEDEESKMLVFMATQDMADYHTELLSTKKKIKKLKEYNIDPDNYEIPKKTEVKSGPISSLFQNNPDIPNVPTRRLKPVSEALFAPTSYEEFPGIHPFMKKNLNEGMNITQVTTVQQLSIQPILDGGDVLVRSQTGSGKTLAYAIPIIQKLQEMRPKISRKDGIYAVIILPTRELALQTLEIFTKLCKSFTWIVPSWLTGGEKMKSEKARIRKGISILVATPGRLLDHCKHTETLKFSKVEHLVLDEADRILDQGYERDIAEFLEILKKQKPQFQSILLSATLTPAVQRLAGMTLQNPIQIDAADSTDIHNTTDSLVIPDSLKQHFIVTPPKLRLVALASFILGKCQNVNEDEESKMLVFMATQDMADYHTELLSTVLGENIAFFKLHGSMSQSERTEVFKTFRSVKSGVLICTDVAARGLDLPLVDWIVQYTAPSSSTDYVHRVGRTARVGHEGSSLLFLIPSEVKLVEELQNRRIRIEEIKLKDCLQNLLSVKMEGDLSRLADGNVETAATALQMSFESAVLQQKILHTSACKGYTSWVRFYASYSKDLRHIFNFKQIHLGHFAKSFALRDAPSVISGIGKPKNKEELKNKKMAINKEKSFKQRGNFSKKQML************
*NITQVTTVQQLSIQPILDGGDVLVRSQTGSGKTLAYAIPIIQKLQEMRPKISRKDGIYAVIILPTRELALQTLEIFTKLCKSFTWIVPSWLTGGEKMKSEKARIRKGISILVATPGRLLDHCKHTETLKFSKVEHLVLDEADRILDQGYERDIAEFLEILKKQKPQFQSILLSATLTPATCWCKHTETLKFSKVEHLVLDEADRILDQGYERDIAEFLEILKKQKPQFQSVLLSATLTPAVQRLAGMTLQNPIQIDAADSTDIHNTTDSLVIPDSLKQHFIVTPPKLRLVALASFILGKCQNVNEDEESKMLVFMATQDMADYHTELLSTK*****************************SS*FQNNPDIPNVPTRRLK*VSEALFAPTSYEEFPGIHPFMKKNLNEGMNITQVTTVQQLSIQPILDGGDVLVRSQTGSGKTLAYAIPIIQKLQEMRPKISRKDGIYAVIILPTRELALQTLEIFTKLCKSFTWIVPSWLTGGEKMKSEKARIRKGISILVATPGRLLDHCKHTETLKFSKVEHLVLDEADRILDQGYERDIAEFLEILKKQKPQFQSILLSATLTPAVQRLAGMTLQNPIQIDAADSTDIHNTTDSLVIPDSLKQHFIVTPPKLRLVALASFILGKCQNVNEDEESKMLVFMATQDMADYHTELLSTVLGENIAFFKLHGSMSQSERTEVFKTFRSVKSGVLICTDVAARGLDLPLVDWIVQYTAPSSSTDYVHRVGRTARVGHEGSSLLFLIPSEVKLVEELQNRRIRIEEIKLKDCLQNLLSVKMEGDL*RLADGNVETAATALQMSFESAVLQQKILHTSACKGYTSWVRFYASYSKDLRHIFNFKQIHLGHFAKSFALRDAP****************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNITQVTTVQQLSIQPILDGGDVLVRSQTGSGKTLAYAIPIIQKLQEMRPKISRKDGIYAVIILPTRELALQTLEIFTKLCKSFTWIVPSWLTGGEKMKSEKARIRKGISILVATPGRLLDHCKHTETLKFSKVEHLVLDEADRILDQGYERDIAEFLEILKKQKPQFQSILLSATLTPATCWCKHTETLKFSKVEHLVLDEADRILDQGYERDIAEFLEILKKQKPQFQSVLLSATLTPAVQRLAGMTLQNPIQIDAADSTDIHNTTDSLVIPDSLKQHFIVTPPKLRLVALASFILGKCQNVNEDEESKMLVFMATQDMADYHTELLSTKKKIKKLKEYNIDPDNYEIPKKTEVKSGPISSLFQNNPDIPNVPTRRLKPVSEALFAPTSYEEFPGIHPFMKKNLNEGMNITQVTTVQQLSIQPILDGGDVLVRSQTGSGKTLAYAIPIIQKLQEMRPKISRKDGIYAVIILPTRELALQTLEIFTKLCKSFTWIVPSWLTGGEKMKSEKARIRKGISILVATPGRLLDHCKHTETLKFSKVEHLVLDEADRILDQGYERDIAEFLEILKKQKPQFQSILLSATLTPAVQRLAGMTLQNPIQIDAADSTDIHNTTDSLVIPDSLKQHFIVTPPKLRLVALASFILGKCQNVNEDEESKMLVFMATQDMADYHTELLSTVLGENIAFFKLHGSMSQSERTEVFKTFRSVKSGVLICTDVAARGLDLPLVDWIVQYTAPSSSTDYVHRVGRTARVGHEGSSLLFLIPSEVKLVEELQNRRIRIEEIKLKDCLQNLLSVKMEGDLSRLADGNVETAATALQMSFESAVLQQKILHTSACKGYTSWVRFYASYSKDLRHIFNFKQIHLGHFAKSFALRDAPSVISGIGKPKNKEELKNKKMAINKEKSFKQRGNFSKKQMLSEFDSGLPQRKP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query930 2.2.26 [Sep-21-2011]
Q9H8H2851 Probable ATP-dependent RN yes N/A 0.595 0.650 0.450 1e-138
Q86B47975 Probable ATP-dependent RN yes N/A 0.530 0.505 0.440 1e-134
Q7XJN0609 DEAD-box ATP-dependent RN yes N/A 0.539 0.824 0.387 4e-98
O60173709 ATP-dependent RNA helicas yes N/A 0.535 0.702 0.367 4e-93
Q0DLB9591 DEAD-box ATP-dependent RN yes N/A 0.531 0.835 0.355 3e-90
Q6C835799 ATP-dependent RNA helicas yes N/A 0.538 0.627 0.357 1e-87
A3LWH3733 ATP-dependent RNA helicas yes N/A 0.589 0.747 0.347 6e-86
Q59S50727 ATP-dependent RNA helicas N/A N/A 0.586 0.749 0.330 1e-84
Q0CF43769 ATP-dependent RNA helicas N/A N/A 0.580 0.702 0.330 2e-84
A1CB55755 ATP-dependent RNA helicas N/A N/A 0.562 0.692 0.346 2e-84
>sp|Q9H8H2|DDX31_HUMAN Probable ATP-dependent RNA helicase DDX31 OS=Homo sapiens GN=DDX31 PE=1 SV=2 Back     alignment and function desciption
 Score =  493 bits (1268), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 272/604 (45%), Positives = 371/604 (61%), Gaps = 50/604 (8%)

Query: 362 SSLFQNNPDIPNVPTRRLKPVSEALFAPTSYEEFPGIHPFMKKNLNEGMNITQVTTVQQL 421
           SSLF+NNPDIP +    +K V E +F   ++ E  G+HP +   +N  + ++ +T+VQ+ 
Sbjct: 202 SSLFKNNPDIPELHRPVVKQVQEKVFTSAAFHEL-GLHPHLISTINTVLKMSSMTSVQKQ 260

Query: 422 SIQPILDGGDVLVRSQTGSGKTLAYAIPIIQKLQEMRPKISRKDGIYAVIILPTRELALQ 481
           SI  +L+G D LVRSQTGSGKTLAY IP++Q LQ M  KI R DG YA++++PTRELALQ
Sbjct: 261 SIPVLLEGRDALVRSQTGSGKTLAYCIPVVQSLQAMESKIQRSDGPYALVLVPTRELALQ 320

Query: 482 TLEIFTKLCKSFTWIVPSWLTGGEKMKSEKARIRKGISILVATPGRLLDHCKHTETLKFS 541
           + +   KL K FTWIVP  L GGEK KSEKAR+RKGI+IL++TPGRL+DH K T+ + FS
Sbjct: 321 SFDTVQKLLKPFTWIVPGVLMGGEKRKSEKARLRKGINILISTPGRLVDHIKSTKNIHFS 380

Query: 542 KVEHLVLDEADRILDQGYERDIAEFLEILKKQKPQFQSILLSATLTPAVQRLAGMTLQNP 601
           ++  LV DEADRILD G+E+DI   L  +  +  + Q++LLSATLT  V RLA ++L +P
Sbjct: 381 RLRWLVFDEADRILDLGFEKDITVILNAVNAECQKRQNVLLSATLTEGVTRLADISLHDP 440

Query: 602 IQIDAADSTD-----------------IHNTTDSLVIPDSLKQHFIVTPPKLRLVALASF 644
           + I   D +                    +  DS  IP+SLKQH  V P KLRLV LA+F
Sbjct: 441 VSISVLDKSHDQLNPKDKAVQEVCPPPAGDKLDSFAIPESLKQHVTVVPSKLRLVCLAAF 500

Query: 645 ILGKCQNVNEDEESKMLVFMATQDMADYHTEL-LSTVLGENIA--------------FFK 689
           IL KC+    +E+ KM+VF ++ ++ ++H  L L T+L  + A              F +
Sbjct: 501 ILQKCKF---EEDQKMVVFFSSCELVEFHYSLFLQTLLSSSGAPASGQLPSASMRLKFLR 557

Query: 690 LHGSMSQSERTEVFKTFRSVKSGVLICTDVAARGLDLPLVDWIVQYTAPSSSTDYVHRVG 749
           LHG M Q ERT VF+ F   + GVL+CTDVAARGLDLP V WIVQY APSS  +Y+HR+G
Sbjct: 558 LHGGMEQEERTAVFQEFSHSRRGVLLCTDVAARGLDLPQVTWIVQYNAPSSPAEYIHRIG 617

Query: 750 RTARVGHEGSSLLFLIPSEVKLVEELQNRRIRIEEIKLKDCL-----QNLLSVKMEGDLS 804
           RTAR+G  GSSLL L PSE + V  L + +I + EIK++D L      +    K  G   
Sbjct: 618 RTARIGCHGSSLLILAPSEAEYVNSLASHKINVSEIKMEDILCVLTRDDCFKGKRWGAQK 677

Query: 805 RLADG--NVETAATALQMSFESAVLQQKILHTSACKGYTSWVRFYASYSKDLRHIFNFKQ 862
             A G   +   AT LQ  FE  V   +   + A K   S+++ YA+Y ++L+HIF+ + 
Sbjct: 678 SHAVGPQEIRERATVLQTVFEDYVHSSERRVSWAKKALQSFIQAYATYPRELKHIFHVRS 737

Query: 863 IHLGHFAKSFALRDAPSVISGIGKPKNKEELKNKKMAINKEKSFKQRGNFSKKQML-SEF 921
           +HLGH AKSF LRDAP  +S + + K K  +K   +        K +   S  ++L SE+
Sbjct: 738 LHLGHVAKSFGLRDAPRNLSALTRKKRKAHVKRPDL------HKKTQSKHSLAEILRSEY 791

Query: 922 DSGL 925
            SG+
Sbjct: 792 SSGM 795




Probable ATP-dependent RNA helicase.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q86B47|Y8611_DROME Probable ATP-dependent RNA helicase CG8611 OS=Drosophila melanogaster GN=CG8611 PE=1 SV=1 Back     alignment and function description
>sp|Q7XJN0|RH17_ARATH DEAD-box ATP-dependent RNA helicase 17 OS=Arabidopsis thaliana GN=RH17 PE=2 SV=1 Back     alignment and function description
>sp|O60173|DBP7_SCHPO ATP-dependent RNA helicase dbp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp7 PE=3 SV=1 Back     alignment and function description
>sp|Q0DLB9|RH17_ORYSJ DEAD-box ATP-dependent RNA helicase 17 OS=Oryza sativa subsp. japonica GN=Os05g0110500 PE=2 SV=2 Back     alignment and function description
>sp|Q6C835|DBP7_YARLI ATP-dependent RNA helicase DBP7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP7 PE=3 SV=1 Back     alignment and function description
>sp|A3LWH3|DBP7_PICST ATP-dependent RNA helicase DBP7 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DPB7 PE=3 SV=2 Back     alignment and function description
>sp|Q59S50|DBP7_CANAL ATP-dependent RNA helicase DBP7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP7 PE=3 SV=1 Back     alignment and function description
>sp|Q0CF43|DBP7_ASPTN ATP-dependent RNA helicase dbp7 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp7 PE=3 SV=2 Back     alignment and function description
>sp|A1CB55|DBP7_ASPCL ATP-dependent RNA helicase dbp7 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp7 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query930
307210507874 Probable ATP-dependent RNA helicase DDX3 0.621 0.661 0.507 1e-174
307179995871 Probable ATP-dependent RNA helicase DDX3 0.627 0.670 0.488 1e-170
242014121821 DEAD box ATP-dependent RNA helicase, put 0.578 0.655 0.506 1e-168
193676312642 PREDICTED: probable ATP-dependent RNA he 0.612 0.887 0.495 1e-158
405952846713 Putative ATP-dependent RNA helicase DDX3 0.618 0.806 0.458 1e-147
321460070757 hypothetical protein DAPPUDRAFT_309224 [ 0.594 0.730 0.458 1e-143
432876075761 PREDICTED: probable ATP-dependent RNA he 0.598 0.731 0.446 1e-139
291411436708 PREDICTED: DEAD (Asp-Glu-Ala-Asp) box po 0.609 0.800 0.443 1e-138
126297926730 PREDICTED: probable ATP-dependent RNA he 0.595 0.758 0.443 1e-138
395506322715 PREDICTED: probable ATP-dependent RNA he 0.551 0.717 0.465 1e-137
>gi|307210507|gb|EFN87010.1| Probable ATP-dependent RNA helicase DDX31 [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  617 bits (1591), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 320/631 (50%), Positives = 430/631 (68%), Gaps = 53/631 (8%)

Query: 342 NIDPDNYEIPKKTEVKSGPISSLFQNNPDIPNVPTRRLKPVSEALFAPTSYEEFPGIHPF 401
           N D D  + P+ +    G ISSLF NNPDIP +  R +KPV E +F   ++E+   IH  
Sbjct: 247 NDDRDLDKNPRLSHRPGGKISSLFGNNPDIPTIGQRFVKPVDEPIFTEITFEDL-NIHSH 305

Query: 402 MKKNLNEGMNITQVTTVQQLSIQPILDGGDVLVRSQTGSGKTLAYAIPIIQKLQEMRPKI 461
           M  NL + MNIT++TTVQQ +I  I    D+LVRSQTGSGKTLAYAIPI++ L ++RPK+
Sbjct: 306 MISNLAQNMNITKMTTVQQKAIPQIFSAKDILVRSQTGSGKTLAYAIPIVELLHKIRPKL 365

Query: 462 SRKDGIYAVIILPTRELALQTLEIFTKLCKSFTWIVPSWLTGGEKMKSEKARIRKGISIL 521
           +R  G+ A+I++PTREL LQT E F KL K FTWIVP +L GGEK K+EKAR+RKG ++L
Sbjct: 366 NRNSGLLALIVVPTRELTLQTYECFIKLVKPFTWIVPGYLIGGEKRKAEKARLRKGCNVL 425

Query: 522 VATPGRLLDHCKHTETLKFSKVEHLVLDEADRILDQGYERDIAEFLEILK----KQKPQF 577
           +ATPGRLLDH ++T+ LK  +V++ VLDEADR+LD GYE+DI+   +I +    K + + 
Sbjct: 426 IATPGRLLDHMQNTKALKLHEVKYFVLDEADRMLDMGYEKDISGTRDIEQNREDKDQSRR 485

Query: 578 QSILLSATLTPAVQRLAGMTLQNPIQIDAADST------DIHNTTDSLVIPDSLKQHFIV 631
           Q+ILLSATLT AV++LAG+ +++PI +DAA +       D+    + LV+P S+ Q++IV
Sbjct: 486 QTILLSATLTQAVEKLAGLAMRSPIFVDAAKANLEMSAGDVSEINEDLVVPQSVSQNYIV 545

Query: 632 TPPKLRLVALASFILGKCQNVNEDEESKMLVFMATQDMADYHTELLSTVLGE-------- 683
           TPPKLR+V L+++I GKCQ      + K+L+FMATQDM DYHTE+LS++L +        
Sbjct: 546 TPPKLRMVTLSAYIAGKCQTPG---QHKILIFMATQDMVDYHTEILSSILTKPINDDDED 602

Query: 684 -----NIAFFKLHGSMSQSERTEVFKTFRSVKSGVLICTDVAARGLDLPLVDWIVQYTAP 738
                ++ FFKL+G+M Q ERTEVFKTFR  KSGVL+CTDVAARGLD+P VD +VQYT P
Sbjct: 603 SDPLVDVEFFKLYGNMPQKERTEVFKTFRQAKSGVLLCTDVAARGLDMPKVDCVVQYTGP 662

Query: 739 SSSTDYVHRVGRTARVGHEGSSLLFLIPSEVKLVEELQNRRIRIEEIKLKDCLQNLLSVK 798
           +S+ DYVHR+GRTAR G  G+  +FL PSE+  V  L++RRIRI++  + D L  LL   
Sbjct: 663 TSARDYVHRIGRTARAGSSGTGTIFLTPSEIDFVRMLESRRIRIKQQDMNDVLDKLL--- 719

Query: 799 MEGDLSRLADGNVETAATALQMSFESAVLQQKILHTSACKGYTSWVRFYASYSKDLRHIF 858
             G LS+    +V+ AATALQ  FE+ +L+ + L+  ACK Y SWV FY+SY +D+R IF
Sbjct: 720 --GPLSK--HNSVQAAATALQNDFENLLLENRQLNAKACKAYASWVCFYSSYPRDMREIF 775

Query: 859 NFKQIHLGHFAKSFALRDAPSVISGIGK---------PKNKEELKNK-------KMAINK 902
           N K +HLGH+AKSFALRD P  I GI K         PK+   L NK       K+   +
Sbjct: 776 NRKALHLGHYAKSFALRDPPQRIGGISKRLREEESSRPKHNNRLSNKPSDGVSQKVPKGQ 835

Query: 903 EKSFKQRGNFSKKQML--SEFDSGL-PQRKP 930
           +   ++ G   + +ML  SE+DSGL P +KP
Sbjct: 836 DGEGQRTGLLKRVRMLNISEYDSGLEPLKKP 866




Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307179995|gb|EFN68085.1| Probable ATP-dependent RNA helicase DDX31 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|242014121|ref|XP_002427746.1| DEAD box ATP-dependent RNA helicase, putative [Pediculus humanus corporis] gi|212512187|gb|EEB15008.1| DEAD box ATP-dependent RNA helicase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|193676312|ref|XP_001947247.1| PREDICTED: probable ATP-dependent RNA helicase DDX31-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|405952846|gb|EKC20608.1| Putative ATP-dependent RNA helicase DDX31 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|321460070|gb|EFX71116.1| hypothetical protein DAPPUDRAFT_309224 [Daphnia pulex] Back     alignment and taxonomy information
>gi|432876075|ref|XP_004072964.1| PREDICTED: probable ATP-dependent RNA helicase DDX31-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|291411436|ref|XP_002721995.1| PREDICTED: DEAD (Asp-Glu-Ala-Asp) box polypeptide 31 [Oryctolagus cuniculus] Back     alignment and taxonomy information
>gi|126297926|ref|XP_001370951.1| PREDICTED: probable ATP-dependent RNA helicase DDX31 [Monodelphis domestica] Back     alignment and taxonomy information
>gi|395506322|ref|XP_003757483.1| PREDICTED: probable ATP-dependent RNA helicase DDX31 [Sarcophilus harrisii] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query930
FB|FBgn0027602 975 CG8611 [Drosophila melanogaste 0.248 0.236 0.537 4.6e-124
UNIPROTKB|F1S0U0784 DDX31 "Uncharacterized protein 0.351 0.417 0.431 2.5e-65
ZFIN|ZDB-GENE-030131-3973739 ddx31 "DEAD (Asp-Glu-Ala-Asp) 0.341 0.430 0.442 5.2e-77
UNIPROTKB|F8WAJ0722 DDX31 "Probable ATP-dependent 0.346 0.445 0.452 4.4e-68
UNIPROTKB|F1NM06690 DDX31 "Uncharacterized protein 0.345 0.465 0.430 5.1e-67
UNIPROTKB|F1N5H8736 DDX31 "Uncharacterized protein 0.361 0.456 0.424 1.2e-65
UNIPROTKB|Q9H8H2851 DDX31 "Probable ATP-dependent 0.346 0.378 0.452 3.3e-71
RGD|1304895682 Ddx31 "DEAD (Asp-Glu-Ala-Asp) 0.339 0.463 0.483 1.9e-76
DICTYBASE|DDB_G0271708 908 ddx31 "DEAD/DEAH box helicase" 0.268 0.275 0.449 1.4e-89
TAIR|locus:2064844609 AT2G40700 [Arabidopsis thalian 0.262 0.400 0.413 4.8e-88
FB|FBgn0027602 CG8611 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 665 (239.2 bits), Expect = 4.6e-124, Sum P(4) = 4.6e-124
 Identities = 129/240 (53%), Positives = 177/240 (73%)

Query:   377 RRLKPVSEALFAPTSYEEFPGIHPFMKKNLNEGMNITQVTTVQQLSIQPILDGGDVLVRS 436
             R +KPV E +F  +      G+HP   KNL + ++I ++T+VQQ +I  +L G DVLVRS
Sbjct:   314 RAVKPVKETIFTGSKISTL-GLHPHAVKNLEDLLSIRELTSVQQKTIPEVLQGKDVLVRS 372

Query:   437 QTGSGKTLAYAIPIIQKLQEMRPKISRKDGIYAVIILPTRELALQTLEIFTKLCKSFTWI 496
             QTGSGKTLAYA+P+++ LQ+ +P+I RKDG+ A++I+PTREL +QT E+  KL K +TWI
Sbjct:   373 QTGSGKTLAYALPLVELLQKQQPRIQRKDGVLALVIVPTRELVMQTYELIQKLVKPYTWI 432

Query:   497 VPSWLTGGEKMKSEKARIRKGISILVATPGRLLDHCKHTETLKFSKVEHLVLDEADRILD 556
             VP  L GGE  KSEKAR+RKGI+IL+ TPGRL+DH  HT + K +K++ L+LDEADR+L+
Sbjct:   433 VPGSLLGGESRKSEKARLRKGINILIGTPGRLVDHLLHTASFKLTKLQFLILDEADRLLE 492

Query:   557 QGYERDIAEFLEILKKQK--------PQFQSILLSATLTPAVQRLAGMTLQNPIQIDAAD 608
              GYERD+ + +E + KQ+        PQ Q +LLSATLT  VQ+LAG+TL+NP+ ID +D
Sbjct:   493 LGYERDVKQLVEAIDKQRAECEDKELPQLQRMLLSATLTSQVQQLAGLTLKNPLYIDNSD 552


GO:0004004 "ATP-dependent RNA helicase activity" evidence=ISS
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
UNIPROTKB|F1S0U0 DDX31 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-3973 ddx31 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 31" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F8WAJ0 DDX31 "Probable ATP-dependent RNA helicase DDX31" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NM06 DDX31 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1N5H8 DDX31 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H8H2 DDX31 "Probable ATP-dependent RNA helicase DDX31" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1304895 Ddx31 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 31" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0271708 ddx31 "DEAD/DEAH box helicase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2064844 AT2G40700 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.130.737
3rd Layer3.6.40.691

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query930
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 4e-94
cd00268203 cd00268, DEADc, DEAD-box helicases 1e-62
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 8e-60
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 2e-57
cd00268203 cd00268, DEADc, DEAD-box helicases 4e-56
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 5e-53
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 2e-51
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 2e-48
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 9e-47
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 2e-45
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 5e-44
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 4e-43
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 7e-41
PRK04537572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 3e-40
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 7e-39
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 4e-37
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 5e-37
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 8e-35
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 9e-33
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 9e-33
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 4e-30
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 4e-30
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 6e-30
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 6e-27
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 7e-26
PRK11634629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 2e-23
smart0049082 smart00490, HELICc, helicase superfamily c-termina 2e-23
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 6e-23
PRK04537572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 2e-22
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 5e-22
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 6e-22
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 9e-21
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 3e-18
pfam1395964 pfam13959, DUF4217, Domain of unknown function (DU 8e-17
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 1e-16
COG1205 851 COG1205, COG1205, Distinct helicase family with a 8e-13
COG1201814 COG1201, Lhr, Lhr-like helicases [General function 3e-11
TIGR00614470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, R 3e-11
COG0514590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 4e-11
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 2e-09
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 2e-09
TIGR01389591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 4e-09
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 8e-09
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 6e-08
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 5e-07
COG1204 766 COG1204, COG1204, Superfamily II helicase [General 5e-07
COG1205851 COG1205, COG1205, Distinct helicase family with a 7e-07
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 1e-06
PRK13767876 PRK13767, PRK13767, ATP-dependent helicase; Provis 1e-06
PRK13767 876 PRK13767, PRK13767, ATP-dependent helicase; Provis 1e-06
COG1204766 COG1204, COG1204, Superfamily II helicase [General 2e-06
PRK13766 773 PRK13766, PRK13766, Hef nuclease; Provisional 3e-06
TIGR04121 803 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA 7e-06
PRK09751 1490 PRK09751, PRK09751, putative ATP-dependent helicas 7e-05
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 2e-04
TIGR00643630 TIGR00643, recG, ATP-dependent DNA helicase RecG 8e-04
PRK11634629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 0.001
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 0.002
TIGR00614470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, R 0.003
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
 Score =  306 bits (786), Expect = 4e-94
 Identities = 130/397 (32%), Positives = 210/397 (52%), Gaps = 27/397 (6%)

Query: 389 PTSYEEFPGIHPFMKKNLNEGMNITQVTTVQQLSIQPILDGGDVLVRSQTGSGKTLAYAI 448
           P  +    G+ P + + L + +   + T +Q  +I  IL G DVL ++QTG+GKT A+ +
Sbjct: 28  PPEFASL-GLSPELLQALKD-LGFEEPTPIQLAAIPLILAGRDVLGQAQTGTGKTAAFLL 85

Query: 449 PIIQKLQEMRPKISRKDGIYAVIILPTRELALQTLEIFTKLCKSFTWIVPSWLTGGEKMK 508
           P++QK+     K   +  + A+I+ PTRELA+Q  E   KL K+   +  + + GG  ++
Sbjct: 86  PLLQKIL----KSVERKYVSALILAPTRELAVQIAEELRKLGKNLGGLRVAVVYGGVSIR 141

Query: 509 SEKARIRKGISILVATPGRLLDHCKHTETLKFSKVEHLVLDEADRILDQGYERDIAEFLE 568
            +   +++G+ I+VATPGRLLD       L  S VE LVLDEADR+LD G+  DI    +
Sbjct: 142 KQIEALKRGVDIVVATPGRLLDL-IKRGKLDLSGVETLVLDEADRMLDMGFIDDI---EK 197

Query: 569 ILKKQKPQFQSILLSATLTPAVQRLAGMTLQNPIQIDAADSTDIHNTTDSLVIPDSLKQH 628
           ILK   P  Q++L SAT+   ++ LA   L +P++I+ +                 +KQ 
Sbjct: 198 ILKALPPDRQTLLFSATMPDDIRELARRYLNDPVEIEVSVEK-------LERTLKKIKQF 250

Query: 629 FIVTPPKLRLVALASFILGKCQNVNEDEESKMLVFMATQDMADYHTELLSTVLGENIAFF 688
           ++    +   + L   +L       +++E +++VF+ T+ + +   E L           
Sbjct: 251 YLEVESEEEKLELLLKLL------KDEDEGRVIVFVRTKRLVEELAESLRK---RGFKVA 301

Query: 689 KLHGSMSQSERTEVFKTFRSVKSGVLICTDVAARGLDLPLVDWIVQYTAPSSSTDYVHRV 748
            LHG + Q ER    + F+  +  VL+ TDVAARGLD+P V  ++ Y  P    DYVHR+
Sbjct: 302 ALHGDLPQEERDRALEKFKDGELRVLVATDVAARGLDIPDVSHVINYDLPLDPEDYVHRI 361

Query: 749 GRTARVGHEGSSLLFLIPS-EVKLVEELQNRRIRIEE 784
           GRT R G +G ++ F+    EVK ++ ++ R  R   
Sbjct: 362 GRTGRAGRKGVAISFVTEEEEVKKLKRIEKRLERKLP 398


Length = 513

>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|222474 pfam13959, DUF4217, Domain of unknown function (DUF4217) Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|237497 PRK13767, PRK13767, ATP-dependent helicase; Provisional Back     alignment and domain information
>gnl|CDD|237497 PRK13767, PRK13767, ATP-dependent helicase; Provisional Back     alignment and domain information
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|237496 PRK13766, PRK13766, Hef nuclease; Provisional Back     alignment and domain information
>gnl|CDD|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated Back     alignment and domain information
>gnl|CDD|137505 PRK09751, PRK09751, putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|233069 TIGR00643, recG, ATP-dependent DNA helicase RecG Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 930
KOG0348|consensus708 100.0
KOG0345|consensus567 100.0
KOG0342|consensus543 100.0
KOG0343|consensus 758 100.0
KOG0330|consensus476 100.0
KOG0331|consensus519 100.0
KOG0338|consensus691 100.0
KOG0340|consensus442 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
KOG0333|consensus673 100.0
KOG0328|consensus400 100.0
KOG0336|consensus629 100.0
KOG0346|consensus569 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PTZ00110545 helicase; Provisional 100.0
KOG0326|consensus459 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
KOG0347|consensus731 100.0
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0335|consensus482 100.0
KOG0341|consensus610 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
KOG0339|consensus731 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0350|consensus620 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0334|consensus 997 100.0
KOG0337|consensus529 100.0
KOG0332|consensus477 100.0
KOG0327|consensus397 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
KOG4284|consensus 980 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
KOG0344|consensus593 100.0
PRK02362 737 ski2-like helicase; Provisional 100.0
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
PRK00254 720 ski2-like helicase; Provisional 100.0
PRK01172 674 ski2-like helicase; Provisional 100.0
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 100.0
KOG0329|consensus387 100.0
COG1201 814 Lhr Lhr-like helicases [General function predictio 100.0
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 100.0
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 100.0
PRK106891147 transcription-repair coupling factor; Provisional 100.0
KOG0952|consensus 1230 100.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 100.0
PRK09200790 preprotein translocase subunit SecA; Reviewed 100.0
TIGR00643630 recG ATP-dependent DNA helicase RecG. 100.0
KOG0330|consensus476 100.0
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 100.0
PHA02653675 RNA helicase NPH-II; Provisional 100.0
KOG0348|consensus708 100.0
KOG0331|consensus519 100.0
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 100.0
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
PRK09401 1176 reverse gyrase; Reviewed 100.0
COG1204 766 Superfamily II helicase [General function predicti 100.0
KOG0349|consensus725 100.0
PRK14701 1638 reverse gyrase; Provisional 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
COG1202 830 Superfamily II helicase, archaea-specific [General 100.0
KOG0352|consensus 641 100.0
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 100.0
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 100.0
KOG0338|consensus691 100.0
KOG0345|consensus567 100.0
KOG0342|consensus543 100.0
KOG0951|consensus1674 100.0
KOG0343|consensus758 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
PHA02558501 uvsW UvsW helicase; Provisional 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
KOG0351|consensus 941 100.0
KOG0346|consensus569 100.0
KOG0951|consensus 1674 100.0
KOG0333|consensus673 100.0
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 100.0
PTZ00110545 helicase; Provisional 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 100.0
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 100.0
COG1205 851 Distinct helicase family with a unique C-terminal 100.0
KOG0335|consensus482 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
KOG0340|consensus442 100.0
KOG0326|consensus459 100.0
PRK13766 773 Hef nuclease; Provisional 100.0
KOG0354|consensus746 100.0
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.98
KOG0328|consensus400 99.98
KOG0339|consensus731 99.98
KOG0336|consensus629 99.98
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 99.97
KOG0353|consensus695 99.97
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.97
PRK12904830 preprotein translocase subunit SecA; Reviewed 99.97
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 99.97
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.97
PRK05580679 primosome assembly protein PriA; Validated 99.97
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.97
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.97
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.97
KOG0334|consensus997 99.97
KOG0952|consensus 1230 99.96
KOG0337|consensus529 99.96
KOG0341|consensus610 99.96
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.96
PTZ00424401 helicase 45; Provisional 99.96
KOG0347|consensus731 99.96
PRK09694878 helicase Cas3; Provisional 99.96
KOG0350|consensus620 99.96
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.96
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.96
KOG0947|consensus 1248 99.95
TIGR03817742 DECH_helic helicase/secretion neighborhood putativ 99.95
KOG4284|consensus980 99.95
KOG0329|consensus387 99.95
COG1201814 Lhr Lhr-like helicases [General function predictio 99.95
PRK04914 956 ATP-dependent helicase HepA; Validated 99.95
KOG0327|consensus397 99.95
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.95
KOG0948|consensus 1041 99.94
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.94
PRK13767876 ATP-dependent helicase; Provisional 99.94
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.94
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.94
KOG0950|consensus 1008 99.93
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.93
PRK02362737 ski2-like helicase; Provisional 99.93
PLN031371195 ATP-dependent DNA helicase; Q4-like; Provisional 99.93
KOG0332|consensus477 99.93
PRK09401 1176 reverse gyrase; Reviewed 99.93
TIGR02621844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.93
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.92
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.92
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.92
COG1202830 Superfamily II helicase, archaea-specific [General 99.92
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.92
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 99.92
PRK00254720 ski2-like helicase; Provisional 99.91
COG1204766 Superfamily II helicase [General function predicti 99.91
PRK14701 1638 reverse gyrase; Provisional 99.91
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.91
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.91
COG1205851 Distinct helicase family with a unique C-terminal 99.91
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.91
PRK01172674 ski2-like helicase; Provisional 99.9
PRK12326764 preprotein translocase subunit SecA; Reviewed 99.9
KOG0344|consensus593 99.9
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 99.89
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.89
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.89
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.89
KOG0922|consensus 674 99.88
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.88
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.87
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 99.87
CHL00122870 secA preprotein translocase subunit SecA; Validate 99.87
PRK106891147 transcription-repair coupling factor; Provisional 99.86
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.86
KOG0923|consensus 902 99.85
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.85
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.85
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.84
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.84
KOG0949|consensus 1330 99.84
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.84
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.83
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.83
KOG0924|consensus 1042 99.83
KOG0352|consensus641 99.83
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.82
KOG0920|consensus 924 99.82
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 99.81
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.8
PHA02653675 RNA helicase NPH-II; Provisional 99.8
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.79
COG4096 875 HsdR Type I site-specific restriction-modification 99.79
KOG0351|consensus941 99.79
KOG0926|consensus 1172 99.78
PHA02558501 uvsW UvsW helicase; Provisional 99.78
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.78
PRK05298652 excinuclease ABC subunit B; Provisional 99.77
smart00487201 DEXDc DEAD-like helicases superfamily. 99.76
COG45811041 Superfamily II RNA helicase [DNA replication, reco 99.76
KOG0353|consensus695 99.76
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.75
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.75
TIGR01970819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.75
PRK11664812 ATP-dependent RNA helicase HrpB; Provisional 99.74
KOG4150|consensus 1034 99.74
KOG1123|consensus776 99.73
KOG0349|consensus725 99.73
KOG0354|consensus746 99.72
KOG0385|consensus 971 99.72
PRK13766773 Hef nuclease; Provisional 99.72
KOG0947|consensus1248 99.72
PRK12899970 secA preprotein translocase subunit SecA; Reviewed 99.71
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.7
smart00487201 DEXDc DEAD-like helicases superfamily. 99.7
PRK05580679 primosome assembly protein PriA; Validated 99.7
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 99.69
KOG0925|consensus 699 99.69
KOG0948|consensus1041 99.68
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 99.67
PRK09200790 preprotein translocase subunit SecA; Reviewed 99.66
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 99.65
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.65
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.65
KOG0390|consensus776 99.64
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.63
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.63
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.62
PRK13104896 secA preprotein translocase subunit SecA; Reviewed 99.62
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.62
PF1395965 DUF4217: Domain of unknown function (DUF4217) 99.62
PRK09694878 helicase Cas3; Provisional 99.61
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.6
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.58
KOG0387|consensus923 99.57
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.56
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.56
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.56
COG4889 1518 Predicted helicase [General function prediction on 99.54
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.54
KOG0950|consensus1008 99.53
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.52
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.51
KOG0392|consensus1549 99.51
KOG0953|consensus700 99.5
PRK12904830 preprotein translocase subunit SecA; Reviewed 99.49
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 99.48
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 99.46
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.45
PRK114481123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.45
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.45
smart0049082 HELICc helicase superfamily c-terminal domain. 99.45
KOG0389|consensus941 99.44
PRK14873665 primosome assembly protein PriA; Provisional 99.43
KOG1000|consensus689 99.42
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.42
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.4
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.37
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 99.36
KOG0384|consensus 1373 99.35
PRK13107908 preprotein translocase subunit SecA; Reviewed 99.32
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 99.3
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.15
KOG0949|consensus1330 99.14
COG4096875 HsdR Type I site-specific restriction-modification 99.12
KOG2340|consensus698 99.11
KOG1002|consensus791 99.08
PRK04914956 ATP-dependent helicase HepA; Validated 99.06
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 99.05
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.05
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 99.04
KOG0391|consensus 1958 99.0
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.99
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 98.99
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 98.99
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 98.96
PRK12326764 preprotein translocase subunit SecA; Reviewed 98.95
KOG0388|consensus1185 98.94
KOG0386|consensus 1157 98.94
PRK14873665 primosome assembly protein PriA; Provisional 98.94
smart00488289 DEXDc2 DEAD-like helicases superfamily. 98.93
smart00489289 DEXDc3 DEAD-like helicases superfamily. 98.93
PLN031421033 Probable chromatin-remodeling complex ATPase chain 98.9
KOG4439|consensus901 98.87
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 98.87
COG1643845 HrpA HrpA-like helicases [DNA replication, recombi 98.82
smart00488289 DEXDc2 DEAD-like helicases superfamily. 98.81
smart00489289 DEXDc3 DEAD-like helicases superfamily. 98.81
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.8
COG0610 962 Type I site-specific restriction-modification syst 98.74
KOG0920|consensus924 98.73
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 98.72
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 98.71
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 98.65
KOG1123|consensus776 98.64
PRK13103913 secA preprotein translocase subunit SecA; Reviewed 98.58
KOG0922|consensus674 98.57
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 98.55
PRK12902939 secA preprotein translocase subunit SecA; Reviewed 98.49
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 98.49
KOG0921|consensus 1282 98.45
KOG0926|consensus1172 98.4
KOG1015|consensus 1567 98.4
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 98.35
KOG2340|consensus698 98.3
PRK15483986 type III restriction-modification system StyLTI en 98.27
PRK15483 986 type III restriction-modification system StyLTI en 98.26
KOG4150|consensus1034 98.17
PRK12903925 secA preprotein translocase subunit SecA; Reviewed 98.15
KOG0385|consensus971 98.11
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 98.09
CHL00122870 secA preprotein translocase subunit SecA; Validate 98.08
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 98.05
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.05
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.01
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 98.01
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 98.01
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.97
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 97.96
COG3587 985 Restriction endonuclease [Defense mechanisms] 97.94
COG4889 1518 Predicted helicase [General function prediction on 97.93
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 97.92
KOG0390|consensus776 97.91
KOG0924|consensus1042 97.88
PF02399824 Herpes_ori_bp: Origin of replication binding prote 97.85
KOG0387|consensus923 97.83
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 97.79
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.77
KOG0925|consensus699 97.77
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.74
KOG0391|consensus 1958 97.73
COG0610962 Type I site-specific restriction-modification syst 97.7
KOG0389|consensus941 97.69
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.68
KOG0923|consensus902 97.66
KOG1000|consensus689 97.62
KOG1803|consensus649 97.61
KOG4439|consensus901 97.59
PRK10536262 hypothetical protein; Provisional 97.52
KOG1002|consensus791 97.49
KOG1803|consensus649 97.46
TIGR00376637 DNA helicase, putative. The gene product may repre 97.44
KOG1016|consensus 1387 97.44
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.42
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 97.41
PF1324576 AAA_19: Part of AAA domain 97.39
PRK10875615 recD exonuclease V subunit alpha; Provisional 97.38
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 97.37
KOG1802|consensus935 97.34
TIGR00376637 DNA helicase, putative. The gene product may repre 97.32
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 97.32
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 97.3
KOG1802|consensus935 97.28
PF1324576 AAA_19: Part of AAA domain 97.25
PRK10536262 hypothetical protein; Provisional 97.19
KOG0953|consensus700 97.03
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 96.98
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 96.94
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 96.8
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 96.78
PRK10875615 recD exonuclease V subunit alpha; Provisional 96.78
PRK129001025 secA preprotein translocase subunit SecA; Reviewed 96.78
PRK129011112 secA preprotein translocase subunit SecA; Reviewed 96.75
PRK13889 988 conjugal transfer relaxase TraA; Provisional 96.72
COG3587985 Restriction endonuclease [Defense mechanisms] 96.7
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 96.67
KOG1132|consensus 945 96.62
KOG1132|consensus945 96.62
KOG0392|consensus1549 96.56
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.56
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 96.54
PRK06526254 transposase; Provisional 96.52
KOG1805|consensus1100 96.5
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 96.49
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 96.48
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 96.47
KOG0921|consensus1282 96.38
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 96.37
KOG1805|consensus1100 96.33
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 96.32
PHA02533534 17 large terminase protein; Provisional 96.3
KOG0386|consensus1157 96.29
KOG0384|consensus1373 96.24
COG0556663 UvrB Helicase subunit of the DNA excision repair c 96.24
PRK08181269 transposase; Validated 96.22
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.21
PHA02533534 17 large terminase protein; Provisional 96.2
KOG0989|consensus346 96.12
KOG0388|consensus1185 96.07
smart00492141 HELICc3 helicase superfamily c-terminal domain. 96.05
PRK13889988 conjugal transfer relaxase TraA; Provisional 96.01
PRK04296190 thymidine kinase; Provisional 95.99
PRK13826 1102 Dtr system oriT relaxase; Provisional 95.96
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 95.95
PRK08181269 transposase; Validated 95.9
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 95.9
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 95.85
PRK07952244 DNA replication protein DnaC; Validated 95.83
smart00491142 HELICc2 helicase superfamily c-terminal domain. 95.81
PRK06526254 transposase; Provisional 95.74
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 95.7
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 95.68
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 95.64
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 95.62
PRK00149450 dnaA chromosomal replication initiation protein; R 95.62
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 95.53
PF05876557 Terminase_GpA: Phage terminase large subunit (GpA) 95.46
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 95.32
COG1484254 DnaC DNA replication protein [DNA replication, rec 95.31
PRK07952244 DNA replication protein DnaC; Validated 95.29
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.27
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 95.21
PF13871278 Helicase_C_4: Helicase_C-like 95.09
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 95.08
PRK04296190 thymidine kinase; Provisional 95.07
COG0653822 SecA Preprotein translocase subunit SecA (ATPase, 95.02
cd01124187 KaiC KaiC is a circadian clock protein primarily f 94.98
PRK08084235 DNA replication initiation factor; Provisional 94.9
PRK08727233 hypothetical protein; Validated 94.89
PRK12377248 putative replication protein; Provisional 94.88
PRK06921266 hypothetical protein; Provisional 94.85
KOG0298|consensus 1394 94.77
PRK14087450 dnaA chromosomal replication initiation protein; P 94.76
PRK138261102 Dtr system oriT relaxase; Provisional 94.69
PHA03368738 DNA packaging terminase subunit 1; Provisional 94.66
PRK06893229 DNA replication initiation factor; Validated 94.63
PHA03368738 DNA packaging terminase subunit 1; Provisional 94.59
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 94.58
KOG0989|consensus346 94.55
cd01124187 KaiC KaiC is a circadian clock protein primarily f 94.53
COG3421812 Uncharacterized protein conserved in bacteria [Fun 94.5
PRK08116268 hypothetical protein; Validated 94.47
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 94.44
PF05876557 Terminase_GpA: Phage terminase large subunit (GpA) 94.42
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 94.41
TIGR00362405 DnaA chromosomal replication initiator protein Dna 94.38
smart00382148 AAA ATPases associated with a variety of cellular 94.36
PRK12377248 putative replication protein; Provisional 94.34
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 94.33
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 94.31
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 94.31
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 94.3
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 94.25
PRK00149450 dnaA chromosomal replication initiation protein; R 94.24
PRK05642234 DNA replication initiation factor; Validated 94.23
PRK08116268 hypothetical protein; Validated 94.21
PRK14974336 cell division protein FtsY; Provisional 94.2
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 94.19
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 94.15
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 94.15
PRK05642234 DNA replication initiation factor; Validated 94.13
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 94.08
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 94.07
smart00382148 AAA ATPases associated with a variety of cellular 94.02
PRK08727233 hypothetical protein; Validated 94.02
PRK06835329 DNA replication protein DnaC; Validated 94.02
PHA03333752 putative ATPase subunit of terminase; Provisional 94.02
PRK11054684 helD DNA helicase IV; Provisional 93.98
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 93.97
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 93.93
PTZ001121164 origin recognition complex 1 protein; Provisional 93.81
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 93.8
PTZ001121164 origin recognition complex 1 protein; Provisional 93.71
PRK10919672 ATP-dependent DNA helicase Rep; Provisional 93.71
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 93.64
CHL00181287 cbbX CbbX; Provisional 93.56
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 93.55
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 93.52
KOG1001|consensus674 93.5
PRK06893229 DNA replication initiation factor; Validated 93.47
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 93.46
TIGR00362405 DnaA chromosomal replication initiator protein Dna 93.46
PRK08084235 DNA replication initiation factor; Provisional 93.45
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 93.44
PRK14086617 dnaA chromosomal replication initiation protein; P 93.42
PRK14087450 dnaA chromosomal replication initiation protein; P 93.41
PRK00411394 cdc6 cell division control protein 6; Reviewed 93.41
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 93.25
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 93.2
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 93.2
TIGR01075715 uvrD DNA helicase II. Designed to identify uvrD me 93.05
PLN03025319 replication factor C subunit; Provisional 92.98
PRK08769319 DNA polymerase III subunit delta'; Validated 92.96
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 92.93
PHA03372668 DNA packaging terminase subunit 1; Provisional 92.9
PRK147121623 conjugal transfer nickase/helicase TraI; Provision 92.87
PRK11773721 uvrD DNA-dependent helicase II; Provisional 92.85
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 92.81
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 92.8
PRK11054684 helD DNA helicase IV; Provisional 92.8
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 92.8
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 92.79
PRK06835329 DNA replication protein DnaC; Validated 92.77
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 92.76
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 92.75
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 92.75
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 92.73
PHA03333752 putative ATPase subunit of terminase; Provisional 92.68
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 92.67
PRK00411394 cdc6 cell division control protein 6; Reviewed 92.61
PRK05298652 excinuclease ABC subunit B; Provisional 92.59
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 92.57
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 92.52
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 92.51
>KOG0348|consensus Back     alignment and domain information
Probab=100.00  E-value=6.9e-102  Score=808.72  Aligned_cols=519  Identities=48%  Similarity=0.784  Sum_probs=474.0

Q ss_pred             cccccccccccCCCCC-CCCCCCCCCCCccccCCCCCCCCCCCCCHHHHHHHHhcCCCCCCCHHHHHhHHhhhcCCcEEE
Q psy15524        356 VKSGPISSLFQNNPDI-PNVPTRRLKPVSEALFAPTSYEEFPGIHPFMKKNLNEGMNITQVTTVQQLSIQPILDGGDVLV  434 (930)
Q Consensus       356 ~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~f~~l~~l~~~~~~~l~~~~~~~~~~~iQ~~~i~~il~~~d~lv  434 (930)
                      ....+.++.+.+++++ ++++.+.++++.+..|....|.+| ||+|.+.+.|.+.|++..||.+|+++||.+++|+|++|
T Consensus       101 ~Q~~k~~~~~~~~~~i~~~lh~~vvk~v~e~~fts~~f~~L-GL~~~lv~~L~~~m~i~~pTsVQkq~IP~lL~grD~lV  179 (708)
T KOG0348|consen  101 KQFAKDSSKAKENPDIAPNLHRPVVKQVSEAPFTSAAFASL-GLHPHLVSHLNTKMKISAPTSVQKQAIPVLLEGRDALV  179 (708)
T ss_pred             hhhhhchhhhccCCccchhhcchhhccccccccccccchhc-CCCHHHHHHHHHHhccCccchHhhcchhhhhcCcceEE
Confidence            3344556778888888 688888999999999999999999 99999999999999999999999999999999999999


Q ss_pred             EccCCCchhHHhhHHHHHHHHhhCcccCCCCCeeEEEEccCHHHHHHHHHHHHHhhccCCCcceEEEeCCCchHHHHHHH
Q psy15524        435 RSQTGSGKTLAYAIPIIQKLQEMRPKISRKDGIYAVIILPTRELALQTLEIFTKLCKSFTWIVPSWLTGGEKMKSEKARI  514 (930)
Q Consensus       435 ~a~TGsGKTl~~~lp~l~~l~~~~~~~~~~~~~~~lil~PtreLa~Q~~~~~~~~~~~~~~~~~~~~~gg~~~~~~~~~~  514 (930)
                      .|+||||||++|++|+++.|+.+.+++.|.+|+.+|||+||||||.|+|+.++++.+.+.|++++.++||++.+++++++
T Consensus       180 ~aQTGSGKTLAYllPiVq~Lq~m~~ki~Rs~G~~ALVivPTREL~~Q~y~~~qKLl~~~hWIVPg~lmGGEkkKSEKARL  259 (708)
T KOG0348|consen  180 RAQTGSGKTLAYLLPIVQSLQAMEPKIQRSDGPYALVIVPTRELALQIYETVQKLLKPFHWIVPGVLMGGEKKKSEKARL  259 (708)
T ss_pred             EcCCCCcccHHHHHHHHHHHHhcCccccccCCceEEEEechHHHHHHHHHHHHHHhcCceEEeeceeecccccccHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcCCcEEEECchhHHHhhhccCCcccccceEEEEecchhhhhcCcHHHHHHHHHHHhh----------cCccceEEEEcc
Q psy15524        515 RKGISILVATPGRLLDHCKHTETLKFSKVEHLVLDEADRILDQGYERDIAEFLEILKK----------QKPQFQSILLSA  584 (930)
Q Consensus       515 ~~~~~Ilv~Tp~rl~~~l~~~~~~~~~~l~~lVlDEah~l~~~g~~~~l~~i~~~l~~----------~~~~~q~vl~SA  584 (930)
                      ++|++|+|+|||||+||+.++..+.+++++|||+||||+++++||++++..|++.+..          .+++.|.+++||
T Consensus       260 RKGiNILIgTPGRLvDHLknT~~i~~s~LRwlVlDEaDrlleLGfekdit~Il~~v~~~~~~e~~~~~lp~q~q~mLlSA  339 (708)
T KOG0348|consen  260 RKGINILIGTPGRLVDHLKNTKSIKFSRLRWLVLDEADRLLELGFEKDITQILKAVHSIQNAECKDPKLPHQLQNMLLSA  339 (708)
T ss_pred             hcCceEEEcCchHHHHHHhccchheeeeeeEEEecchhHHHhccchhhHHHHHHHHhhccchhcccccccHHHHhHhhhh
Confidence            9999999999999999999999999999999999999999999999999999999943          233589999999


Q ss_pred             ccCHHHHHHHhhhcCCCEEEEccCCCC----------------cccCccceecCCCceEEEEEcCchhhHHHHHHHHHhh
Q psy15524        585 TLTPAVQRLAGMTLQNPIQIDAADSTD----------------IHNTTDSLVIPDSLKQHFIVTPPKLRLVALASFILGK  648 (930)
Q Consensus       585 T~~~~~~~l~~~~~~~~~~i~~~~~~~----------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~  648 (930)
                      |+++.+.++++..+.||+.|..+....                .....+.+.+|+.+.|.|.++|++.|+..|.++|.+.
T Consensus       340 TLtd~V~rLa~~sLkDpv~I~ld~s~~~~~p~~~a~~ev~~~~~~~~l~~~~iPeqL~qry~vVPpKLRLV~Laa~L~~~  419 (708)
T KOG0348|consen  340 TLTDGVNRLADLSLKDPVYISLDKSHSQLNPKDKAVQEVDDGPAGDKLDSFAIPEQLLQRYTVVPPKLRLVALAALLLNK  419 (708)
T ss_pred             hhHHHHHHHhhccccCceeeeccchhhhcCcchhhhhhcCCcccccccccccCcHHhhhceEecCCchhHHHHHHHHHHH
Confidence            999999999999999999998332211                0111244789999999999999999999999999998


Q ss_pred             ccCCCcCCCceEEEEecchhhHHHHHHHHhhhcCC-------------------CceEEEecCCCCHHHHHHHHHHhhcC
Q psy15524        649 CQNVNEDEESKMLVFMATQDMADYHTELLSTVLGE-------------------NIAFFKLHGSMSQSERTEVFKTFRSV  709 (930)
Q Consensus       649 ~~~~~~~~~~k~iVF~~s~~~~~~~~~~l~~~~~~-------------------~~~~~~lhg~~~~~~R~~v~~~F~~~  709 (930)
                      +....   ..++|||+++++.+++++++|.+.+..                   +..++.+||+|+|++|..+++.|...
T Consensus       420 ~k~~~---~qk~iVF~S~~d~VeFHy~lf~~~l~~~~e~~s~~~~s~g~~~l~~~~k~~rLHGsm~QeeRts~f~~Fs~~  496 (708)
T KOG0348|consen  420 VKFEE---KQKMIVFFSCSDSVEFHYSLFSEALLSHLEGSSGAPDSEGLPPLFMDLKFYRLHGSMEQEERTSVFQEFSHS  496 (708)
T ss_pred             hhhhh---hceeEEEEechhHHHHHHHHHHhhhhcccccccCCcccCCChhhhhcceEEEecCchhHHHHHHHHHhhccc
Confidence            87655   679999999999999999999876532                   56799999999999999999999999


Q ss_pred             CCcEEEeccccccccCCCCccEEEEecCCCChhhHHhhhcccccCCCCceEEEEeCcccHHHHHHHHhcCCccchhchHH
Q psy15524        710 KSGVLICTDVAARGLDLPLVDWIVQYTAPSSSTDYVHRVGRTARVGHEGSSLLFLIPSEVKLVEELQNRRIRIEEIKLKD  789 (930)
Q Consensus       710 ~~~vLv~T~~~~~GlDip~v~~VI~~~~p~s~~~y~qr~GRagR~g~~g~~~~~~~~~e~~~~~~l~~~~~~~~~~~~~~  789 (930)
                      +..||+||||++||+|+|+|+|||+||+|.++++|+||+|||+|+|..|.+++|+.|.|.+|++.++.+.+.+.+..+..
T Consensus       497 ~~~VLLcTDVAaRGLDlP~V~~vVQYd~P~s~adylHRvGRTARaG~kG~alLfL~P~Eaey~~~l~~~~~~l~q~~~~~  576 (708)
T KOG0348|consen  497 RRAVLLCTDVAARGLDLPHVGLVVQYDPPFSTADYLHRVGRTARAGEKGEALLFLLPSEAEYVNYLKKHHIMLLQFDMEI  576 (708)
T ss_pred             cceEEEehhhhhccCCCCCcCeEEEeCCCCCHHHHHHHhhhhhhccCCCceEEEecccHHHHHHHHHhhcchhhccchhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999988888888777


Q ss_pred             HHHhhhhhhccCccccccccchHHHHHHHHHHHHHHHHhcHHHHHHHhhhhHHHHHHhhhcccccccccccccCChHHHH
Q psy15524        790 CLQNLLSVKMEGDLSRLADGNVETAATALQMSFESAVLQQKILHTSACKGYTSWVRFYASYSKDLRHIFNFKQIHLGHFA  869 (930)
Q Consensus       790 ~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~a~~s~~~~y~~~~~~~~~~f~~~~l~~~~~a  869 (930)
                      ++..+.-...     +....++++++..+|..++.++..++.+..+|.+||+||+|+|++|+.+++.||+++.||+||+|
T Consensus       577 ~l~~~~~~~~-----k~~~~e~~~~at~~q~~~e~~~~~~~~~~~~a~kaf~S~vr~Yath~~elk~iFnvr~lHlGH~A  651 (708)
T KOG0348|consen  577 LLPAFKPRKD-----KAKTKEWQERATTLQLNLERLVVGDEAMKNLAKKAFVSWVRAYATHPSELKSIFNVRFLHLGHVA  651 (708)
T ss_pred             hhhhcCcccc-----cccchhhhhhHHHHHHHHHHHHhccHHHHHHHHHHHHHHHHHHhhChhhhccceehhhhhhhHHH
Confidence            7665541111     11234788999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhcCCCCCCccccc
Q psy15524        870 KSFALRDAPSVISG  883 (930)
Q Consensus       870 ~sf~l~~~p~~~~~  883 (930)
                      +||||++.|..+.+
T Consensus       652 KSFaLReaP~k~~g  665 (708)
T KOG0348|consen  652 KSFALREAPGKLSG  665 (708)
T ss_pred             HhhHhhhcchhhhc
Confidence            99999999966553



>KOG0345|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF13959 DUF4217: Domain of unknown function (DUF4217) Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>KOG1132|consensus Back     alignment and domain information
>KOG1132|consensus Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PHA03372 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query930
3sqw_A579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 7e-51
3sqx_A512 Structure Of Mss116p (Nte And C-Tail Double Deletio 9e-51
3i5x_A563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 1e-50
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 6e-42
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 4e-38
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 4e-38
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 4e-38
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 5e-38
2hyi_C413 Structure Of The Human Exon Junction Complex With A 5e-38
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 8e-38
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 9e-38
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 3e-37
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 9e-35
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 1e-34
3ly5_A262 Ddx18 Dead-Domain Length = 262 3e-32
2pl3_A236 Human Dead-Box Rna Helicase Ddx10, Dead Domain In C 6e-32
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 3e-29
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 7e-29
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 8e-29
2vso_A395 Crystal Structure Of A Translation Initiation Compl 2e-28
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 3e-28
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 3e-28
1fuu_A394 Yeast Initiation Factor 4a Length = 394 8e-27
3ber_A249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 3e-26
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 7e-26
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 7e-26
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 2e-25
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 4e-25
4db4_A256 Mss116p Dead-Box Helicase Domain 2 Bound To A Chima 9e-24
4db2_C257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 9e-24
4db2_A257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 1e-23
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 1e-23
3fe2_A242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 1e-23
1vec_A206 Crystal Structure Of The N-Terminal Domain Of RckP5 4e-23
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 6e-22
3fht_A412 Crystal Structure Of Human Dbp5 In Complex With Amp 6e-22
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 7e-22
3fmp_B479 Crystal Structure Of The Nucleoporin Nup214 In Comp 8e-22
1wrb_A253 Crystal Structure Of The N-Terminal Reca-Like Domai 2e-21
3fho_B508 Structure Of S. Pombe Dbp5 Length = 508 4e-21
3iuy_A228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 2e-19
1qde_A224 Crystal Structure Of The Atpase Domain Of Translati 1e-18
1qva_A223 Yeast Initiation Factor 4a N-Terminal Domain Length 2e-18
3bor_A237 Crystal Structure Of The Deadc Domain Of Human Tran 7e-17
1q0u_A219 Crystal Structure Of The Bstdead N-Terminal Domain 9e-17
2jgn_A185 Ddx3 Helicase Domain Length = 185 6e-16
1t6n_A220 Crystal Structure Of The N-Terminal Domain Of Human 2e-15
2g9n_A221 Structure Of The Dead Domain Of Human Eukaryotic In 5e-14
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 2e-13
3dkp_A245 Human Dead-Box Rna-Helicase Ddx52, Conserved Domain 7e-13
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 1e-12
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 3e-12
2yjt_D170 Crystal Structure Of E. Coli Dead-Box Protein Srmb 5e-12
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 1e-11
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 1e-11
2wax_A193 Structure Of The Human Ddx6 C-Terminal Domain In Co 2e-11
2kbe_A226 Solution Structure Of Amino-Terminal Domain Of Dbp5 3e-11
3i32_A300 Dimeric Structure Of A Hera Helicase Fragment Inclu 7e-11
3eaq_A212 Novel Dimerization Motif In The Dead Box Rna Helica 2e-10
1t5i_A172 Crystal Structure Of The C-Terminal Domain Of Uap56 5e-10
3fmo_B300 Crystal Structure Of The Nucleoporin Nup214 In Comp 5e-09
3fhc_B235 Crystal Structure Of Human Dbp5 In Complex With Nup 5e-09
2rb4_A175 Crystal Structure Of The Helicase Domain Of Human D 9e-08
1fuk_A165 Crystal Structure Of The Carboxy Terminal Domain Of 5e-07
2oxc_A230 Human Dead-Box Rna Helicase Ddx20, Dead Domain In C 1e-06
2oxc_A230 Human Dead-Box Rna Helicase Ddx20, Dead Domain In C 1e-06
1oyy_A523 Structure Of The Recq Catalytic Core Bound To Atp-G 6e-06
1gm5_A780 Structure Of Recg Bound To Three-Way Dna Junction L 1e-05
1oyw_A523 Structure Of The Recq Catalytic Core Length = 523 1e-04
1wp9_A494 Crystal Structure Of Pyrococcus Furiosus Hef Helica 4e-04
4gl2_A699 Structural Basis For Dsrna Duplex Backbone Recognit 8e-04
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure

Iteration: 1

Score = 199 bits (505), Expect = 7e-51, Method: Compositional matrix adjust. Identities = 129/384 (33%), Positives = 201/384 (52%), Gaps = 30/384 (7%) Query: 410 MNITQVTTVQQLSIQPIL--DGGDVLVRSQTGSGKTLAYAIPIIQKLQEMRPKISRKDGI 467 M +T VQQ +I+PIL + DV+ R++TG+GKT A+ IPI Q L + K + + Sbjct: 39 MEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHL--INTKFDSQYMV 96 Query: 468 YAVIILPTRELALQTLEIFTKLCKSFTWIVPSW----LTGGEKMKSEKARIRK-GISILV 522 AVI+ PTR+LALQ +E K + + + L GG ++ ++ K +I++ Sbjct: 97 KAVIVAPTRDLALQ-IEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVI 155 Query: 523 ATPGRLLDHCKHTETLKFSKVEHLVLDEADRILDQGYERDIAEFLEILK----KQKPQFQ 578 ATPGRL+D + F V++ VLDEADR+L+ G+ D+ IL K + Sbjct: 156 ATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSADNIK 215 Query: 579 SILLSATLTPAVQRLAG--MTLQNPIQIDAADSTD--IHNTTD-SLVIPDSLKQHFIVTP 633 ++L SATL VQ+LA M + + +D D + H D S+VI + Sbjct: 216 TLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAV 275 Query: 634 PKLRLVALASFILGKCQNVNEDEESKMLVFMATQDMADYHTELLSTVLGENIAFFKLHGS 693 + K Q D K ++F T + +L +++ + HG Sbjct: 276 EHI-----------KKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGK 324 Query: 694 MSQSERTEVFKTFRSVKSGVLICTDVAARGLDLPLVDWIVQYTAPSSSTDYVHRVGRTAR 753 ++Q++RT + K F+ +SG+L+CTDV ARG+D P V ++Q PS +Y+HR+GRTAR Sbjct: 325 ITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTAR 384 Query: 754 VGHEGSSLLFLIPSEVKLVEELQN 777 G EGSS+LF+ E+ V EL++ Sbjct: 385 SGKEGSSVLFICKDELPFVRELED 408
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 Back     alignment and structure
>pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|4DB4|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To A Chimaeric Rna-Dna Duplex Length = 256 Back     alignment and structure
>pdb|4DB2|C Chain C, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|4DB2|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure
>pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 Back     alignment and structure
>pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 Back     alignment and structure
>pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 Back     alignment and structure
>pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 Back     alignment and structure
>pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 Back     alignment and structure
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure
>pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure
>pdb|2KBE|A Chain A, Solution Structure Of Amino-Terminal Domain Of Dbp5p Length = 226 Back     alignment and structure
>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 Back     alignment and structure
>pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 Back     alignment and structure
>pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 Back     alignment and structure
>pdb|3FMO|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 300 Back     alignment and structure
>pdb|3FHC|B Chain B, Crystal Structure Of Human Dbp5 In Complex With Nup214 Length = 235 Back     alignment and structure
>pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 Back     alignment and structure
>pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 Back     alignment and structure
>pdb|2OXC|A Chain A, Human Dead-Box Rna Helicase Ddx20, Dead Domain In Complex With Adp Length = 230 Back     alignment and structure
>pdb|2OXC|A Chain A, Human Dead-Box Rna Helicase Ddx20, Dead Domain In Complex With Adp Length = 230 Back     alignment and structure
>pdb|1OYY|A Chain A, Structure Of The Recq Catalytic Core Bound To Atp-Gamma-S Length = 523 Back     alignment and structure
>pdb|1GM5|A Chain A, Structure Of Recg Bound To Three-Way Dna Junction Length = 780 Back     alignment and structure
>pdb|1OYW|A Chain A, Structure Of The Recq Catalytic Core Length = 523 Back     alignment and structure
>pdb|1WP9|A Chain A, Crystal Structure Of Pyrococcus Furiosus Hef Helicase Domain Length = 494 Back     alignment and structure
>pdb|4GL2|A Chain A, Structural Basis For Dsrna Duplex Backbone Recognition By Mda5 Length = 699 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query930
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 1e-114
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 3e-54
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 1e-114
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 6e-54
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 1e-81
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 7e-42
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 6e-80
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 2e-41
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 5e-79
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 4e-39
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 1e-76
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 8e-36
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 3e-13
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 6e-76
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 2e-38
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 5e-75
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 9e-39
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 1e-74
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 5e-39
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 8e-74
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 8e-38
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 1e-73
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 7e-38
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 3e-73
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 6e-38
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 3e-66
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 1e-34
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 1e-65
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 6e-34
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 7e-65
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 4e-58
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 9e-14
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 6e-63
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 6e-32
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 1e-09
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 3e-62
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 2e-55
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 2e-15
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 2e-61
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 1e-37
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 2e-56
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 2e-49
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 4e-50
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 3e-43
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 7e-50
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 5e-43
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 8e-49
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 3e-43
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 3e-13
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 7e-48
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 3e-40
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 2e-12
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 1e-47
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 5e-41
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 1e-10
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 1e-46
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 8e-42
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 1e-11
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 1e-44
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 4e-38
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 5e-11
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 2e-43
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 3e-38
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 5e-11
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 2e-42
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 3e-38
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 1e-10
3bor_A237 Human initiation factor 4A-II; translation initiat 1e-40
3bor_A237 Human initiation factor 4A-II; translation initiat 8e-37
3bor_A237 Human initiation factor 4A-II; translation initiat 1e-10
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 1e-40
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 8e-37
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 1e-10
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 1e-39
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 4e-34
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 1e-30
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 1e-30
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 9e-30
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 2e-28
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 3e-28
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 4e-28
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 6e-26
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 6e-25
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 1e-23
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-19
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 1e-14
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 5e-14
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 3e-13
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 8e-12
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 2e-11
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 8e-11
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 2e-11
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 2e-04
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 4e-11
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 1e-10
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 2e-09
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 4e-11
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 3e-09
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 9e-09
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 2e-10
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 2e-06
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 2e-10
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 3e-10
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 4e-10
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 2e-10
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 6e-10
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 1e-09
3b6e_A216 Interferon-induced helicase C domain-containing P; 4e-10
3b6e_A216 Interferon-induced helicase C domain-containing P; 9e-09
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 1e-08
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 8e-04
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 3e-06
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 3e-06
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 6e-06
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 4e-05
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 1e-04
1yks_A440 Genome polyprotein [contains: flavivirin protease 3e-04
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 9e-04
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
 Score =  361 bits (929), Expect = e-114
 Identities = 141/572 (24%), Positives = 250/572 (43%), Gaps = 58/572 (10%)

Query: 352 KKTEVKSGPISSLFQNNPDIPNVPTRRLKPVSEALFAPTSYEEFPGIHPFMKKNLNEGMN 411
           +           +  +      +     +  S+ +   +  EE   +   + K +   M 
Sbjct: 34  RPRTRSREDDDEVHFDKTTFSKLIHVPKEDNSKEVTLDSLLEEG-VLDKEIHKAITR-ME 91

Query: 412 ITQVTTVQQLSIQPILDG--GDVLVRSQTGSGKTLAYAIPIIQKLQEMRPKISRKDGIYA 469
              +T VQQ +I+PIL     DV+ R++TG+GKT A+ IPI Q L  +  K   +  + A
Sbjct: 92  FPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHL--INTKFDSQYMVKA 149

Query: 470 VIILPTRELALQTLEIFTKLCKSFTWIVPSWLT---GGEKMKSEKARIRK-GISILVATP 525
           VI+ PTR+LALQ      K+      +         GG   ++   ++ K   +I++ATP
Sbjct: 150 VIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATP 209

Query: 526 GRLLDHCKHTETLKFSKVEHLVLDEADRILDQGYERDIAEFLEILKKQKPQF----QSIL 581
           GRL+D  +      F  V++ VLDEADR+L+ G+  D+     IL ++  +     +++L
Sbjct: 210 GRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSADNIKTLL 269

Query: 582 LSATLTPAVQRLAGMTLQNPIQIDAADSTDIHNTTDSLVIPDSLKQHFIVTPPKL-RLVA 640
            SATL   VQ+LA   +     +                  + + Q  +++      + A
Sbjct: 270 FSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEA-----HERIDQSVVISEKFANSIFA 324

Query: 641 LASFILGKCQNVNEDEESKMLVFMATQDMADYHTELLSTVLGENIAFFKLHGSMSQSERT 700
               I    Q    D   K ++F  T     +   +L     +++   + HG ++Q++RT
Sbjct: 325 AVEHIK--KQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRT 382

Query: 701 EVFKTFRSVKSGVLICTDVAARGLDLPLVDWIVQYTAPSSSTDYVHRVGRTARVGHEGSS 760
            + K F+  +SG+L+CTDV ARG+D P V  ++Q   PS   +Y+HR+GRTAR G EGSS
Sbjct: 383 SLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSS 442

Query: 761 LLFLIPSEVKLVEELQN-RRIRIEEIKLKDCLQNLLSVKMEGDLSRLADGNVETAATALQ 819
           +LF+   E+  V EL++ + I I + +  +  + +     + ++        E  +    
Sbjct: 443 VLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEI-----KSEVLEAVTEEPEDIS---- 493

Query: 820 MSFESAVLQQKILHTSACKGYTSWVRFYASYSKDLRHIFNFKQIHLGHFAKSFA-LRDAP 878
                                 S +  Y S  K+    F+ ++I L   A ++  L + P
Sbjct: 494 ------------------DIVISLISSYRSCIKEY--RFSERRI-LPEIASTYGVLLNDP 532

Query: 879 SVISGIG-KPKNKEELKNKKMAINKEKSFKQR 909
            +   +  +  +K  L    +    +  F+ R
Sbjct: 533 QLKIPVSRRFLDKLGLSRSPIG---KAMFEIR 561


>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Length = 1054 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Length = 510 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query930
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 100.0
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 100.0
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 100.0
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 100.0
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 100.0
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 100.0
1yks_A440 Genome polyprotein [contains: flavivirin protease 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 100.0
4gl2_A699 Interferon-induced helicase C domain-containing P; 100.0
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 100.0
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 100.0
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 100.0
3jux_A822 Protein translocase subunit SECA; protein transloc 100.0
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 100.0
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 100.0
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 100.0
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 100.0
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 100.0
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 100.0
3h1t_A590 Type I site-specific restriction-modification syst 100.0
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 100.0
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 100.0
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 100.0
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 100.0
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 100.0
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 100.0
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.98
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.98
3bor_A237 Human initiation factor 4A-II; translation initiat 99.98
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.97
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.97
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.97
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.97
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.97
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.97
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.96
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.96
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.96
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.96
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.96
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.96
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.96
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.96
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.96
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.96
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.96
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.96
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.95
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.95
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.95
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.95
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.95
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.95
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.95
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.95
3bor_A237 Human initiation factor 4A-II; translation initiat 99.95
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.95
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.95
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.94
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.94
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.94
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.94
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.94
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.94
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.94
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.94
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.94
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.94
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.93
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.93
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.93
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.93
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 99.92
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.92
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.92
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.92
3l9o_A1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.91
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.91
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.91
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.91
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.91
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.91
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.9
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.9
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.9
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.9
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.9
1tf5_A844 Preprotein translocase SECA subunit; ATPase, helic 99.9
2xgj_A1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.9
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.9
2fsf_A853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.9
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 99.89
4a4z_A997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.89
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.89
1nkt_A922 Preprotein translocase SECA 1 subunit; preprotein 99.88
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 99.88
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.87
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.77
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.86
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.85
4gl2_A699 Interferon-induced helicase C domain-containing P; 99.85
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.84
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.84
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.83
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.83
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 99.82
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 99.79
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.79
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.78
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.78
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.78
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.77
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.76
2ipc_A997 Preprotein translocase SECA subunit; nucleotide bi 99.74
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.74
3h1t_A590 Type I site-specific restriction-modification syst 99.72
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.71
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.71
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.7
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.7
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.69
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.68
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.68
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.67
2w00_A1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.67
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.65
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.52
3dmq_A968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.51
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.49
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.44
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.39
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.37
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.3
3jux_A822 Protein translocase subunit SECA; protein transloc 99.26
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.0
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.66
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.4
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 98.25
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 98.07
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 97.77
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.74
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 97.72
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.69
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 97.69
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.56
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 97.54
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 97.52
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 97.47
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 97.45
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.37
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 97.32
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 97.1
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 96.9
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 96.49
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 96.46
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 96.42
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 96.36
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 95.89
2kjq_A149 DNAA-related protein; solution structure, NESG, st 95.84
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 95.58
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 95.47
3lfu_A647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 95.46
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 95.44
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 95.43
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 95.34
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 95.32
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 95.3
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 94.98
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 94.96
1pjr_A724 PCRA; DNA repair, DNA replication, SOS response, h 94.72
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 94.6
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 94.52
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 94.4
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 94.27
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 94.24
1uaa_A673 REP helicase, protein (ATP-dependent DNA helicase 94.17
2kjq_A149 DNAA-related protein; solution structure, NESG, st 93.91
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 93.9
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 93.88
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 93.78
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 93.66
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 93.62
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 93.55
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 93.37
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 93.37
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 93.32
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 93.18
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 93.16
2chg_A226 Replication factor C small subunit; DNA-binding pr 93.13
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 92.99
3bos_A242 Putative DNA replication factor; P-loop containing 92.92
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 92.82
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 92.79
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 92.69
2v1u_A387 Cell division control protein 6 homolog; DNA repli 92.6
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 92.52
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 92.21
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 92.17
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 92.12
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 92.09
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 92.06
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 91.29
2chg_A226 Replication factor C small subunit; DNA-binding pr 92.0
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 92.0
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 91.86
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 91.71
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 91.68
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 91.64
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 91.38
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 91.21
2r6a_A454 DNAB helicase, replicative helicase; replication, 91.11
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 91.11
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 91.1
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 91.07
2v1u_A387 Cell division control protein 6 homolog; DNA repli 91.06
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 90.86
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 90.78
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 90.56
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 90.51
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 90.45
3bos_A242 Putative DNA replication factor; P-loop containing 90.36
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 90.35
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 90.23
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 89.97
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 89.96
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 89.73
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 89.73
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 89.68
2qgz_A308 Helicase loader, putative primosome component; str 89.5
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 89.49
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 89.44
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 89.34
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 89.22
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 89.2
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 88.96
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 88.89
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 88.86
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 88.83
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 88.76
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 88.75
2r6a_A454 DNAB helicase, replicative helicase; replication, 88.64
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 88.6
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 88.59
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 88.42
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 88.23
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 88.19
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 88.19
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 87.98
2chq_A319 Replication factor C small subunit; DNA-binding pr 87.94
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 87.77
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 87.5
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 87.46
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 87.23
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 87.15
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 86.59
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 86.47
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 86.08
2cvh_A220 DNA repair and recombination protein RADB; filamen 86.07
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 86.04
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 85.88
2l8b_A189 Protein TRAI, DNA helicase I; RECD, hydrolase; NMR 85.7
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 85.33
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 85.31
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 85.09
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 85.03
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 85.0
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 84.86
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 84.6
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 84.42
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 84.17
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 84.15
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 83.87
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 83.47
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 83.17
1xp8_A366 RECA protein, recombinase A; recombination, radior 83.17
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 83.12
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 82.96
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 82.94
3cmu_A2050 Protein RECA, recombinase A; homologous recombinat 82.8
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 82.42
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 81.59
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 81.54
2cvh_A220 DNA repair and recombination protein RADB; filamen 81.44
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 81.23
3co5_A143 Putative two-component system transcriptional RES 80.63
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 80.63
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 80.31
2gno_A305 DNA polymerase III, gamma subunit-related protein; 80.31
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 80.05
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 80.01
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
Probab=100.00  E-value=2.1e-62  Score=628.75  Aligned_cols=383  Identities=16%  Similarity=0.151  Sum_probs=281.2

Q ss_pred             CCHHHHHHHHhcCCCCCCCHHHHHhHHhhhcC-CcEEEEccCCCchhHHhhHHHHHHHHhhCcccCCCCCeeEEEEccCH
Q psy15524        398 IHPFMKKNLNEGMNITQVTTVQQLSIQPILDG-GDVLVRSQTGSGKTLAYAIPIIQKLQEMRPKISRKDGIYAVIILPTR  476 (930)
Q Consensus       398 l~~~~~~~l~~~~~~~~~~~iQ~~~i~~il~~-~d~lv~a~TGsGKTl~~~lp~l~~l~~~~~~~~~~~~~~~lil~Ptr  476 (930)
                      |++...+.+. ..+|+.++|+|.++++.++.+ +|++++||||||||++|.+|+++.+..       .++.++||++|+|
T Consensus       911 L~~~~~e~l~-~~~f~~fnpiQ~q~~~~l~~~~~nvlv~APTGSGKTliaelail~~l~~-------~~~~kavyi~P~r  982 (1724)
T 4f92_B          911 LRNSAFESLY-QDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQ-------SSEGRCVYITPME  982 (1724)
T ss_dssp             SCCHHHHTTT-TTTCSBCCHHHHHHHHHHHSCCSCEEEECCTTSCCHHHHHHHHHHHHHH-------CTTCCEEEECSCH
T ss_pred             ccCHHHHHHH-HhcCCCCCHHHHHHHHHHhcCCCcEEEEeCCCCCchHHHHHHHHHHHHh-------CCCCEEEEEcChH
Confidence            3344555554 258999999999999999865 679999999999999999999999876       3466899999999


Q ss_pred             HHHHHHHHHHHHhhccCCCcceEEEeCCCchHHHHHHHhcCCcEEEECchhHHHhhhccCCc-ccccceEEEEecchhhh
Q psy15524        477 ELALQTLEIFTKLCKSFTWIVPSWLTGGEKMKSEKARIRKGISILVATPGRLLDHCKHTETL-KFSKVEHLVLDEADRIL  555 (930)
Q Consensus       477 eLa~Q~~~~~~~~~~~~~~~~~~~~~gg~~~~~~~~~~~~~~~Ilv~Tp~rl~~~l~~~~~~-~~~~l~~lVlDEah~l~  555 (930)
                      +||.|+++.|.+.+.......++.++|+....   .+...+++|+|||||+|..+++++... .+++++++|+||+|++.
T Consensus       983 aLa~q~~~~~~~~f~~~~g~~V~~ltGd~~~~---~~~~~~~~IiV~TPEkld~llr~~~~~~~l~~v~lvViDE~H~l~ 1059 (1724)
T 4f92_B          983 ALAEQVYMDWYEKFQDRLNKKVVLLTGETSTD---LKLLGKGNIIISTPEKWDILSRRWKQRKNVQNINLFVVDEVHLIG 1059 (1724)
T ss_dssp             HHHHHHHHHHHHHHTTTSCCCEEECCSCHHHH---HHHHHHCSEEEECHHHHHHHHTTTTTCHHHHSCSEEEECCGGGGG
T ss_pred             HHHHHHHHHHHHHhchhcCCEEEEEECCCCcc---hhhcCCCCEEEECHHHHHHHHhCcccccccceeeEEEeechhhcC
Confidence            99999999998876654445677778875432   233456899999999998888775433 47899999999999887


Q ss_pred             hcCcHHHHHHHHHHHh----hcCccceEEEEccccCHHHHHHHhhhcCCCE-EEEccCCCCcccCccceecCCCceEEEE
Q psy15524        556 DQGYERDIAEFLEILK----KQKPQFQSILLSATLTPAVQRLAGMTLQNPI-QIDAADSTDIHNTTDSLVIPDSLKQHFI  630 (930)
Q Consensus       556 ~~g~~~~l~~i~~~l~----~~~~~~q~vl~SAT~~~~~~~l~~~~~~~~~-~i~~~~~~~~~~~~~~~~~~~~~~~~~~  630 (930)
                      +. .+..++.++..+.    ...++.|++++|||+++ ..+++.+...++. ...+..          ...|..+..++.
T Consensus      1060 d~-rg~~le~il~rl~~i~~~~~~~~riI~lSATl~N-~~dla~WL~~~~~~~~~~~~----------~~RPvpL~~~i~ 1127 (1724)
T 4f92_B         1060 GE-NGPVLEVICSRMRYISSQIERPIRIVALSSSLSN-AKDVAHWLGCSATSTFNFHP----------NVRPVPLELHIQ 1127 (1724)
T ss_dssp             ST-THHHHHHHHHHHHHHHHTTSSCCEEEEEESCBTT-HHHHHHHHTCCSTTEEECCG----------GGCSSCEEEEEE
T ss_pred             CC-CCccHHHHHHHHHHHHhhcCCCceEEEEeCCCCC-HHHHHHHhCCCCCCeEEeCC----------CCCCCCeEEEEE
Confidence            74 5666766666553    34568899999999986 4445544332221 111111          112344554444


Q ss_pred             EcCchh---hHHHHHHHHHhhccCCCcCCCceEEEEecchhhHHHHHHHHhhhcCC------------------------
Q psy15524        631 VTPPKL---RLVALASFILGKCQNVNEDEESKMLVFMATQDMADYHTELLSTVLGE------------------------  683 (930)
Q Consensus       631 ~~~~~~---~~~~l~~~l~~~~~~~~~~~~~k~iVF~~s~~~~~~~~~~l~~~~~~------------------------  683 (930)
                      ..+...   ++..+..-+......  ...++++||||+|+..++..+..|......                        
T Consensus      1128 ~~~~~~~~~~~~~~~~~~~~~i~~--~~~~~~~lVF~~sR~~~~~~A~~L~~~~~~~~~~~~~~~~~~~~l~~~l~~~~d 1205 (1724)
T 4f92_B         1128 GFNISHTQTRLLSMAKPVYHAITK--HSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSD 1205 (1724)
T ss_dssp             EECCCSHHHHHHTTHHHHHHHHHH--HCSSSCEEEEESSHHHHHHHHHHHHHHHHHTTCTTTTBCSCHHHHHHHHTTCCC
T ss_pred             eccCCCchhhhhhhcchHHHHHHH--hcCCCCeeeeCCCHHHHHHHHHHHHHHHhhccchhhhhcccHHHHHHHHhhccc
Confidence            333322   222111111111111  113679999999999998877655332100                        


Q ss_pred             -------CceEEEecCCCCHHHHHHHHHHhhcCCCcEEEeccccccccCCCCccEEEEe----------cCCCChhhHHh
Q psy15524        684 -------NIAFFKLHGSMSQSERTEVFKTFRSVKSGVLICTDVAARGLDLPLVDWIVQY----------TAPSSSTDYVH  746 (930)
Q Consensus       684 -------~~~~~~lhg~~~~~~R~~v~~~F~~~~~~vLv~T~~~~~GlDip~v~~VI~~----------~~p~s~~~y~q  746 (930)
                             ..++..+||+|++.+|..+++.|++|.++|||||+++++|+|+|++++||..          ..|.++.+|+|
T Consensus      1206 ~~L~~~l~~GIa~hHagL~~~~R~~VE~lF~~G~i~VLvaT~tlA~GVnlPa~~VVI~~~~~~dg~~~~~~~~s~~~~~Q 1285 (1724)
T 4f92_B         1206 STLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYPIYDVLQ 1285 (1724)
T ss_dssp             HHHHHHHHTTEEEECTTSCHHHHHHHHHHHHHTSBCEEEEEGGGSSSCCCCBSEEEEECSEEEETTTTEEEECCHHHHHH
T ss_pred             HHHHHHHhCCEEEECCCCCHHHHHHHHHHHHCCCCeEEEEChHHHcCCCCCccEEEEecCccccCcccccCCCCHHHHHH
Confidence                   1235566999999999999999999999999999999999999999999942          24678999999


Q ss_pred             hhcccccCCC--CceEEEEeCcccHHHHHHHHhcCCccchhchHHHHHhhhhhhccCcccc
Q psy15524        747 RVGRTARVGH--EGSSLLFLIPSEVKLVEELQNRRIRIEEIKLKDCLQNLLSVKMEGDLSR  805 (930)
Q Consensus       747 r~GRagR~g~--~g~~~~~~~~~e~~~~~~l~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~  805 (930)
                      |+|||||.|.  .|.|++++.+.+..+++++...+.++++.....+.+++++++..+....
T Consensus      1286 m~GRAGR~g~d~~G~avll~~~~~~~~~~~ll~~~~pveS~L~~~l~~~l~~eI~~~~i~~ 1346 (1724)
T 4f92_B         1286 MVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIEN 1346 (1724)
T ss_dssp             HHTTBCCTTTCSCEEEEEEEEGGGHHHHHHHTTSCBCCCCCGGGSCHHHHHHHHHTTSCCB
T ss_pred             hhccccCCCCCCceEEEEEecchHHHHHHHHhCCCCceeeecccchHHHHHHHHHhcccCC
Confidence            9999999998  6999999999999999999888888887666666677777776666543



>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 930
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 4e-32
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 8e-24
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 8e-14
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 6e-30
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 6e-21
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 7e-12
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 5e-29
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 3e-19
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 8e-09
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 9e-29
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 2e-18
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 3e-08
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 3e-28
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 3e-19
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 1e-08
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 4e-28
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 6e-19
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 2e-08
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 4e-28
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 4e-19
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 2e-08
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 2e-24
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 2e-16
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 3e-23
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 7e-14
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 7e-08
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 4e-23
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 9e-19
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 5e-06
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 8e-22
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 1e-20
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 6e-06
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 2e-20
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 3e-18
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 4e-04
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 4e-20
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 2e-10
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 2e-06
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 2e-19
d1a1va2299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 3e-19
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 7e-17
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 2e-15
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 3e-15
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 9e-14
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 1e-12
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 4e-12
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 9e-11
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 4e-10
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 1e-10
d1oywa3200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 1e-09
d1t5la2181 c.37.1.19 (A:415-595) Nucleotide excision repair e 2e-09
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 2e-07
d1t5ia_168 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 3e-07
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 4e-04
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 4e-04
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 0.001
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 0.001
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 0.001
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Putative DEAD box RNA helicase
species: Archaeon Methanococcus jannaschii [TaxId: 2190]
 Score =  122 bits (306), Expect = 4e-32
 Identities = 61/217 (28%), Positives = 105/217 (48%), Gaps = 16/217 (7%)

Query: 391 SYEEFPGIHPFMKKNLNEGMNITQVTTVQQLSIQPILDGG-DVLVRSQTGSGKTLAYAIP 449
           ++ E   +   +   +       + T +Q   I   L+   +++ +++TGSGKT ++AIP
Sbjct: 5   NFNEL-NLSDNILNAIRN-KGFEKPTDIQMKVIPLFLNDEYNIVAQARTGSGKTASFAIP 62

Query: 450 IIQKLQEMRPKISRKDGIYAVIILPTRELALQTLEIFTKLCKSFTWIVPSWLTGGEKMKS 509
           +I+ + E         GI A+I+ PTRELA+Q  +    L  +    +      G K   
Sbjct: 63  LIELVNENN-------GIEAIILTPTRELAIQVADEIESLKGNKNLKIAKIY--GGKAIY 113

Query: 510 EKARIRKGISILVATPGRLLDHCKHTETLKFSKVEHLVLDEADRILDQGYERDIAEFLEI 569
            + +  K  +I+V TPGR+LDH     TL    V++ +LDEAD +L+ G+ +D     +I
Sbjct: 114 PQIKALKNANIVVGTPGRILDHINR-GTLNLKNVKYFILDEADEMLNMGFIKD---VEKI 169

Query: 570 LKKQKPQFQSILLSATLTPAVQRLAGMTLQNPIQIDA 606
           L       + +L SAT+   +  LA   + +   I A
Sbjct: 170 LNACNKDKRILLFSATMPREILNLAKKYMGDYSFIKA 206


>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query930
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 100.0
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 100.0
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 100.0
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 100.0
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 100.0
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 100.0
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 100.0
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 100.0
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 100.0
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 100.0
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.98
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.97
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.97
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.97
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.97
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.97
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.95
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.95
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.95
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.95
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.94
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.94
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.93
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.92
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.92
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.92
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.9
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.9
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.89
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.89
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.89
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.88
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.84
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.84
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.83
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.76
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.76
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.75
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.74
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.73
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.72
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.71
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.67
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.66
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.65
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.62
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.62
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.62
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.61
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.61
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.6
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.59
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.56
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.54
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.54
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 99.35
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.22
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.2
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.15
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 98.95
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.93
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 98.88
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 98.87
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.81
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.77
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.66
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 98.19
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 97.95
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.83
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.47
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 97.02
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 96.96
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 96.77
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 96.72
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 96.62
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 96.44
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 96.14
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 96.02
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 95.7
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 95.69
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 95.68
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 95.64
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 95.53
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 95.52
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 95.29
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 95.23
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 95.05
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 94.88
d1ls1a2207 GTPase domain of the signal sequence recognition p 94.79
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 94.61
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 93.9
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 93.76
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 93.61
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 93.43
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 93.37
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 93.29
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 93.07
d2qy9a2211 GTPase domain of the signal recognition particle r 92.98
d1j8yf2211 GTPase domain of the signal sequence recognition p 92.68
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 92.35
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 92.07
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 92.05
d1okkd2207 GTPase domain of the signal recognition particle r 92.0
d1vmaa2213 GTPase domain of the signal recognition particle r 91.21
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 90.07
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 89.92
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 89.82
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 88.64
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 88.46
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 88.19
d1ls1a2207 GTPase domain of the signal sequence recognition p 88.16
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 88.05
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 87.89
d1j8yf2211 GTPase domain of the signal sequence recognition p 87.68
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 87.56
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 87.26
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 87.14
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 87.12
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 86.68
d1okkd2207 GTPase domain of the signal recognition particle r 86.02
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 85.95
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 85.75
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 85.73
d2qy9a2211 GTPase domain of the signal recognition particle r 84.74
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 84.64
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 84.6
d1vmaa2213 GTPase domain of the signal recognition particle r 84.17
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 83.67
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 83.58
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 83.52
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 83.48
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 83.38
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 82.99
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 82.95
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 81.65
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 81.46
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 80.98
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 80.31
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 80.16
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.1e-39  Score=329.40  Aligned_cols=206  Identities=27%  Similarity=0.477  Sum_probs=186.4

Q ss_pred             CCCCCCCCCCCCHHHHHHHHhcCCCCCCCHHHHHhHHhhhcCCcEEEEccCCCchhHHhhHHHHHHHHhhCcccCCCCCe
Q psy15524        388 APTSYEEFPGIHPFMKKNLNEGMNITQVTTVQQLSIQPILDGGDVLVRSQTGSGKTLAYAIPIIQKLQEMRPKISRKDGI  467 (930)
Q Consensus       388 ~~~~f~~l~~l~~~~~~~l~~~~~~~~~~~iQ~~~i~~il~~~d~lv~a~TGsGKTl~~~lp~l~~l~~~~~~~~~~~~~  467 (930)
                      ...+|++| +|++.++++|.+ +||..|||+|+++||.+++|+|++++||||||||+||++|+++.+..      ...++
T Consensus        15 ~~~sF~~l-~L~~~l~~~L~~-~g~~~pt~IQ~~aIp~il~g~dvi~~a~TGSGKTlayllPil~~l~~------~~~~~   86 (222)
T d2j0sa1          15 VTPTFDTM-GLREDLLRGIYA-YGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDI------QVRET   86 (222)
T ss_dssp             CCCSGGGG-CCCHHHHHHHHH-HTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHTCCT------TSCSC
T ss_pred             CCCCHHHC-CCCHHHHHHHHH-CCCCCCCHHHHHHHHHHHCCCCeEEEcCcchhhhhhhcccccccccc------cccCc
Confidence            34589999 999999999985 79999999999999999999999999999999999999999998754      24567


Q ss_pred             eEEEEccCHHHHHHHHHHHHHhhccCCCcceEEEeCCCchHHHHHHHhcCCcEEEECchhHHHhhhccCCcccccceEEE
Q psy15524        468 YAVIILPTRELALQTLEIFTKLCKSFTWIVPSWLTGGEKMKSEKARIRKGISILVATPGRLLDHCKHTETLKFSKVEHLV  547 (930)
Q Consensus       468 ~~lil~PtreLa~Q~~~~~~~~~~~~~~~~~~~~~gg~~~~~~~~~~~~~~~Ilv~Tp~rl~~~l~~~~~~~~~~l~~lV  547 (930)
                      +++|++||||||.|+++.+.++.... .+....++||.....+...+..+++|+|+||||+.+++.. ..+.+++++++|
T Consensus        87 ~~lil~PtreLa~Qi~~~~~~l~~~~-~i~~~~~~g~~~~~~~~~~l~~~~~Ilv~TPgrl~~~~~~-~~~~~~~l~~lV  164 (222)
T d2j0sa1          87 QALILAPTRELAVQIQKGLLALGDYM-NVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRR-RSLRTRAIKMLV  164 (222)
T ss_dssp             CEEEECSSHHHHHHHHHHHHHHTTTT-TCCEEEECTTSCHHHHHHHHHHCCSEEEECHHHHHHHHHT-TSSCCTTCCEEE
T ss_pred             eeEEecchHHHHHHHHHHHHHHhCcc-ceeEEEEeecccchhhHHHhccCCeEEeCCCCcHHhcccc-cccccccceeee
Confidence            89999999999999999999988754 4567778899888888888889999999999999998876 567889999999


Q ss_pred             EecchhhhhcCcHHHHHHHHHHHhhcCccceEEEEccccCHHHHHHHhhhcCCCEEEEc
Q psy15524        548 LDEADRILDQGYERDIAEFLEILKKQKPQFQSILLSATLTPAVQRLAGMTLQNPIQIDA  606 (930)
Q Consensus       548 lDEah~l~~~g~~~~l~~i~~~l~~~~~~~q~vl~SAT~~~~~~~l~~~~~~~~~~i~~  606 (930)
                      +||||++++.||...+..|++.+++   .+|+++||||+++++.++++.++++|+.|.+
T Consensus       165 lDEaD~ll~~~f~~~i~~I~~~l~~---~~Q~ilfSAT~~~~v~~l~~~~l~~Pv~I~V  220 (222)
T d2j0sa1         165 LDEADEMLNKGFKEQIYDVYRYLPP---ATQVVLISATLPHEILEMTNKFMTDPIRILV  220 (222)
T ss_dssp             EETHHHHTSTTTHHHHHHHHTTSCT---TCEEEEEESCCCHHHHTTGGGTCSSCEEECC
T ss_pred             ecchhHhhhcCcHHHHHHHHHhCCC---CCEEEEEEEeCCHHHHHHHHHHCCCCEEEEE
Confidence            9999999999999999999877764   7899999999999999999999999998865



>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure