Psyllid ID: psy15540


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
MGTILGWTSPAGDRLIAGEYPFPVTESDLSFIGSSMALGAVFGSPVVGNLVDTVGRKNTMLLLAVPTLVGWGLIIWSQSVSRHGSIH
ccccEEEHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHcccc
cccEEccccccHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
mgtilgwtspagdrliageypfpvtesdlsfigssmalgavfgspvvgnlvdtvgrknTMLLLAVPTLVGWGLIIWSQsvsrhgsih
mgtilgwtspagdrLIAGEYPFPVTESDLSFIGSSMALGAVFGSPVVGNLVDTVGRKNTMLLLAVPTLVGWGLIIWSQSVSRHGSIH
MGTILGWTSPAGDRLIAGEYPFPVTESDLSFIGSSMALGAVFGSPVVGNLVDTVGRKNTMLLLAVPTLVGWGLIIWSQSVSRHGSIH
***ILGWTSPAGDRLIAGEYPFPVTESDLSFIGSSMALGAVFGSPVVGNLVDTVGRKNTMLLLAVPTLVGWGLIIWSQ*********
MGTILGWTSPAGDRLIAGEYPFPVTESDLSFIGSSMALGAVFGSPVVGNLVDTVGRKNTMLLLAVPTLVGWGLIIWSQSVSRHGSIH
MGTILGWTSPAGDRLIAGEYPFPVTESDLSFIGSSMALGAVFGSPVVGNLVDTVGRKNTMLLLAVPTLVGWGLIIWSQS********
MGTILGWTSPAGDRLIAGEYPFPVTESDLSFIGSSMALGAVFGSPVVGNLVDTVGRKNTMLLLAVPTLVGWGLIIWSQSVSR*****
ooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooo
ooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooo
ooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiHHHHHHHHHHHHHHHHHHHHooooooooo
oooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooo
ooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGTILGWTSPAGDRLIAGEYPFPVTESDLSFIGSSMALGAVFGSPVVGNLVDTVGRKNTMLLLAVPTLVGWGLIIWSQSVSRHGSIH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query87 2.2.26 [Sep-21-2011]
Q8GXK5 482 Sugar transporter ERD6-li yes N/A 0.885 0.159 0.3 0.0001
A9ZSY3 505 Facilitated trehalose tra N/A N/A 0.758 0.130 0.362 0.0003
>sp|Q8GXK5|EDL14_ARATH Sugar transporter ERD6-like 14 OS=Arabidopsis thaliana GN=At4g04750 PE=2 SV=2 Back     alignment and function desciption
 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 44/80 (55%), Gaps = 3/80 (3%)

Query: 1   MGTILGWTSPAGDRLIAGEYPFPVTESDLSFIGSSMALGAVFGSPVVGNLVDTVGRKNTM 60
            G I+G+T+P    ++       ++ +D SF GS + +G + G+ + G L D VGR  T+
Sbjct: 50  FGCIVGYTAPTQSSIMK---DLNLSIADFSFFGSILTVGLILGALICGKLADLVGRVYTI 106

Query: 61  LLLAVPTLVGWGLIIWSQSV 80
            +  +  L+GW  I +++ V
Sbjct: 107 WITNILVLIGWLAIAFAKDV 126




Sugar transporter.
Arabidopsis thaliana (taxid: 3702)
>sp|A9ZSY3|TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori GN=Tret1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
328696470 508 PREDICTED: facilitated trehalose transpo 0.931 0.159 0.530 8e-19
193575619 489 PREDICTED: facilitated trehalose transpo 0.919 0.163 0.525 3e-18
289742799 479 solute carrier family 2 [Glossina morsit 0.919 0.167 0.562 6e-18
251736857 489 sugar transporter 1 [Sitobion avenae] 0.919 0.163 0.5 2e-17
193596719 528 PREDICTED: facilitated trehalose transpo 0.919 0.151 0.512 6e-17
195428086 552 GK17357 [Drosophila willistoni] gi|19415 0.908 0.143 0.437 5e-12
195166725 467 GL22895 [Drosophila persimilis] gi|19410 0.896 0.167 0.475 1e-11
198466442 549 GA23919 [Drosophila pseudoobscura pseudo 0.896 0.142 0.475 1e-11
24663515 471 CG10960, isoform A [Drosophila melanogas 0.908 0.167 0.456 4e-11
24663511 539 CG10960, isoform B [Drosophila melanogas 0.908 0.146 0.456 4e-11
>gi|328696470|ref|XP_001943804.2| PREDICTED: facilitated trehalose transporter Tret1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 97.4 bits (241), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 61/81 (75%)

Query: 1   MGTILGWTSPAGDRLIAGEYPFPVTESDLSFIGSSMALGAVFGSPVVGNLVDTVGRKNTM 60
           MGT LGWTSPAG  +  G+Y FP+T+ D+S+I S M LGA+ G P +G LV+ +GRK+ M
Sbjct: 81  MGTTLGWTSPAGPMMAHGQYGFPITDDDISWIASCMPLGAMLGCPFMGGLVNKLGRKSLM 140

Query: 61  LLLAVPTLVGWGLIIWSQSVS 81
           ++L +P L+GW +IIW+ SV+
Sbjct: 141 IMLTIPALLGWAMIIWADSVT 161




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|193575619|ref|XP_001942953.1| PREDICTED: facilitated trehalose transporter Tret1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|289742799|gb|ADD20147.1| solute carrier family 2 [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|251736857|gb|ACT10281.1| sugar transporter 1 [Sitobion avenae] Back     alignment and taxonomy information
>gi|193596719|ref|XP_001950031.1| PREDICTED: facilitated trehalose transporter Tret1-like isoform 1 [Acyrthosiphon pisum] gi|328696681|ref|XP_003240096.1| PREDICTED: facilitated trehalose transporter Tret1-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|195428086|ref|XP_002062105.1| GK17357 [Drosophila willistoni] gi|194158190|gb|EDW73091.1| GK17357 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195166725|ref|XP_002024185.1| GL22895 [Drosophila persimilis] gi|194107540|gb|EDW29583.1| GL22895 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|198466442|ref|XP_002135189.1| GA23919 [Drosophila pseudoobscura pseudoobscura] gi|198150603|gb|EDY73816.1| GA23919 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|24663515|ref|NP_729842.1| CG10960, isoform A [Drosophila melanogaster] gi|24663519|ref|NP_729843.1| CG10960, isoform C [Drosophila melanogaster] gi|23093592|gb|AAN11863.1| CG10960, isoform A [Drosophila melanogaster] gi|23093593|gb|AAN11864.1| CG10960, isoform C [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|24663511|ref|NP_648605.1| CG10960, isoform B [Drosophila melanogaster] gi|7294533|gb|AAF49874.1| CG10960, isoform B [Drosophila melanogaster] gi|21428998|gb|AAM50218.1| HL01062p [Drosophila melanogaster] gi|220943584|gb|ACL84335.1| CG10960-PA [synthetic construct] gi|220953532|gb|ACL89309.1| CG10960-PA [synthetic construct] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
FB|FBgn0036316 539 CG10960 [Drosophila melanogast 0.919 0.148 0.463 1e-14
FB|FBgn0034247 465 CG6484 [Drosophila melanogaste 0.931 0.174 0.353 3.5e-10
FB|FBgn0028560 444 sut4 "sugar transporter 4" [Dr 0.931 0.182 0.341 1.4e-09
FB|FBgn0031522 466 CG3285 [Drosophila melanogaste 0.908 0.169 0.407 1.6e-09
FB|FBgn0037485 438 CG14606 [Drosophila melanogast 0.919 0.182 0.378 4.9e-09
UNIPROTKB|F1RS19 478 SLC2A8 "Uncharacterized protei 0.908 0.165 0.387 3e-07
FB|FBgn0031523 466 CG15408 [Drosophila melanogast 0.896 0.167 0.353 3.7e-07
UNIPROTKB|F1NDA6 482 SLC2A8 "Uncharacterized protei 0.908 0.163 0.362 1.7e-06
UNIPROTKB|A5LGM7 504 Tret1 "Facilitated trehalose t 0.678 0.117 0.406 1.9e-06
UNIPROTKB|A9ZSY3 505 Tret1 "Facilitated trehalose t 0.816 0.140 0.351 1.9e-06
FB|FBgn0036316 CG10960 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 196 (74.1 bits), Expect = 1.0e-14, P = 1.0e-14
 Identities = 38/82 (46%), Positives = 56/82 (68%)

Query:     2 GTILGWTSPAGDRLI-AGE-YPFPVTESDLSFIGSSMALGAVFGSPVVGNLVDTVGRKNT 59
             GT+LGWTSPA   ++  GE Y FPV +   S++GS+M LGA      +G L++ +GRK T
Sbjct:    98 GTVLGWTSPAETEIVDRGEGYDFPVDKDQFSWVGSAMTLGAACVCIPIGFLINMIGRKWT 157

Query:    60 MLLLAVPTLVGWGLIIWSQSVS 81
             ML L +P ++GW ++IW+ +VS
Sbjct:   158 MLFLVLPFILGWTMLIWAVNVS 179




GO:0005355 "glucose transmembrane transporter activity" evidence=ISS
GO:0016021 "integral to membrane" evidence=IEA
GO:0055085 "transmembrane transport" evidence=IEA
GO:0046427 "positive regulation of JAK-STAT cascade" evidence=IMP
FB|FBgn0034247 CG6484 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0028560 sut4 "sugar transporter 4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0031522 CG3285 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0037485 CG14606 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1RS19 SLC2A8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0031523 CG15408 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NDA6 SLC2A8 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A5LGM7 Tret1 "Facilitated trehalose transporter Tret1" [Polypedilum vanderplanki (taxid:319348)] Back     alignment and assigned GO terms
UNIPROTKB|A9ZSY3 Tret1 "Facilitated trehalose transporter Tret1" [Bombyx mori (taxid:7091)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
pfam00083 449 pfam00083, Sugar_tr, Sugar (and other) transporter 4e-04
>gnl|CDD|215702 pfam00083, Sugar_tr, Sugar (and other) transporter Back     alignment and domain information
 Score = 36.9 bits (86), Expect = 4e-04
 Identities = 15/51 (29%), Positives = 25/51 (49%)

Query: 27 SDLSFIGSSMALGAVFGSPVVGNLVDTVGRKNTMLLLAVPTLVGWGLIIWS 77
               I S  ++G + GS   G L D  GRK ++L+  V  ++G  L  ++
Sbjct: 46 VLSGLIVSIFSVGCLIGSLFAGKLGDRFGRKKSLLIGNVLFVIGALLQGFA 96


Length = 449

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 87
PRK09705 393 cynX putative cyanate transporter; Provisional 99.18
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 99.1
PRK03633 381 putative MFS family transporter protein; Provision 99.07
PRK10091 382 MFS transport protein AraJ; Provisional 99.07
PRK03545 390 putative arabinose transporter; Provisional 99.04
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 99.04
TIGR00891 405 2A0112 putative sialic acid transporter. 99.03
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 99.02
PRK14995 495 methyl viologen resistance protein SmvA; Provision 99.01
PRK15403 413 multidrug efflux system protein MdtM; Provisional 98.99
TIGR00898 505 2A0119 cation transport protein. 98.99
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 98.97
PRK10077 479 xylE D-xylose transporter XylE; Provisional 98.96
PRK12307 426 putative sialic acid transporter; Provisional 98.95
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 98.95
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 98.95
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 98.94
KOG0254|consensus 513 98.93
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 98.92
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 98.92
PRK10213 394 nepI ribonucleoside transporter; Reviewed 98.92
PRK10133 438 L-fucose transporter; Provisional 98.92
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 98.91
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 98.91
PRK11652 394 emrD multidrug resistance protein D; Provisional 98.9
PRK03699 394 putative transporter; Provisional 98.9
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 98.89
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 98.88
TIGR00896 355 CynX cyanate transporter. This family of proteins 98.88
PRK11043 401 putative transporter; Provisional 98.88
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 98.86
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 98.84
TIGR00893 399 2A0114 d-galactonate transporter. 98.84
PLN00028 476 nitrate transmembrane transporter; Provisional 98.84
PRK03893 496 putative sialic acid transporter; Provisional 98.83
PRK11663 434 regulatory protein UhpC; Provisional 98.83
KOG0255|consensus 521 98.83
PRK10473 392 multidrug efflux system protein MdtL; Provisional 98.82
TIGR00900 365 2A0121 H+ Antiporter protein. 98.81
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 98.79
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 98.78
PRK05122 399 major facilitator superfamily transporter; Provisi 98.78
TIGR00895 398 2A0115 benzoate transport. 98.77
PRK10504 471 putative transporter; Provisional 98.77
TIGR00892 455 2A0113 monocarboxylate transporter 1. 98.77
PRK10642 490 proline/glycine betaine transporter; Provisional 98.76
PRK12382 392 putative transporter; Provisional 98.73
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 98.73
PF0677985 DUF1228: Protein of unknown function (DUF1228); In 98.7
KOG1330|consensus 493 98.69
PRK09874 408 drug efflux system protein MdtG; Provisional 98.68
PRK10054 395 putative transporter; Provisional 98.68
PRK10406 432 alpha-ketoglutarate transporter; Provisional 98.64
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 98.6
PRK10207 489 dipeptide/tripeptide permease B; Provisional 98.59
TIGR00897 402 2A0118 polyol permease family. This family of prot 98.59
PRK11195 393 lysophospholipid transporter LplT; Provisional 98.58
PRK15075 434 citrate-proton symporter; Provisional 98.55
PF1283277 MFS_1_like: MFS_1 like family 98.55
TIGR00889 418 2A0110 nucleoside transporter. This family of prot 98.54
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 98.53
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 98.52
TIGR00805 633 oat sodium-independent organic anion transporter. 98.48
PRK11646 400 multidrug resistance protein MdtH; Provisional 98.48
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 98.45
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 98.43
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 98.41
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 98.4
PRK09528 420 lacY galactoside permease; Reviewed 98.39
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 98.39
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 98.38
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 98.36
KOG2504|consensus 509 98.36
KOG2615|consensus 451 98.33
PTZ00207 591 hypothetical protein; Provisional 98.31
PRK09952 438 shikimate transporter; Provisional 98.31
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 98.3
PRK15462 493 dipeptide/tripeptide permease D; Provisional 98.27
KOG0569|consensus 485 98.26
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 98.25
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 98.24
KOG0252|consensus 538 98.23
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 98.23
KOG2532|consensus 466 98.18
TIGR00901 356 2A0125 AmpG-related permease. 98.17
PRK09584 500 tppB putative tripeptide transporter permease; Rev 98.14
PF05631 354 DUF791: Protein of unknown function (DUF791); Inte 98.13
PRK10489 417 enterobactin exporter EntS; Provisional 98.12
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 98.07
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 98.06
PRK11902 402 ampG muropeptide transporter; Reviewed 98.03
PRK15011 393 sugar efflux transporter B; Provisional 98.0
PRK03699394 putative transporter; Provisional 97.98
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 97.97
TIGR00880141 2_A_01_02 Multidrug resistance protein. 97.97
PF03825 400 Nuc_H_symport: Nucleoside H+ symporter 97.96
KOG3764|consensus 464 97.92
PRK15011393 sugar efflux transporter B; Provisional 97.91
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 97.91
PRK09528420 lacY galactoside permease; Reviewed 97.89
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 97.87
KOG0253|consensus 528 97.86
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 97.85
PRK10133438 L-fucose transporter; Provisional 97.83
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 97.83
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 97.81
PRK10473392 multidrug efflux system protein MdtL; Provisional 97.79
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 97.77
PRK10642 490 proline/glycine betaine transporter; Provisional 97.77
TIGR00896355 CynX cyanate transporter. This family of proteins 97.76
TIGR00902382 2A0127 phenyl proprionate permease family protein. 97.74
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 97.73
PRK03893 496 putative sialic acid transporter; Provisional 97.73
TIGR00891405 2A0112 putative sialic acid transporter. 97.72
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 97.71
PRK03633381 putative MFS family transporter protein; Provision 97.7
TIGR01272310 gluP glucose/galactose transporter. Disruption of 97.7
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 97.69
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 97.69
PRK10091382 MFS transport protein AraJ; Provisional 97.67
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 97.67
PRK10077 479 xylE D-xylose transporter XylE; Provisional 97.67
PRK09705393 cynX putative cyanate transporter; Provisional 97.66
PRK15075434 citrate-proton symporter; Provisional 97.65
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 97.64
KOG0569|consensus 485 97.64
PRK12307426 putative sialic acid transporter; Provisional 97.61
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 97.6
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 97.6
TIGR00901356 2A0125 AmpG-related permease. 97.59
KOG3762|consensus 618 97.58
PRK03545390 putative arabinose transporter; Provisional 97.55
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 97.55
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 97.54
PRK09952438 shikimate transporter; Provisional 97.51
PRK10406432 alpha-ketoglutarate transporter; Provisional 97.5
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 97.46
TIGR00895398 2A0115 benzoate transport. 97.45
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 97.44
TIGR00897402 2A0118 polyol permease family. This family of prot 97.44
TIGR00900365 2A0121 H+ Antiporter protein. 97.43
PF06813 250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 97.42
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 97.42
PRK11010 491 ampG muropeptide transporter; Validated 97.38
PRK11010 491 ampG muropeptide transporter; Validated 97.36
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 97.36
PRK15402406 multidrug efflux system translocase MdfA; Provisio 97.35
COG2807 395 CynX Cyanate permease [Inorganic ion transport and 97.35
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 97.34
TIGR00889 418 2A0110 nucleoside transporter. This family of prot 97.33
PRK14995 495 methyl viologen resistance protein SmvA; Provision 97.33
PF13347 428 MFS_2: MFS/sugar transport protein 97.3
PLN00028 476 nitrate transmembrane transporter; Provisional 97.26
PRK10504 471 putative transporter; Provisional 97.23
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 97.23
PRK10489417 enterobactin exporter EntS; Provisional 97.2
PRK05122399 major facilitator superfamily transporter; Provisi 97.11
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 97.1
PRK09874408 drug efflux system protein MdtG; Provisional 97.09
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 97.09
PRK09669 444 putative symporter YagG; Provisional 97.08
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 97.08
PF03137 539 OATP: Organic Anion Transporter Polypeptide (OATP) 97.06
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 97.05
COG2270438 Permeases of the major facilitator superfamily [Ge 96.93
PRK11902402 ampG muropeptide transporter; Reviewed 96.93
PRK12382392 putative transporter; Provisional 96.93
KOG2533|consensus 495 96.9
TIGR00788 468 fbt folate/biopterin transporter. The only functio 96.87
KOG0254|consensus 513 96.85
PRK10429 473 melibiose:sodium symporter; Provisional 96.84
PRK09848 448 glucuronide transporter; Provisional 96.83
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 96.8
PF01306 412 LacY_symp: LacY proton/sugar symporter; InterPro: 96.8
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 96.78
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 96.75
PRK10429 473 melibiose:sodium symporter; Provisional 96.74
TIGR00893399 2A0114 d-galactonate transporter. 96.73
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 96.71
PRK10213394 nepI ribonucleoside transporter; Reviewed 96.71
COG0477 338 ProP Permeases of the major facilitator superfamil 96.67
PRK11043 401 putative transporter; Provisional 96.65
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 96.61
COG2211 467 MelB Na+/melibiose symporter and related transport 96.61
PRK11195393 lysophospholipid transporter LplT; Provisional 96.6
KOG0253|consensus528 96.59
PRK09848 448 glucuronide transporter; Provisional 96.55
TIGR00898505 2A0119 cation transport protein. 96.47
KOG2504|consensus 509 96.46
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 96.4
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 96.36
PRK11462 460 putative transporter; Provisional 96.2
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 96.18
PRK09669 444 putative symporter YagG; Provisional 96.14
PRK11663434 regulatory protein UhpC; Provisional 96.05
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 95.98
KOG4686|consensus459 95.73
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 95.69
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 95.63
TIGR00881379 2A0104 phosphoglycerate transporter family protein 95.62
PF13347 428 MFS_2: MFS/sugar transport protein 95.57
PRK10054395 putative transporter; Provisional 95.53
TIGR00892 455 2A0113 monocarboxylate transporter 1. 95.4
TIGR00788 468 fbt folate/biopterin transporter. The only functio 94.92
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 94.61
TIGR00805 633 oat sodium-independent organic anion transporter. 94.58
COG0738422 FucP Fucose permease [Carbohydrate transport and m 94.47
KOG2563|consensus 480 94.33
COG2807395 CynX Cyanate permease [Inorganic ion transport and 94.33
PF05978156 UNC-93: Ion channel regulatory protein UNC-93; Int 94.3
KOG3626|consensus 735 94.28
KOG2816|consensus 463 94.15
PRK11646400 multidrug resistance protein MdtH; Provisional 94.02
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 93.7
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 93.61
KOG2325|consensus 488 93.34
KOG4332|consensus 454 92.88
KOG2533|consensus 495 92.5
PF11700 477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 92.34
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 92.19
PRK11652394 emrD multidrug resistance protein D; Provisional 92.0
TIGR00880141 2_A_01_02 Multidrug resistance protein. 90.88
PRK11462 460 putative transporter; Provisional 90.45
KOG0252|consensus 538 89.94
KOG0637|consensus 498 89.42
KOG2532|consensus 466 89.33
KOG4686|consensus 459 89.28
KOG3764|consensus464 88.88
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 88.77
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 87.65
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 87.34
COG2270 438 Permeases of the major facilitator superfamily [Ge 87.28
TIGR00769 472 AAA ADP/ATP carrier protein family. These proteins 87.1
PRK15403413 multidrug efflux system protein MdtM; Provisional 86.99
KOG2816|consensus 463 86.65
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 85.59
KOG3574|consensus 510 83.92
PF03209 403 PUCC: PUCC protein; InterPro: IPR004896 This prote 83.22
PRK09584 500 tppB putative tripeptide transporter permease; Rev 82.35
PF01770 412 Folate_carrier: Reduced folate carrier; InterPro: 81.99
PF06963432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 81.57
TIGR01272310 gluP glucose/galactose transporter. Disruption of 81.47
COG2211 467 MelB Na+/melibiose symporter and related transport 81.4
PRK15462 493 dipeptide/tripeptide permease D; Provisional 80.12
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
Probab=99.18  E-value=3.1e-11  Score=75.85  Aligned_cols=74  Identities=9%  Similarity=-0.099  Sum_probs=67.6

Q ss_pred             eccccccccccCCCCCccccchhHHHHHHhhHhhhhhhhhhhhhhhhhchhHHHHHHHHHHHHHHHHHHHhcccccc
Q psy15540          7 WTSPAGDRLIAGEYPFPVTESDLSFIGSSMALGAVFGSPVVGNLVDTVGRKNTMLLLAVPTLVGWGLIIWSQSVSRH   83 (87)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~l~d~~grr~~~~~~~~~~~~~~~~~~~a~~~~~l   83 (87)
                      ...+..|.+++   +++.+.++.++..+.+.++..+++++.|++.||+|||+++..+..+..++.+.+++++++..+
T Consensus        27 ~~~~~lp~i~~---~~~~s~~~~g~~~s~~~~~~~l~~~~~g~l~dr~G~r~~l~~~~~l~~~~~~~~~~a~~~~~l  100 (393)
T PRK09705         27 SVGPLLPQLRQ---ASGMSFSVAALLTALPVVTMGGLALAGSWLHQHVSERRSVAISLLLIAVGALMRELYPQSALL  100 (393)
T ss_pred             ccchhHHHHHH---HhCCCHHHHHHHHHHHHHHHHHHhhhhHHHHHHhCchHHHHHHHHHHHHHHHHHHHCcchHHH
Confidence            34566777777   899999999999999999999999999999999999999999999999999999999987654



>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>KOG4332|consensus Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>KOG0637|consensus Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>KOG3574|consensus Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 99.21
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 99.1
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 98.98
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 98.97
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 98.86
2xut_A 524 Proton/peptide symporter family protein; transport 98.65
2cfq_A 417 Lactose permease; transport, transport mechanism, 98.49
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 98.04
2cfq_A417 Lactose permease; transport, transport mechanism, 97.61
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 97.44
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 97.22
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 95.25
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 93.19
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
Probab=99.21  E-value=2.9e-12  Score=80.49  Aligned_cols=53  Identities=23%  Similarity=0.375  Sum_probs=48.3

Q ss_pred             cccchhHHHHHHhhHhhhhhhhhhhhhhhhhchhHHHHHHHHHHHHHHHHHHH
Q psy15540         24 VTESDLSFIGSSMALGAVFGSPVVGNLVDTVGRKNTMLLLAVPTLVGWGLIIW   76 (87)
Q Consensus        24 ~~~~~~~~~~~~~~~~~~~~~~~~g~l~d~~grr~~~~~~~~~~~~~~~~~~~   76 (87)
                      .++++.+++.+.+.+|..+|++++|+++||+|||+++..+.++..++.+.+++
T Consensus        52 ~~~~~~g~~~s~~~~G~~iG~~~~G~laDr~GRk~~l~~~~~l~~i~~i~~a~  104 (491)
T 4gc0_A           52 AANSLLGFCVASALIGCIIGGALGGYCSNRFGRRDSLKIAAVLFFISGVGSAW  104 (491)
T ss_dssp             HHHHHHHHHHHTHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHHHHHHC
T ss_pred             cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHHHH
Confidence            34456789999999999999999999999999999999999999999999885



>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 98.97
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 98.92
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 97.22
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 96.26
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=98.97  E-value=6.4e-10  Score=67.13  Aligned_cols=58  Identities=12%  Similarity=0.107  Sum_probs=54.0

Q ss_pred             CCccccchhHHHHHHhhHhhhhhhhhhhhhhhhhchhHHHHHHHHHHHHHHHHHHHhc
Q psy15540         21 PFPVTESDLSFIGSSMALGAVFGSPVVGNLVDTVGRKNTMLLLAVPTLVGWGLIIWSQ   78 (87)
Q Consensus        21 ~~~~~~~~~~~~~~~~~~~~~~~~~~~g~l~d~~grr~~~~~~~~~~~~~~~~~~~a~   78 (87)
                      +.+.++++.+++.+.+.++..++.++.|+++||+|||+++..+.++..++.+++++++
T Consensus        53 ~~g~s~~~~g~~~s~~~~~~~~~~~~~G~l~Dr~g~r~~~~~~~~~~~~~~~~~~~~~  110 (447)
T d1pw4a_          53 EQGFSRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVP  110 (447)
T ss_dssp             SSTTCSSCHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHCH
T ss_pred             HhCcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCchHHHHHHHHHHHHHHhhccccc
Confidence            5799999999999999999999999999999999999999999999998888887664



>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure