Psyllid ID: psy15631


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210---
MEKRPFIDEAKRLRAMHMKEHPDYKYRPRRKPKTPGQSIPNNKSPNQGAPAPTSASNAFPSFPLPPYFANHGGGSHPHPLDSLSAAYPPMNMPHYFGSPFDAMNFSKLVQGQTSQADTKSSNAAAAVVSSFYSSLYPSVTSAQTKTFSTPPPSHLSALFQHPTAASSHPSQFLYGLKSEQLSPSSSPGESQSQSNNQSALELDQLRRPVPVIY
cccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccc
cccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccHHccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccEEc
MEKRPFIDEAKRLRAMHmkehpdykyrprrkpktpgqsipnnkspnqgapaptsasnafpsfplppyfanhgggshphpldslsaayppmnmphyfgspfdamnfsklvqgqtsqadtkssnAAAAVVSSFYSslypsvtsaqtktfstpppshlsalfqhptaasshpsqflyglkseqlspssspgesqsqsnnqsaleldqlrrpvpviy
mekrpfideakrlramhmkehpdykyrprrkPKTPGQSIPNNKSPNQGAPAPTSASNAFPSFPLPPYFANHGGGSHPHPLDSLSAAYPPMNMPHYFGSPFDAMNFSKLVQGQTSQADTKSSNAAAAVVSSFYSSLYPSVTSAQTKTFSTPPPSHLSALFQHPTAASSHPSQFLYGLKSEQLSPSSspgesqsqsnnqsaleldqlrrpvpviy
MEKRPFIDEAKRLRAMHMKEHPDYKYRPRRKPKTPGQSIPNNKSPNQGAPAPTSASNAFPSFPLPPYFANHGGGSHPHPLDSLSAAYPPMNMPHYFGSPFDAMNFSKLVQGQTSQADTKssnaaaavvssfyssLYPSVTSAQTKTFSTPPPSHLSALFQHPTAASSHPSQFLYglkseqlspssspgesqsqsnnqsALELDQLRRPVPVIY
**********************************************************************************************YF*********************************SFY*********************************************************************************
*EKRPFIDEAKRLRAMHMKEHPDYK*************************************************************************************************************************************************************************************R******
MEKRPFIDEAKRLRAMHMKEHPDYKYR***************************ASNAFPSFPLPPYFANHGGGSHPHPLDSLSAAYPPMNMPHYFGSPFDAMNFSKLV***************AAVVSSFYSSLYPSV*************SHLSALFQHPTAASSHPSQFLYGLKS********************ALELDQLRRPVPVIY
**KRPFIDEAKRLRAMHMKEHPDYKYRPRRKPKTPGQSIPNNKSPNQGAPAPTSASNAFPSFPLPPYFANHGGGSHPHPLDSLSAAYPPMNMPHYFGSPFDAMNFSKLVQGQTSQADTKSSNAAAAVVSSFYSSLYPSVTS*****FST*******A*FQHPT****HPSQFLYGLK*E***********************DQLRRPVPVIY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKRPFIDEAKRLRAMHMKEHPDYKYRPRRKPKTPGQSIPNNKSPNQGAPAPTSASNAFPSFPLPPYFANHGGGSHPHPLDSLSAAYPPMNMPHYFGSPFDAMNFSKLVQGQTSQADTKSSNAAAAVVSSFYSSLYPSVTSAQTKTFSTPPPSHLSALFQHPTAASSHPSQFLYGLKSEQLSPSSSPGESQSQSNNQSALELDQLRRPVPVIY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query213 2.2.26 [Sep-21-2011]
Q24533382 SOX domain-containing pro yes N/A 0.591 0.329 0.402 2e-16
Q6RVD7245 Transcription factor Sox- yes N/A 0.154 0.134 1.0 2e-13
Q811W0276 Transcription factor SOX- yes N/A 0.154 0.119 1.0 3e-13
Q9Y651276 Transcription factor SOX- yes N/A 0.154 0.119 1.0 3e-13
Q9W7R5280 Transcription factor SOX- yes N/A 0.154 0.117 1.0 5e-13
B0ZTE1262 Transcription factor Sox- N/A N/A 0.154 0.125 0.969 5e-13
P48430315 Transcription factor SOX- yes N/A 0.154 0.104 0.939 8e-13
Q6P0E1315 Transcription factor Sox- no N/A 0.154 0.104 0.939 1e-12
O42569311 Transcription factor Sox- N/A N/A 0.154 0.106 0.939 1e-12
Q6NVN0311 Transcription factor Sox- no N/A 0.154 0.106 0.939 1e-12
>sp|Q24533|DICH_DROME SOX domain-containing protein dichaete OS=Drosophila melanogaster GN=D PE=2 SV=1 Back     alignment and function desciption
 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 76/159 (47%), Gaps = 33/159 (20%)

Query: 2   EKRPFIDEAKRLRAMHMKEHPDYKYRPRRKPKTPGQSIPNNKSPNQGA---------PAP 52
           EKRPFIDEAKRLRA+HMKEHPDYKYRPRRKPK P  + P      Q              
Sbjct: 187 EKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKNPLTAGPQGGLQMQAGGMGQQKLGAGPG 246

Query: 53  TSASNAFPSFPLPPYFANHGGGSHPHPLDSLSAAYPPMNMPHYFGSPFDAMNFSKLVQGQ 112
             A    P   LPPYFA         P   L   YP   +P YFG  FD +  SKL Q Q
Sbjct: 247 AGAGGYNPFHQLPPYFA---------PSHHLDQGYP---VP-YFGG-FDPLALSKLHQSQ 292

Query: 113 TSQADTKSSNAAAAV----------VSSFYSSLYPSVTS 141
            + A   ++                +SSFYS +Y  +++
Sbjct: 293 AAAAAAVNNQGQQQGQAPPQLPPTSLSSFYSGIYSGISA 331




Essential for segmentation and CNS development. May modulate the actions of other transcription factors, including gap and pair-rule proteins.
Drosophila melanogaster (taxid: 7227)
>sp|Q6RVD7|SX21B_DANRE Transcription factor Sox-21-B OS=Danio rerio GN=sox21b PE=2 SV=1 Back     alignment and function description
>sp|Q811W0|SOX21_MOUSE Transcription factor SOX-21 OS=Mus musculus GN=Sox21 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y651|SOX21_HUMAN Transcription factor SOX-21 OS=Homo sapiens GN=SOX21 PE=2 SV=1 Back     alignment and function description
>sp|Q9W7R5|SOX21_CHICK Transcription factor SOX-21 OS=Gallus gallus GN=SOX21 PE=2 SV=1 Back     alignment and function description
>sp|B0ZTE1|SOX21_XENLA Transcription factor Sox-21 OS=Xenopus laevis GN=sox21 PE=2 SV=1 Back     alignment and function description
>sp|P48430|SOX2_CHICK Transcription factor SOX-2 OS=Gallus gallus GN=SOX2 PE=1 SV=1 Back     alignment and function description
>sp|Q6P0E1|SOX2_DANRE Transcription factor Sox-2 OS=Danio rerio GN=sox2 PE=2 SV=1 Back     alignment and function description
>sp|O42569|SOX2_XENLA Transcription factor Sox-2 OS=Xenopus laevis GN=sox2 PE=2 SV=1 Back     alignment and function description
>sp|Q6NVN0|SOX2_XENTR Transcription factor Sox-2 OS=Xenopus tropicalis GN=sox2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query213
345494190 339 PREDICTED: transcription factor Sox-14-l 0.873 0.548 0.426 3e-26
350416776311 PREDICTED: SOX domain-containing protein 0.896 0.614 0.408 4e-22
340721649311 PREDICTED: SOX domain-containing protein 0.915 0.627 0.415 7e-21
380016546279 PREDICTED: SOX domain-containing protein 0.737 0.562 0.459 4e-18
157111610 314 sex-determining region y protein, sry [A 0.600 0.407 0.435 2e-17
357607486202 hypothetical protein KGM_19696 [Danaus p 0.755 0.797 0.448 9e-16
195161050 403 GL24831 [Drosophila persimilis] gi|19411 0.784 0.414 0.369 9e-16
194747990 387 GF25204 [Drosophila ananassae] gi|190623 0.591 0.325 0.412 1e-15
158287886 330 AGAP010919-PA [Anopheles gambiae str. PE 0.582 0.375 0.425 2e-15
195494282 381 GE20027 [Drosophila yakuba] gi|194180871 0.591 0.330 0.411 7e-15
>gi|345494190|ref|XP_003427240.1| PREDICTED: transcription factor Sox-14-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 105/246 (42%), Positives = 129/246 (52%), Gaps = 60/246 (24%)

Query: 2   EKRPFIDEAKRLRAMHMKEHPDYKYRPRRKPKTPGQSIPNNKSPNQGAPAPTSASNAFPS 61
           +K+PFIDEAKRLRA HMKEHPDYKYRPRRKPK P  +IP  K+ + GA        +FPS
Sbjct: 120 QKQPFIDEAKRLRAKHMKEHPDYKYRPRRKPKVPVSAIPGGKNQSMGA--------SFPS 171

Query: 62  FPLPPYFANHGG---GSHPHPLDSLSAAYPPMNMPHYFGSPFDAMNFSKLVQGQTSQADT 118
           F L PYF +  G     HPHPLD     YPP  +P YFGS FDA++  KLV    SQ  +
Sbjct: 172 FTL-PYFGSPAGPVSHHHPHPLD-----YPP--LPGYFGSAFDAVHLGKLVSNTQSQQTS 223

Query: 119 KS--------SNAAAAVVSSFYSSLYPSVTSAQTKTFSTPPPSHLSALFQHPTAASSHPS 170
            +        + +AAAVVSSFYSSLY +  + Q K       + + +LF  P AA  H  
Sbjct: 224 TTAADVANNNAASAAAVVSSFYSSLY-NPAAQQNKVSPYGAATTMGSLF--PGAAHHH-- 278

Query: 171 QFLYGLKSEQLSPSSSPGESQ-----------------------SQSNNQSALELDQLRR 207
                + S  + P S    SQ                       S S    +L+LDQLRR
Sbjct: 279 -----MTSSMMFPGSQLTASQMTHSSSSPSSSPGSTPVSLSHGSSTSPTAPSLDLDQLRR 333

Query: 208 PVPVIY 213
           P+ VIY
Sbjct: 334 PLSVIY 339




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350416776|ref|XP_003491097.1| PREDICTED: SOX domain-containing protein dichaete-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340721649|ref|XP_003399229.1| PREDICTED: SOX domain-containing protein dichaete-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380016546|ref|XP_003692243.1| PREDICTED: SOX domain-containing protein dichaete-like [Apis florea] Back     alignment and taxonomy information
>gi|157111610|ref|XP_001651645.1| sex-determining region y protein, sry [Aedes aegypti] gi|108883819|gb|EAT48044.1| AAEL000893-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|357607486|gb|EHJ65526.1| hypothetical protein KGM_19696 [Danaus plexippus] Back     alignment and taxonomy information
>gi|195161050|ref|XP_002021383.1| GL24831 [Drosophila persimilis] gi|194118496|gb|EDW40539.1| GL24831 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|194747990|ref|XP_001956432.1| GF25204 [Drosophila ananassae] gi|190623714|gb|EDV39238.1| GF25204 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|158287886|ref|XP_001688246.1| AGAP010919-PA [Anopheles gambiae str. PEST] gi|157019404|gb|EDO64436.1| AGAP010919-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195494282|ref|XP_002094770.1| GE20027 [Drosophila yakuba] gi|194180871|gb|EDW94482.1| GE20027 [Drosophila yakuba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query213
FB|FBgn0000411382 D "Dichaete" [Drosophila melan 0.474 0.264 0.5 7.1e-21
ZFIN|ZDB-GENE-060322-5340 sox1b "SRY-box containing gene 0.154 0.097 0.969 2.9e-17
ZFIN|ZDB-GENE-040429-1245 sox21b "SRY-box containing gen 0.154 0.134 1.0 6e-17
ZFIN|ZDB-GENE-990715-6239 sox21a "SRY-box containing gen 0.150 0.133 0.968 6e-17
UNIPROTKB|Q9Y651276 SOX21 "Transcription factor SO 0.154 0.119 1.0 1.6e-16
MGI|MGI:2654070276 Sox21 "SRY-box containing gene 0.154 0.119 1.0 1.6e-16
ZFIN|ZDB-GENE-980526-333300 sox3 "SRY-box containing gene 0.431 0.306 0.484 2.9e-16
UNIPROTKB|B0ZTE1262 sox21 "Transcription factor So 0.154 0.125 0.969 3.2e-16
ZFIN|ZDB-GENE-040718-186336 sox1a "SRY-box containing gene 0.154 0.098 0.969 8.4e-16
UNIPROTKB|F1MIK5369 SOX1 "Uncharacterized protein" 0.154 0.089 0.939 1.6e-15
FB|FBgn0000411 D "Dichaete" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 222 (83.2 bits), Expect = 7.1e-21, Sum P(2) = 7.1e-21
 Identities = 62/124 (50%), Positives = 67/124 (54%)

Query:     2 EKRPFIDEAKRLRAMHMKEHPDYKYRPRRKPKTPGQSIPNNKSPNQ---------GAPAP 52
             EKRPFIDEAKRLRA+HMKEHPDYKYRPRRKPK P  + P      Q         GA   
Sbjct:   187 EKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKNPLTAGPQGGLQMQAGGMGQQKLGAGPG 246

Query:    53 TSASNAFPSFPLPPYFANHGGGSHPHPLDSLSAAYPPMNMPHYFGSPFDAMNFSKLVQGQ 112
               A    P   LPPYFA     SH H    L   YP   +P YFG  FD +  SKL Q Q
Sbjct:   247 AGAGGYNPFHQLPPYFAP----SH-H----LDQGYP---VP-YFGG-FDPLALSKLHQSQ 292

Query:   113 TSQA 116
              + A
Sbjct:   293 AAAA 296


GO:0007350 "blastoderm segmentation" evidence=IMP
GO:0007417 "central nervous system development" evidence=IMP
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0008301 "DNA binding, bending" evidence=NAS;IDA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
GO:0003677 "DNA binding" evidence=IDA
GO:0035120 "post-embryonic appendage morphogenesis" evidence=IMP
GO:0002168 "instar larval development" evidence=IMP
GO:0007442 "hindgut morphogenesis" evidence=IMP
GO:0007420 "brain development" evidence=IMP
GO:0003705 "RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity" evidence=IDA
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IDA
GO:0003730 "mRNA 3'-UTR binding" evidence=IDA
GO:0009950 "dorsal/ventral axis specification" evidence=IMP
GO:0060810 "intracellular mRNA localization involved in pattern specification process" evidence=IMP
GO:0008134 "transcription factor binding" evidence=IPI
GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=IMP
GO:0043565 "sequence-specific DNA binding" evidence=IDA
GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IDA
ZFIN|ZDB-GENE-060322-5 sox1b "SRY-box containing gene 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040429-1 sox21b "SRY-box containing gene 21 b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990715-6 sox21a "SRY-box containing gene 21a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y651 SOX21 "Transcription factor SOX-21" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2654070 Sox21 "SRY-box containing gene 21" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-980526-333 sox3 "SRY-box containing gene 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|B0ZTE1 sox21 "Transcription factor Sox-21" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-186 sox1a "SRY-box containing gene 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MIK5 SOX1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P40670CH31_CHICKNo assigned EC number0.92590.12670.5noN/A
P40667CH03_CHICKNo assigned EC number0.92590.12670.5noN/A
P40642AMA2_ALLMINo assigned EC number0.92590.12670.5N/AN/A
P40669CH07_CHICKNo assigned EC number0.92590.12670.5noN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query213
cd0138872 cd01388, SOX-TCF_HMG-box, SOX-TCF_HMG-box, class I 3e-09
cd0138977 cd01389, MATA_HMG-box, MATA_HMG-box, class I membe 2e-04
pfam0050569 pfam00505, HMG_box, HMG (high mobility group) box 3e-04
>gnl|CDD|238684 cd01388, SOX-TCF_HMG-box, SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
 Score = 51.1 bits (123), Expect = 3e-09
 Identities = 15/26 (57%), Positives = 23/26 (88%)

Query: 2  EKRPFIDEAKRLRAMHMKEHPDYKYR 27
          EK+P+ +EAK+L+ +HMK +PDYK+R
Sbjct: 47 EKQPYYEEAKKLKELHMKLYPDYKWR 72


These proteins contain a single HMG box, and bind the minor groove of DNA in a highly sequence-specific manner. Members include SRY and its homologs in insects and vertebrates, and transcription factor-like proteins, TCF-1, -3, -4, and LEF-1. They appear to bind the minor groove of the A/T C A A A G/C-motif. Length = 72

>gnl|CDD|238685 cd01389, MATA_HMG-box, MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>gnl|CDD|189580 pfam00505, HMG_box, HMG (high mobility group) box Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 213
KOG0527|consensus331 99.54
cd0138977 MATA_HMG-box MATA_HMG-box, class I member of the H 98.45
KOG0528|consensus511 98.19
cd0138872 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of 97.7
KOG3248|consensus421 91.58
smart0039870 HMG high mobility group. 91.56
PF0050569 HMG_box: HMG (high mobility group) box; InterPro: 89.76
cd0008466 HMG-box High Mobility Group (HMG)-box is found in 85.46
>KOG0527|consensus Back     alignment and domain information
Probab=99.54  E-value=5.9e-15  Score=134.05  Aligned_cols=37  Identities=73%  Similarity=1.137  Sum_probs=34.9

Q ss_pred             CcchhHHHHHHHHHHHHhhCCCCcccCCCCCCCCCCC
Q psy15631          2 EKRPFIDEAKRLRAMHMKEHPDYKYRPRRKPKTPGQS   38 (213)
Q Consensus         2 EK~PyideAkrLKa~H~k~YPdYKYrPRRK~k~~~~~   38 (213)
                      ||+||||||||||++||++|||||||||||+|+....
T Consensus       108 EKrPFi~EAeRLR~~HmkehPdYKYRPRRKkk~~~~~  144 (331)
T KOG0527|consen  108 EKRPFVDEAERLRAQHMKEYPDYKYRPRRKKKKRPKL  144 (331)
T ss_pred             hhccHHHHHHHHHHHHHHhCCCccccccccccccccc
Confidence            8999999999999999999999999999999887764



>cd01389 MATA_HMG-box MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>KOG0528|consensus Back     alignment and domain information
>cd01388 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>KOG3248|consensus Back     alignment and domain information
>smart00398 HMG high mobility group Back     alignment and domain information
>PF00505 HMG_box: HMG (high mobility group) box; InterPro: IPR000910 High mobility group (HMG or HMGB) proteins are a family of relatively low molecular weight non-histone components in chromatin Back     alignment and domain information
>cd00084 HMG-box High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query213
2le4_A81 Solution Structure Of The Hmg Box Dna-Binding Domai 1e-12
1gt0_D80 Crystal Structure Of A PouHMGDNA TERNARY COMPLEX Le 2e-12
1o4x_B88 Ternary Complex Of The Dna Binding Domains Of The O 2e-12
3f27_D83 Structure Of Sox17 Bound To Dna Length = 83 7e-08
4euw_A106 Crystal Structure Of A Hmg Domain Of Transcription 2e-07
3u2b_C79 Structure Of The Sox4 Hmg Domain Bound To Dna Lengt 2e-05
1j47_A85 3d Solution Nmr Structure Of The M9i Mutant Of The 3e-05
1j46_A85 3d Solution Nmr Structure Of The Wild Type Hmg-Box 3e-05
2yul_A82 Solution Structure Of The Hmg Box Of Human Transcri 6e-05
4a3n_A71 Crystal Structure Of Hmg-Box Of Human Sox17 Length 1e-04
>pdb|2LE4|A Chain A, Solution Structure Of The Hmg Box Dna-Binding Domain Of Human Stem Cell Transcription Factor Sox2 Length = 81 Back     alignment and structure

Iteration: 1

Score = 69.3 bits (168), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 31/33 (93%), Positives = 32/33 (96%) Query: 2 EKRPFIDEAKRLRAMHMKEHPDYKYRPRRKPKT 34 EKRPFIDEAKRLRA+HMKEHPDYKYRPRRK KT Sbjct: 49 EKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT 81
>pdb|1GT0|D Chain D, Crystal Structure Of A PouHMGDNA TERNARY COMPLEX Length = 80 Back     alignment and structure
>pdb|1O4X|B Chain B, Ternary Complex Of The Dna Binding Domains Of The Oct1 And Sox2 Transcription Factors With A 19mer Oligonucleotide From The Hoxb1 Regulatory Element Length = 88 Back     alignment and structure
>pdb|3F27|D Chain D, Structure Of Sox17 Bound To Dna Length = 83 Back     alignment and structure
>pdb|4EUW|A Chain A, Crystal Structure Of A Hmg Domain Of Transcription Factor Sox-9 Bound To Dna (Sox-9DNA) FROM HOMO SAPIENS AT 2.77 A RESOLUTION Length = 106 Back     alignment and structure
>pdb|3U2B|C Chain C, Structure Of The Sox4 Hmg Domain Bound To Dna Length = 79 Back     alignment and structure
>pdb|1J47|A Chain A, 3d Solution Nmr Structure Of The M9i Mutant Of The Hmg-Box Domain Of The Human Male Sex Determining Factor Sry Complexed To Dna Length = 85 Back     alignment and structure
>pdb|1J46|A Chain A, 3d Solution Nmr Structure Of The Wild Type Hmg-Box Domain Of The Human Male Sex Determining Factor Sry Complexed To Dna Length = 85 Back     alignment and structure
>pdb|2YUL|A Chain A, Solution Structure Of The Hmg Box Of Human Transcription Factor Sox-17 Length = 82 Back     alignment and structure
>pdb|4A3N|A Chain A, Crystal Structure Of Hmg-Box Of Human Sox17 Length = 71 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query213
3u2b_C79 Transcription factor SOX-4; HMG domain, transcript 4e-16
1gt0_D80 Transcription factor SOX-2; POU factors, SOX prote 4e-16
1j46_A85 SRY, sex-determining region Y protein; MALE sex de 6e-16
3f27_D83 Transcription factor SOX-17; protein-DNA complex, 3e-15
2lef_A86 LEF-1 HMG, protein (lymphoid enhancer-binding fact 1e-14
1i11_A81 Transcription factor SOX-5; HMG BOX, DNA bending, 1e-14
1wz6_A82 HMG-box transcription factor BBX; bobby SOX homolo 4e-14
4euw_A106 Transcription factor SOX-9; protein-DNA complex, H 9e-14
1hry_A76 Human SRY; DNA, DNA-binding protein, DNA binding p 1e-12
4a3n_A71 Transcription factor SOX-17; 2.40A {Homo sapiens} 3e-10
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 1e-09
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 7e-05
2e6o_A87 HMG box-containing protein 1; HMG-box domain, HMG- 1e-07
2crj_A92 SWI/SNF-related matrix-associated actin- dependent 8e-06
1wgf_A90 Upstream binding factor 1; transcription factor, D 2e-05
1hme_A77 High mobility group protein fragment-B; DNA-bindin 1e-04
2lhj_A97 High mobility group protein homolog NHP1; structur 4e-04
>3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} Length = 79 Back     alignment and structure
 Score = 69.1 bits (170), Expect = 4e-16
 Identities = 21/32 (65%), Positives = 26/32 (81%)

Query: 2  EKRPFIDEAKRLRAMHMKEHPDYKYRPRRKPK 33
          +K PFI EA+RLR  HM ++PDYKYRPR+K K
Sbjct: 48 DKIPFIQEAERLRLKHMADYPDYKYRPRKKVK 79


>1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B Length = 80 Back     alignment and structure
>1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A Length = 85 Back     alignment and structure
>3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} PDB: 2yul_A Length = 83 Back     alignment and structure
>2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 Length = 86 Back     alignment and structure
>1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 Length = 81 Back     alignment and structure
>1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Length = 82 Back     alignment and structure
>4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} Length = 106 Back     alignment and structure
>1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* Length = 76 Back     alignment and structure
>4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} Length = 71 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Length = 159 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Length = 159 Back     alignment and structure
>2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Length = 92 Back     alignment and structure
>1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Length = 90 Back     alignment and structure
>1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Length = 77 Back     alignment and structure
>2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} Length = 97 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query213
1i11_A81 Transcription factor SOX-5; HMG BOX, DNA bending, 98.71
3u2b_C79 Transcription factor SOX-4; HMG domain, transcript 98.61
1j46_A85 SRY, sex-determining region Y protein; MALE sex de 98.58
3f27_D83 Transcription factor SOX-17; protein-DNA complex, 98.56
1gt0_D80 Transcription factor SOX-2; POU factors, SOX prote 98.5
2lef_A86 LEF-1 HMG, protein (lymphoid enhancer-binding fact 98.2
1hry_A76 Human SRY; DNA, DNA-binding protein, DNA binding p 98.06
1wz6_A82 HMG-box transcription factor BBX; bobby SOX homolo 98.0
1k99_A99 Upstream binding factor 1; alpha-helix, L-shape, D 97.37
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 97.0
4a3n_A71 Transcription factor SOX-17; 2.40A {Homo sapiens} 96.81
1hme_A77 High mobility group protein fragment-B; DNA-bindin 95.37
2co9_A102 Thymus high mobility group box protein TOX; TOX pr 95.35
2crj_A92 SWI/SNF-related matrix-associated actin- dependent 95.08
2cs1_A92 PMS1 protein homolog 1; DNA mismatch repair protei 93.99
1wxl_A73 Single-strand recognition protein; FACT, SSRP1, HM 93.6
1aab_A83 High mobility group protein; HMG-BOX, DNA-binding; 92.53
3nm9_A73 HMG-D, high mobility group protein D; DNA bending, 89.64
1v63_A101 Nucleolar transcription factor 1; DNA binding, str 89.09
1ckt_A71 High mobility group 1 protein; high-mobility group 88.75
1v64_A108 Nucleolar transcription factor 1; DNA binding, str 83.76
2cto_A93 Novel protein; high mobility group box domain, hel 82.21
>1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
Probab=98.71  E-value=5.2e-09  Score=74.00  Aligned_cols=31  Identities=48%  Similarity=0.963  Sum_probs=22.5

Q ss_pred             CcchhHHHHHHHHHHHHhhCCCCcccCCCCC
Q psy15631          2 EKRPFIDEAKRLRAMHMKEHPDYKYRPRRKP   32 (213)
Q Consensus         2 EK~PyideAkrLKa~H~k~YPdYKYrPRRK~   32 (213)
                      ||++|+++|++++++|+++||||+|+||||+
T Consensus        50 eK~~y~~~A~~~k~~~~~~~p~Yky~pr~~~   80 (81)
T 1i11_A           50 EKQPYYEEQARLSKQHLEKYPDYKYKPRPKR   80 (81)
T ss_dssp             GGHHHHHHHHHHHHHHHTTCSCC--------
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCeeccCCCC
Confidence            7999999999999999999999999999875



>3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A Back     alignment and structure
>3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} SCOP: a.21.1.1 PDB: 2yul_A Back     alignment and structure
>1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B Back     alignment and structure
>2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* Back     alignment and structure
>1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Back     alignment and structure
>1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Back     alignment and structure
>4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} SCOP: a.21.1.0 Back     alignment and structure
>1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Back     alignment and structure
>2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Back     alignment and structure
>2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 Back     alignment and structure
>3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} SCOP: a.21.1.1 PDB: 1e7j_A* 1hma_A 1qrv_A* Back     alignment and structure
>1v63_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A Back     alignment and structure
>1v64_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2cto_A Novel protein; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 213
d1gt0d_80 a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 2e-13
d1j46a_85 a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 96 2e-11
d2lefa_86 a.21.1.1 (A:) Lymphoid enhancer-binding factor, LE 2e-10
d1i11a_70 a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 2e-06
d1hsma_79 a.21.1.1 (A:) High mobility group protein 1, HMG1 3e-06
d1v64a_108 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 5e-05
d1k99a_91 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 8e-05
d1qrva_73 a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxI 1e-04
d1v63a_101 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 0.001
d1ckta_71 a.21.1.1 (A:) High mobility group protein 1, HMG1 0.001
d1lwma_93 a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces 0.003
>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure

class: All alpha proteins
fold: HMG-box
superfamily: HMG-box
family: HMG-box
domain: Sox-2
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 61.4 bits (149), Expect = 2e-13
 Identities = 31/33 (93%), Positives = 32/33 (96%)

Query: 2  EKRPFIDEAKRLRAMHMKEHPDYKYRPRRKPKT 34
          EKRPFIDEAKRLRA+HMKEHPDYKYRPRRK KT
Sbjct: 48 EKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT 80


>d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 Back     information, alignment and structure
>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Length = 79 Back     information, alignment and structure
>d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Length = 73 Back     information, alignment and structure
>d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 Back     information, alignment and structure
>d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 93 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query213
d1gt0d_80 Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} 98.31
d2lefa_86 Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus 98.05
d1j46a_85 SRY {Human (Homo sapiens) [TaxId: 9606]} 97.96
d1i11a_70 Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} 97.16
d1hsma_79 High mobility group protein 1, HMG1 {Hamster (Cric 90.83
d1qrva_73 HMG-D {Drosophila melanogaster [TaxId: 7227]} 86.17
d1ckta_71 High mobility group protein 1, HMG1 {Rat (Rattus n 83.29
d1v63a_101 Nucleolar transcription factor 1 (Upstream binding 80.39
>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: HMG-box
superfamily: HMG-box
family: HMG-box
domain: Sox-2
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=98.31  E-value=1.3e-07  Score=66.53  Aligned_cols=33  Identities=94%  Similarity=1.487  Sum_probs=30.6

Q ss_pred             CcchhHHHHHHHHHHHHhhCCCCcccCCCCCCC
Q psy15631          2 EKRPFIDEAKRLRAMHMKEHPDYKYRPRRKPKT   34 (213)
Q Consensus         2 EK~PyideAkrLKa~H~k~YPdYKYrPRRK~k~   34 (213)
                      ||.+|.++|+++|++|.+++|+|+|+||||.|+
T Consensus        48 eK~~y~~~A~~~k~~y~~~~p~Yk~~p~rk~kt   80 (80)
T d1gt0d_          48 EKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT   80 (80)
T ss_dssp             HHHHHHHHHHHHHHHHHHHCTTCCCCCCCCCC-
T ss_pred             HHHHHHHHHHHHHHHHHHHCccccCCCCCCCCC
Confidence            689999999999999999999999999998764



>d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure