Psyllid ID: psy15732

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550

FKIDPACGDTIGARLSVLDTTRSSVLDTTRYSELPGTRYYPVLDTTRYSVLLGTRTTRILILELALECRVCEDIFLTQGDKVPRLLHCGHTVCLACLLRLPIKDDTITCPFDRQPTPVGYSGVWGLKKNFALLELIEKIQTNDEKATESIPLFSAELHIKCDFSLQLHIKCDEDESHIAVLYCTVCASHLCEQCASDSHATRTLQKHRRIPLSEKPREKPFCSSHPTNIAEFICLEEHCQTSAQYPPLMCFICKDYGRHKTHKHALVEIEAENLRSYVKNASSNVQHLIEEITESVNTVDLVVSKIEGNTGPSGTEPGTGDQARAKVHAYFNHLRESLLVQEAAATSAVDMFVRERLGCLVQLHDDMGFWLQEVAKLYLKCEQMILQDDARVLTSGREIKEAIETIEKYDTLFNELTPEQIHPDPCIPITFTKDNRVHIGPKMEMRVVTLGLDSADSADKERLPEALAELTKLIAEKELKDAALLLLANKQDIPGCETVESITEAFDLYKLCCGRSWHIQACNAQSGEGLHEGLDWLSRQLIAAGVNDMS

cccccccccEEEccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccEEEcccccccccccccccEEEccccHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEcccccHHHHHHHHHHHHcccccccccEEccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHEEEcccccccccccccHHHHHHHHHHHHccccccccEEEEEEccccccccccHHHHHHHHccccccccccEEEEcccccccccHHHHHHHHHHHHHHHcccccc

ccccccccccccEEEEEEccccccccccccccccccccEccccccHHHcccccccccEEEEccEEEEcccHHHHccccccccccEccccHHHHHHHHHcccccccEEEcccccEEEEcccccHHHHHHHHHHHHHHHHHHHccccccccccccHccccccccHHccccccccccccccEEEEEcEccHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEEEEccccccccccHHHHHHHHHHcccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHccHHHHHHHHHHHHHHHHHHHHHcHHHcccccccEEEEEccccEEEcccEEEEEEEEEccccEccccccHHHHHHHHHHHHccHHHcccEEEEEEEcccccccccHHHHHHHccHccccccccEEEEEcEccccEcHHHHHHHHHHHHHHccccccc

fkidpacgdtiGARLSVLDttrssvldttryselpgtryypvldttrYSVLLGTRTTRILILELALECRVCEDIfltqgdkvprllhcghTVCLACllrlpikddtitcpfdrqptpvgysgvwgLKKNFALLELIEKIQTndekatesiplfsaELHIkcdfslqlhikcdedesHIAVLYCTVCAShlceqcasdshATRTLqkhrriplsekprekpfcsshptniAEFICLeehcqtsaqypplmcfickdygrhkthkHALVEIEAENLRSYVKNASSNVQHLIEEITESVNTVDLVVSKiegntgpsgtepgtgdqARAKVHAYFNHLRESLLVQEAAATSAVDMFVRERLGCLVQLHDDMGFWLQEVAKLYLKCEQMILQDDARVLTSGREIKEAIETIEKYDTLFneltpeqihpdpcipitftkdnrvhigpkmEMRVVTLGldsadsadkERLPEALAELTKLIAEKELKDAALLLLAnkqdipgcetvESITEAFDLYKlccgrswhiqacnaqsgeglheGLDWLSRQLIAAGVNDMS

fkidpacgdtigarlsvldttrssvldttryselpgtryypvldtTRYSVLLGTRTTRILILELALECRVCEDIFLTQGDKVPRLLHCGHTVCLACLLRLPIKDDTITCPFDRQPTPVGYSGVWGLKKNFALLELIEKIQTNDEKATESIPLFSAELHIKCDFSLQLHIKCDEDESHIAVLYCTVCASHLCEQCASDSHATRTLQKhrriplsekprekpfcssHPTNIAEFICLEEHCQTSAQYPPLMCFICKDYGRHKTHKHALVEIEAENLRSYVKNASSNVQHLIEEITESVNTVDLVVSKIEgntgpsgtepgtgDQARAKVHAYFNHLRESLLVQEAAATSAVDMFVRERLGCLVQLHDDMGFWLQEVAKLYLKCEQMILQDDARVLTSGREIKEAIETIEKYDTLFNELTPeqihpdpcipitftkdnrvhigPKMEMRVVTLGLDSADSADKERLPEALAELTKLIAEKELKDAALLLLANKQDIPGCETVESITEAFDLYKLCCGRSWHIQACNAQSGEGLHEGLDWLSRQLIAAGVNDMS

FKIDPACGDTIGARLSVLDTTRSSVLDTTRYSELPGTRYYPVLDTTRYSVllgtrttrililelaleCRVCEDIFLTQGDKVPRLLHCGHTVCLACLLRLPIKDDTITCPFDRQPTPVGYSGVWGLKKNFALLELIEKIQTNDEKATESIPLFSAELHIKCDFSLQLHIKCDEDESHIAVLYCTVCASHLCEQCASDSHATRTLQKHRRIPLSEKPREKPFCSSHPTNIAEFICLEEHCQTSAQYPPLMCFICKDYGRHKTHKHALVEIEAENLRSYVKNASSNVQHLIEEITESVNTVDLVVSKIEGNTGPSGTEPGTGDQARAKVHAYFNHLRESLLVQEAAATSAVDMFVRERLGCLVQLHDDMGFWLQEVAKLYLKCEQMILQDDARVLTSGREIKEAIETIEKYDTLFNELTPEQIHPDPCIPITFTKDNRVHIGPKMEMRVVTLGLDSADSADKERLPEALAELTkliaekelkdaallllankQDIPGCETVESITEAFDLYKLCCGRSWHIQACNAQSGEGLHEGLDWLSRQLIAAGVNDMS

*******GDTIGARLSVLDTTRSSVLDTTRYSELPGTRYYPVLDTTRYSVLLGTRTTRILILELALECRVCEDIFLTQGDKVPRLLHCGHTVCLACLLRLPIKDDTITCPFDRQPTPVGYSGVWGLKKNFALLELIEKIQTNDEKATESIPLFSAELHIKCDFSLQLHIKCDEDESHIAVLYCTVCASHLCEQCA******************************PTNIAEFICLEEHCQTSAQYPPLMCFICKDYGRHKTHKHALVEIEAENLRSYVKNASSNVQHLIEEITESVNTVDLVVSKI*******************KVHAYFNHLRESLLVQEAAATSAVDMFVRERLGCLVQLHDDMGFWLQEVAKLYLKCEQMILQDDARVLTSGREIKEAIETIEKYDTLFNELTPEQIHPDPCIPITFTKDNRVHIGPKMEMRVVTLGL*************ALAELTKLIAEKELKDAALLLLANKQDIPGCETVESITEAFDLYKLCCGRSWHIQACNAQSGEGLHEGLDWLSRQLIAA******

******CGDTIGARLSVL******************TRYYPVLDT*****************ELALECRVCEDIFLTQGDKVPRLLHCGHTVCLACLLRLPIKDDTITCPFDRQPTPVGYSGVWGLKKNFALLELIE***********************CDFSLQLHIKCDEDESHIAVLYCTVCASHLCEQCASDSHATRT******************CSSHPTNIAEFICLEEHCQTSAQYPPLMCFICKDYGRHKTHKHALVEIEAEN***************************************************AKVHAYFNHLRESLLV********VDMFVRERLGCLVQLHDDMGFWLQEVAKLYLKCEQMILQDDARVLTSGREIKEAIETIEKYDTLFNELTPEQIHPDPCIPITFTKDNRVHIGPKMEMRVVTLGLDSADSADKERLPEALAELTKLIAEKELKDAALLLLANKQDIPGCETVESITEAFDLYKLCCGRSWHIQACNAQSGEGLHEGLDWLSRQLIAA******

FKIDPACGDTIGARLSVLDTTRSSVLDTTRYSELPGTRYYPVLDTTRYSVLLGTRTTRILILELALECRVCEDIFLTQGDKVPRLLHCGHTVCLACLLRLPIKDDTITCPFDRQPTPVGYSGVWGLKKNFALLELIEKIQTN************************LHIKCDEDESHIAVLYCTVCASHLCEQCASDSHATRTLQKHRRIPLSEKPREKPFCSSHPTNIAEFICLEEHCQTSAQYPPLMCFICKDYGRHKTHKHALVEIEAENLRSYVKNASSNVQHLIEEITESVNTVDLVVSKIEGNTGPSGTEPGTGDQARAKVHAYFNHLRESLLVQEAAATSAVDMFVRERLGCLVQLHDDMGFWLQEVAKLYLKCEQMILQDDARVLTSGREIKEAIETIEKYDTLFNELTPEQIHPDPCIPITFTKDNRVHIGPKMEMRVVTLGLDSADSADKERLPEALAELTKLIAEKELKDAALLLLANKQDIPGCETVESITEAFDLYKLCCGRSWHIQACNAQSGEGLHEGLDWLSRQLIAAG*****

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

FKIDPACGDTIGARLSVLDTTRSSVLDTTRYSELPGTRYYPVLDTTRYSVLLGTRTTRILILELALECRVCEDIFLTQGDKVPRLLHCGHTVCLACLLRLPIKDDTITCPFDRQPTPVGYSGVWGLKKNFALLELIEKIQTNDEKATESIPLFSAELHIKCDFSLQLHIKCDEDESHIAVLYCTVCASHLCEQCASDSHATRTLQKHRRIPLSEKPREKPFCSSHPTNIAEFICLEEHCQTSAQYPPLMCFICKDYGRHKTHKHALVEIExxxxxxxxxxxxxxxxxxxxxITESVNTVDLVVSKIEGNTGPSGTEPGTGDQARAKVHAYFNHLRESLLVQEAAATSAVDMFVRERLGCLVQLHDDMGFWLQEVAKLYLKCEQMILQDDARVLTSGREIKEAIETIEKYDTLFNELTPEQIHPDPCIPITFTKDNRVHIGPKMEMRVVTLGLDSADSADKERLPEALAELTKLIAEKELKDAALLLLANKQDIPGCETVESITEAFDLYKLCCGRSWHIQACNAQSGEGLHEGLDWLSRQLIAAGVNDMS

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		550	2.2.26 [Sep-21-2011]
P36407		573	E3 ubiquitin-protein liga	yes	N/A	0.872	0.837	0.406	1e-105
P36406		574	E3 ubiquitin-protein liga	yes	N/A	0.698	0.668	0.487	1e-104
Q8BGX0		574	E3 ubiquitin-protein liga	yes	N/A	0.698	0.668	0.483	1e-103
Q09654		539	E3 ubiquitin-protein liga	yes	N/A	0.669	0.682	0.344	5e-58
P61210		182	ADP-ribosylation factor 1	N/A	N/A	0.154	0.467	0.534	9e-19
P61209		182	ADP-ribosylation factor 1	yes	N/A	0.154	0.467	0.534	9e-19
Q10943		181	ADP-ribosylation factor 1	no	N/A	0.154	0.469	0.534	1e-18
Q61LA8		181	ADP-ribosylation factor 1	N/A	N/A	0.154	0.469	0.534	1e-18
P84082		181	ADP-ribosylation factor 2	no	N/A	0.154	0.469	0.534	1e-18
Q8BSL7		181	ADP-ribosylation factor 2	no	N/A	0.154	0.469	0.534	1e-18

>sp\|P36407\|TRI23_RAT E3 ubiquitin-protein ligase TRIM23 OS=Rattus norvegicus GN=Trim23 PE=2 SV=2	Back alignment and function desciption

 Score =  382 bits (982), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 233/573 (40%), Positives = 322/573 (56%), Gaps = 93/573 (16%)

Query: 53  GTRTTRILILELALECRVCEDIFLTQGDKVPRLLHCGHTVCLACLLRLPIKDDTITCPFD 112
           G+R T ++ +   LEC VCED+F  QGDKVPRLL CGHTVC  CL RLP+    I CPFD
Sbjct: 19  GSRGTAVVKV---LECGVCEDVFSLQGDKVPRLLLCGHTVCHDCLTRLPLHGRAIRCPFD 75

Query: 113 RQPTPVGYSGVWGLKKNFALLELIEKIQTND----EKATESIPLFSAELHIKCDFSLQLH 168
           RQ T +G SGVWGLKKNFALLEL+E++Q         A E++ +    +           
Sbjct: 76  RQVTDLGDSGVWGLKKNFALLELLERLQNGHIGQYGAAEEALGISGESI----------- 124

Query: 169 IKCDEDESHIAVLYCTVCASHLCEQCASDSHATRTLQKHRRIPLSEKPREKPFCSSHPTN 228
           I+CDEDE+H+A +YCTVCA+HLC +C+  +H+T+TL KHRR+PL++KP EK  C  H  +
Sbjct: 125 IRCDEDEAHVASVYCTVCATHLCSECSQVTHSTKTLAKHRRVPLADKPHEKTMCCQHQVH 184

Query: 229 IAEFICLEEHCQTSAQYPPLMCFICKDYGRHKTHKHALVEIEAENLRSYVKNASSNVQHL 288
             EF+CLEE CQTS    PLMC +CK+YG+H+ HKH+++E EA  +R+ + + +  ++  
Sbjct: 185 AIEFVCLEEACQTS----PLMCCVCKEYGKHQGHKHSVLEPEANQIRASILDMAHCIRTF 240

Query: 289 IEEITESVNTVDLVVSKIEGN-------TGPSGTE--PGTGDQARAKVHAYFNHLRESLL 339
            EEI++    +  +V  IEG         G + TE  PGT + AR+ V AYF+ L E+L 
Sbjct: 241 TEEISDYSRKLVGIVQHIEGGEQIVEDGIGMAHTEHVPGTAENARSCVRAYFSDLHETLC 300

Query: 340 VQEAAATSAVD-------MFVRER---------------LGCLVQLHDDMGFWL--QEVA 375
            QE  A S VD       +++R++               L C     DD    L  QE+ 
Sbjct: 301 RQEEMALSVVDAHVREKLIWLRQQQEDMTILLSQVSTACLHCKTLQQDDCRVVLAKQEIT 360

Query: 376 KLY--LKCEQ-----------------MILQDDARVLTSG----REIKEAIETIEKYDTL 412
           +L   L+ +Q                 +    D RV        R +   ++   K   L
Sbjct: 361 RLLETLQKQQQQFTEVADHIQLDASIPVTFTKDNRVYHGPKMEIRVVTLGLDGAGKTTIL 420

Query: 413 FNELTPEQIHPDPCIPITFT-------KDNRVHIGPKMEMRVV--------TLGLDSADS 457
           F     E + P P I            K     +G K ++R +           +   DS
Sbjct: 421 FKLKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWKHYYLNTQAVVFVVDS 480

Query: 458 ADKERLPEALAELTKLIAEKELKDAALLLLANKQDIPGCETVESITEAFDLYKLCCGRSW 517
           + ++R+ EA +EL KL+ EKEL+DA LL+ ANKQD+ G  +VE ITE   L+KLCCGRSW
Sbjct: 481 SHRDRISEAHSELAKLLTEKELRDALLLIFANKQDVAGALSVEEITELLSLHKLCCGRSW 540

Query: 518 HIQACNAQSGEGLHEGLDWLSRQLIAAGVNDMS 550
           +IQ C+A+SG GL+EGLDWLSRQL+AAGV D++
Sbjct: 541 YIQGCDARSGMGLYEGLDWLSRQLVAAGVLDVA 573

Acts as an E3 ubiquitin-protein ligase (By similarity). The C-terminus can act as an allosteric activator of the cholera toxin catalytic subunit.
Rattus norvegicus (taxid: 10116)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -

>sp\|P36406\|TRI23_HUMAN E3 ubiquitin-protein ligase TRIM23 OS=Homo sapiens GN=TRIM23 PE=1 SV=1	Back alignment and function description

>sp\|Q8BGX0\|TRI23_MOUSE E3 ubiquitin-protein ligase TRIM23 OS=Mus musculus GN=Trim23 PE=2 SV=1	Back alignment and function description

>sp\|Q09654\|TRI23_CAEEL E3 ubiquitin-protein ligase arc-1 OS=Caenorhabditis elegans GN=arc-1 PE=3 SV=3	Back alignment and function description

>sp\|P61210\|ARF1_LOCMI ADP-ribosylation factor 1 OS=Locusta migratoria GN=ARF1 PE=2 SV=2	Back alignment and function description

>sp\|P61209\|ARF1_DROME ADP-ribosylation factor 1 OS=Drosophila melanogaster GN=Arf79F PE=2 SV=2	Back alignment and function description

>sp\|Q10943\|ARF12_CAEEL ADP-ribosylation factor 1-like 2 OS=Caenorhabditis elegans GN=arf-1.2 PE=2 SV=2	Back alignment and function description

>sp\|Q61LA8\|ARF12_CAEBR ADP-ribosylation factor 1-like 2 OS=Caenorhabditis briggsae GN=arf-1.2 PE=3 SV=3	Back alignment and function description

>sp\|P84082\|ARF2_RAT ADP-ribosylation factor 2 OS=Rattus norvegicus GN=Arf2 PE=2 SV=1	Back alignment and function description

>sp\|Q8BSL7\|ARF2_MOUSE ADP-ribosylation factor 2 OS=Mus musculus GN=Arf2 PE=1 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		550
193575609		573	PREDICTED: e3 ubiquitin-protein ligase T	0.732	0.703	0.558	1e-123
302393777		573	RecName: Full=E3 ubiquitin-protein ligas	0.872	0.837	0.406	1e-103
395825390		574	PREDICTED: E3 ubiquitin-protein ligase T	0.698	0.668	0.487	1e-103
417402910		574	Putative e3 ubiquitin-protein ligase tri	0.716	0.686	0.479	1e-103
4502197		574	E3 ubiquitin-protein ligase TRIM23 isofo	0.698	0.668	0.487	1e-103
354491683		574	PREDICTED: E3 ubiquitin-protein ligase T	0.698	0.668	0.485	1e-103
301767844		583	PREDICTED: GTP-binding protein ARD-1-lik	0.709	0.668	0.481	1e-102
15208643		546	E3 ubiquitin-protein ligase TRIM23 isofo	0.698	0.703	0.487	1e-102
390459899		546	PREDICTED: E3 ubiquitin-protein ligase T	0.698	0.703	0.487	1e-102
426384572		581	PREDICTED: E3 ubiquitin-protein ligase T	0.698	0.660	0.487	1e-102

>gi\|193575609\|ref\|XP_001952583.1\| PREDICTED: e3 ubiquitin-protein ligase TRIM23-like [Acyrthosiphon pisum]	Back alignment and taxonomy information

 Score =  448 bits (1153), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 230/412 (55%), Positives = 299/412 (72%), Gaps = 9/412 (2%)

Query: 48  YSVLLGTRTTRILILELALECRVCEDIFLTQGDKVPRLLHCGHTVCLACLLRLPIKDDTI 107
           Y+ L   R   I      LECRVCEDIF  QGDKVPRLL+CGHT+C +CLLRL  +  ++
Sbjct: 8   YNSLSFGRIASIPDKSDVLECRVCEDIFTLQGDKVPRLLYCGHTICHSCLLRLYQRCSSV 67

Query: 108 TCPFDRQPTPVGYSGVWGLKKNFALLELIEKIQTNDEKATESIPLFSAELHIKCDFSLQL 167
            CPFDRQ TP+G SGVWGLKKNFALLEL+E++Q +++         +AE   K +   QL
Sbjct: 68  QCPFDRQTTPIGPSGVWGLKKNFALLELLERLQRSNKSEININSYLNAEAMEKEE---QL 124

Query: 168 HIKCDEDESHIAVLYCTVCASHLCEQCASDSHATRTLQKHRRIPLSEKPREKPFCSSHPT 227
           HI CDE+E+HIAVLYCTVC ++LC  C+  +H+TRTL KHRR+P+SEKP+E+P C  HP+
Sbjct: 125 HIICDENENHIAVLYCTVCCTNLCFYCSEQTHSTRTLAKHRRVPVSEKPQERPRCPLHPS 184

Query: 228 NIAEFICLEEHCQTSAQYPPLMCFICKDYGRHKTHKHALVEIEAENLRSYVKNASSNVQH 287
           ++AEF CL++ C   +  PPLMCF+CKDYG HK HKH LVE EAEN+RS VK+A   +++
Sbjct: 185 HVAEFTCLQDSCHQPS--PPLMCFVCKDYGTHKNHKHTLVETEAENIRSKVKSAGPLMRN 242

Query: 288 LIEEITESVNTVDLVVSKIEG--NTGPSGTE--PGTGDQARAKVHAYFNHLRESLLVQEA 343
           L+EE+ +++  +D V+ ++EG  + G    E  PGT   ARA+V  YF HLRE+L VQEA
Sbjct: 243 LMEEMNDTIQRLDQVMLRLEGLDSNGSVDEESNPGTCSLARARVQLYFQHLRETLQVQEA 302

Query: 344 AATSAVDMFVRERLGCLVQLHDDMGFWLQEVAKLYLKCEQMILQDDARVLTSGREIKEAI 403
           AA SAVD  VRERLG L  L +D+   L +VA + ++CEQ + QDD RV+++  +I +A+
Sbjct: 303 AALSAVDTHVRERLGSLRSLQEDLASSLSQVAVICVQCEQAVRQDDFRVISASADINQAL 362

Query: 404 ETIEKYDTLFNELTPEQIHPDPCIPITFTKDNRVHIGPKMEMRVVTLGLDSA 455
             IEK+  +F EL+PEQ+ PDP IPITFTKDNRVHIGPKME+RVVTLGLD A
Sbjct: 363 NVIEKHKQMFTELSPEQLQPDPSIPITFTKDNRVHIGPKMEIRVVTLGLDGA 414

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|302393777\|sp\|P36407.2\|TRI23_RAT RecName: Full=E3 ubiquitin-protein ligase TRIM23; AltName: Full=ADP-ribosylation factor domain-containing protein 1; AltName: Full=GTP-binding protein ARD-1; AltName: Full=Tripartite motif-containing protein 23	Back alignment and taxonomy information

>gi\|395825390\|ref\|XP_003785918.1\| PREDICTED: E3 ubiquitin-protein ligase TRIM23 [Otolemur garnettii]	Back alignment and taxonomy information

>gi\|417402910\|gb\|JAA48285.1\| Putative e3 ubiquitin-protein ligase trim23 [Desmodus rotundus]	Back alignment and taxonomy information

>gi|4502197|ref|NP_001647.1| E3 ubiquitin-protein ligase TRIM23 isoform alpha [Homo sapiens] gi|386780750|ref|NP_001247520.1| tripartite motif containing 23 [Macaca mulatta] gi|114600014|ref|XP_001163376.1| PREDICTED: E3 ubiquitin-protein ligase TRIM23 isoform 3 [Pan troglodytes] gi|332233700|ref|XP_003266041.1| PREDICTED: E3 ubiquitin-protein ligase TRIM23 [Nomascus leucogenys] gi|397514415|ref|XP_003827483.1| PREDICTED: E3 ubiquitin-protein ligase TRIM23 [Pan paniscus] gi|402871691|ref|XP_003899787.1| PREDICTED: E3 ubiquitin-protein ligase TRIM23 [Papio anubis] gi|543839|sp|P36406.1|TRI23_HUMAN RecName: Full=E3 ubiquitin-protein ligase TRIM23; AltName: Full=ADP-ribosylation factor domain-containing protein 1; AltName: Full=GTP-binding protein ARD-1; AltName: Full=RING finger protein 46; AltName: Full=Tripartite motif-containing protein 23 gi|12275883|gb|AAG50176.1|AF230397_1 tripartite motif protein TRIM23 alpha [Homo sapiens] gi|292070|gb|AAA35940.1| nucleotide binding protein [Homo sapiens] gi|18490296|gb|AAH22510.1| Tripartite motif-containing 23 [Homo sapiens] gi|119571734|gb|EAW51349.1| tripartite motif-containing 23, isoform CRA_a [Homo sapiens] gi|123993941|gb|ABM84572.1| tripartite motif-containing 23 [synthetic construct] gi|123997817|gb|ABM86510.1| tripartite motif-containing 23 [synthetic construct] gi|168277720|dbj|BAG10838.1| tripartite motif-containing protein 23 [synthetic construct] gi|355691350|gb|EHH26535.1| E3 ubiquitin-protein ligase TRIM23 [Macaca mulatta] gi|355749956|gb|EHH54294.1| E3 ubiquitin-protein ligase TRIM23 [Macaca fascicularis] gi|380812558|gb|AFE78153.1| E3 ubiquitin-protein ligase TRIM23 isoform alpha [Macaca mulatta] gi|383418191|gb|AFH32309.1| E3 ubiquitin-protein ligase TRIM23 isoform alpha [Macaca mulatta] gi|410211944|gb|JAA03191.1| tripartite motif containing 23 [Pan troglodytes] gi|410248320|gb|JAA12127.1| tripartite motif containing 23 [Pan troglodytes] gi|410299036|gb|JAA28118.1| tripartite motif containing 23 [Pan troglodytes] gi|410332599|gb|JAA35246.1| tripartite motif containing 23 [Pan troglodytes]

Back alignment and taxonomy information

>gi\|354491683\|ref\|XP_003507984.1\| PREDICTED: E3 ubiquitin-protein ligase TRIM23 [Cricetulus griseus] gi\|344247411\|gb\|EGW03515.1\| GTP-binding protein ARD-1 [Cricetulus griseus]	Back alignment and taxonomy information

>gi\|301767844\|ref\|XP_002919347.1\| PREDICTED: GTP-binding protein ARD-1-like [Ailuropoda melanoleuca]	Back alignment and taxonomy information

>gi\|15208643\|ref\|NP_150231.1\| E3 ubiquitin-protein ligase TRIM23 isoform gamma [Homo sapiens] gi\|395735866\|ref\|XP_003776655.1\| PREDICTED: E3 ubiquitin-protein ligase TRIM23 isoform 2 [Pongo abelii] gi\|12275887\|gb\|AAG50178.1\|AF230399_1 tripartite motif protein TRIM23 gamma [Homo sapiens] gi\|119571736\|gb\|EAW51351.1\| tripartite motif-containing 23, isoform CRA_c [Homo sapiens]	Back alignment and taxonomy information

>gi\|390459899\|ref\|XP_003732382.1\| PREDICTED: E3 ubiquitin-protein ligase TRIM23 [Callithrix jacchus]	Back alignment and taxonomy information

>gi\|426384572\|ref\|XP_004058835.1\| PREDICTED: E3 ubiquitin-protein ligase TRIM23 [Gorilla gorilla gorilla]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		550
ZFIN\|ZDB-GENE-060929-804		576	trim23 "tripartite motif conta	0.683	0.652	0.493	3.2e-121
UNIPROTKB\|P36406		574	TRIM23 "E3 ubiquitin-protein l	0.683	0.655	0.496	2.2e-120
UNIPROTKB\|F1SKT5		576	LOC100513958 "Uncharacterized	0.683	0.652	0.498	9.5e-120
UNIPROTKB\|K7GP98		574	LOC100513958 "Uncharacterized	0.683	0.655	0.498	9.5e-120
MGI\|MGI:1933161		574	Trim23 "tripartite motif-conta	0.683	0.655	0.498	1.2e-119
UNIPROTKB\|F1LSC5		573	Trim23 "E3 ubiquitin-protein l	0.681	0.654	0.491	1.8e-118
UNIPROTKB\|E2RHV3		572	TRIM23 "Uncharacterized protei	0.683	0.657	0.498	2.2e-118
UNIPROTKB\|E1C0E8		580	TRIM23 "Uncharacterized protei	0.683	0.648	0.488	4.7e-118
RGD\|621587		573	Trim23 "tripartite motif-conta	0.681	0.654	0.486	4.2e-117
UNIPROTKB\|P36407		573	Trim23 "E3 ubiquitin-protein l	0.681	0.654	0.486	4.2e-117

ZFIN\|ZDB-GENE-060929-804 trim23 "tripartite motif containing 23" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

 Score = 954 (340.9 bits), Expect = 3.2e-121, Sum P(2) = 3.2e-121
 Identities = 196/397 (49%), Positives = 257/397 (64%)

Query:    68 CRVCEDIFLTQGDKVPRLLHCGHTVCLACLLRLPIKDDTITCPFDRQPTPVGYSGVWGLK 127
             C VCED+F  QGDKVPRLL CGHTVC  CL RLP+    + CPFDRQ T +G SGVWGLK
Sbjct:    33 CGVCEDVFSLQGDKVPRLLLCGHTVCHDCLTRLPLHGRAVRCPFDRQVTELGDSGVWGLK 92

Query:   128 KNFALLELIEKIQTNDEKATESIPLFSAELHIKCDFSLQLHIKCDEDESHIAVLYCTVCA 187
             KNFALLEL+E++Q     AT    +    L    +   +  I+CDEDE+H A +YCTVCA
Sbjct:    93 KNFALLELLERLQNG---ATNQSGMSEDALR---EMG-ECIIRCDEDETHTASMYCTVCA 145

Query:   188 SHLCEQCASDSHATRTLQKHRRIPLSEKPREKPFCSSHPTNIAEFICLEEHCQTSAQYPP 247
             +HLC +C+  +H+TRTL KHRR+PL++KP EK  C  H  +  EF+CLE+ CQ      P
Sbjct:   146 THLCAECSQLTHSTRTLAKHRRVPLADKPHEKMLCPQHQVHAIEFVCLEDGCQPG----P 201

Query:   248 LMCFICKDYGRHKTHKHALVEIEAENLRSYVKNASSNVQHLIEEITESVNTVDLVVSKIE 307
             LMC +CK+YG+H+ HKHA++E EA  +R+ + + +  ++   EE++E    +  +V +IE
Sbjct:   202 LMCCVCKEYGKHQGHKHAVLEAEANQIRASILDMAHCIRTFTEEVSEYSRKLVGIVQQIE 261

Query:   308 G-------NTGPSGTE--PGTGDQARAKVHAYFNHLRESLLVQEAAATSAVDMFVRERLG 358
             G       + G + TE  PGT + AR+ V AYF  L E+L  QE  A S VD  VRERL 
Sbjct:   262 GGEQIVEDSMGIAHTEHVPGTAESARSCVRAYFADLHETLCRQEEMALSVVDAHVRERLI 321

Query:   359 CLVQLHDDMGFWLQEVAKLYLKCEQMILQDDARVLTSGREIKEAIETIEKYDTLFNELTP 418
              L Q  +DM   L +V+   L CE+ + QDD RV+ + +EI   +ET++K    F EL  
Sbjct:   322 WLRQQQEDMTILLSQVSTACLHCEKTLQQDDCRVVLAKQEINRLLETLQKQQQQFTELA- 380

Query:   419 EQIHPDPCIPITFTKDNRVHIGPKMEMRVVTLGLDSA 455
             + I  D  IP+TFTKDNRVHIGPKME+RVVTLGLD A
Sbjct:   381 DHIQLDAGIPVTFTKDNRVHIGPKMEIRVVTLGLDGA 417

GO:0005525 "GTP binding" evidence=IEA

GO:0005622 "intracellular" evidence=IEA

GO:0008270 "zinc ion binding" evidence=IEA

GO:0007264 "small GTPase mediated signal transduction" evidence=IEA

GO:0000166 "nucleotide binding" evidence=IEA

GO:0046872 "metal ion binding" evidence=IEA

UNIPROTKB\|P36406 TRIM23 "E3 ubiquitin-protein ligase TRIM23" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1SKT5 LOC100513958 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|K7GP98 LOC100513958 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

MGI\|MGI:1933161 Trim23 "tripartite motif-containing 23" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|F1LSC5 Trim23 "E3 ubiquitin-protein ligase TRIM23" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RHV3 TRIM23 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|E1C0E8 TRIM23 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

RGD\|621587 Trim23 "tripartite motif-containing 23" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|P36407 Trim23 "E3 ubiquitin-protein ligase TRIM23" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q8BGX0	TRI23_MOUSE	6, ., 3, ., 2, ., -	0.4831	0.6981	0.6689	yes	N/A
P0CM16	ARF_CRYNJ	No assigned EC number	0.5116	0.1545	0.4670	yes	N/A
P61209	ARF1_DROME	No assigned EC number	0.5348	0.1545	0.4670	yes	N/A
Q09654	TRI23_CAEEL	6, ., 3, ., 2, ., -	0.3443	0.6690	0.6827	yes	N/A
P36407	TRI23_RAT	6, ., 3, ., 2, ., -	0.4066	0.8727	0.8376	yes	N/A
P36406	TRI23_HUMAN	6, ., 3, ., 2, ., -	0.4879	0.6981	0.6689	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		550
cd04158		169	cd04158, ARD1, (ADP-ribosylation factor domain pro	5e-38
pfam00025		174	pfam00025, Arf, ADP-ribosylation factor family	2e-29
cd00878		158	cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf	1e-28
cd04150		159	cd04150, Arf1_5_like, ADP-ribosylation factor-1 (A	8e-27
cd04155		174	cd04155, Arl3, Arf-like 3 (Arl3) GTPase	5e-25
cd04153		174	cd04153, Arl5_Arl8, Arf-like 5 (Arl5) and 8 (Arl8)	1e-24
PTZ00133		182	PTZ00133, PTZ00133, ADP-ribosylation factor; Provi	2e-24
cd04149		168	cd04149, Arf6, ADP ribosylation factor 6 (Arf6)	5e-23
cd04156		160	cd04156, ARLTS1, Arf-like tumor suppressor gene 1	5e-23
PLN00223		181	PLN00223, PLN00223, ADP-ribosylation factor; Provi	6e-23
smart00177		175	smart00177, ARF, ARF-like small GTPases; ARF, ADP-	2e-22
cd04151		158	cd04151, Arl1, ADP ribosylation factor 1 (Arf1)	2e-22
cd04154		173	cd04154, Arl2, Arf-like 2 (Arl2) GTPase	4e-19
cd04160		168	cd04160, Arfrp1, Arf-related protein 1 (Arfrp1)	4e-18
cd04157		162	cd04157, Arl6, Arf-like 6 (Arl6) GTPase	8e-15
cd04152		183	cd04152, Arl4_Arl7, Arf-like 4 (Arl4) and 7 (Arl7)	1e-13
cd00879		191	cd00879, Sar1, Sar1 is an essential component of C	2e-10
cd04162		164	cd04162, Arl9_Arfrp2_like, Arf-like 9 (Arl9)/Arfrp	3e-09
smart00178		184	smart00178, SAR, Sar1p-like members of the Ras-fam	5e-09
cd04159		159	cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl	3e-08
cd04161		167	cd04161, Arl2l1_Arl13_like, Arl2-like protein 1 (A	5e-07
smart00184		40	smart00184, RING, Ring finger	5e-05
pfam00643		42	pfam00643, zf-B_box, B-box zinc finger	8e-05
TIGR00599		397	TIGR00599, rad18, DNA repair protein rad18	2e-04
pfam13445		55	pfam13445, zf-RING_LisH, RING-type zinc-finger, Li	4e-04
cd00021		39	cd00021, BBOX, B-Box-type zinc finger; zinc bindin	0.001
cd00162		45	cd00162, RING, RING-finger (Really Interesting New	0.002

>gnl\|CDD\|206723 cd04158, ARD1, (ADP-ribosylation factor domain protein 1 (ARD1)	Back alignment and domain information

 Score =  137 bits (345), Expect = 5e-38
 Identities = 59/95 (62%), Positives = 78/95 (82%)

Query: 456 DSADKERLPEALAELTKLIAEKELKDAALLLLANKQDIPGCETVESITEAFDLYKLCCGR 515
           DS+ ++R+ EA +EL KL+ EKEL+DA LL+ ANKQD+ G  +VE +TE   L+KLCCGR
Sbjct: 75  DSSHRDRVSEAHSELAKLLTEKELRDALLLIFANKQDVAGALSVEEMTELLSLHKLCCGR 134

Query: 516 SWHIQACNAQSGEGLHEGLDWLSRQLIAAGVNDMS 550
           SW+IQ C+A+SG GL+EGLDWLSRQL+AAGV D++
Sbjct: 135 SWYIQGCDARSGMGLYEGLDWLSRQLVAAGVLDVA 169

ARD1 (ADP-ribosylation factor domain protein 1) is an unusual member of the Arf family. In addition to the C-terminal Arf domain, ARD1 has an additional 46-kDa N-terminal domain that contains a RING finger domain, two predicted B-Boxes, and a coiled-coil protein interaction motif. This domain belongs to the TRIM (tripartite motif) or RBCC (RING, B-Box, coiled-coil) family. Like most Arfs, the ARD1 Arf domain lacks detectable GTPase activity. However, unlike most Arfs, the full-length ARD1 protein has significant GTPase activity due to the GAP (GTPase-activating protein) activity exhibited by the 46-kDa N-terminal domain. The GAP domain of ARD1 is specific for its own Arf domain and does not bind other Arfs. The rate of GDP dissociation from the ARD1 Arf domain is slowed by the adjacent 15 amino acids, which act as a GDI (GDP-dissociation inhibitor) domain. ARD1 is ubiquitously expressed in cells and localizes to the Golgi and to the lysosomal membrane. Two Tyr-based motifs in the Arf domain are responsible for Golgi localization, while the GAP domain controls lysosomal localization. Length = 169

>gnl\|CDD\|200938 pfam00025, Arf, ADP-ribosylation factor family	Back alignment and domain information

>gnl\|CDD\|206644 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf-like (Arl) small GTPases	Back alignment and domain information

>gnl\|CDD\|206717 cd04150, Arf1_5_like, ADP-ribosylation factor-1 (Arf1) and ADP-ribosylation factor-5 (Arf5)	Back alignment and domain information

>gnl\|CDD\|206721 cd04155, Arl3, Arf-like 3 (Arl3) GTPase	Back alignment and domain information

>gnl\|CDD\|133353 cd04153, Arl5_Arl8, Arf-like 5 (Arl5) and 8 (Arl8) GTPases	Back alignment and domain information

>gnl\|CDD\|173423 PTZ00133, PTZ00133, ADP-ribosylation factor; Provisional	Back alignment and domain information

>gnl\|CDD\|206716 cd04149, Arf6, ADP ribosylation factor 6 (Arf6)	Back alignment and domain information

>gnl\|CDD\|133356 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 (ARLTS1 or Arl11)	Back alignment and domain information

>gnl\|CDD\|165788 PLN00223, PLN00223, ADP-ribosylation factor; Provisional	Back alignment and domain information

>gnl\|CDD\|128474 smart00177, ARF, ARF-like small GTPases; ARF, ADP-ribosylation factor	Back alignment and domain information

>gnl\|CDD\|206718 cd04151, Arl1, ADP ribosylation factor 1 (Arf1)	Back alignment and domain information

>gnl\|CDD\|206720 cd04154, Arl2, Arf-like 2 (Arl2) GTPase	Back alignment and domain information

>gnl\|CDD\|206725 cd04160, Arfrp1, Arf-related protein 1 (Arfrp1)	Back alignment and domain information

>gnl\|CDD\|206722 cd04157, Arl6, Arf-like 6 (Arl6) GTPase	Back alignment and domain information

>gnl\|CDD\|206719 cd04152, Arl4_Arl7, Arf-like 4 (Arl4) and 7 (Arl7) GTPases	Back alignment and domain information

>gnl\|CDD\|206645 cd00879, Sar1, Sar1 is an essential component of COPII vesicle coats	Back alignment and domain information

>gnl\|CDD\|133362 cd04162, Arl9_Arfrp2_like, Arf-like 9 (Arl9)/Arfrp2-like GTPase	Back alignment and domain information

>gnl\|CDD\|197556 smart00178, SAR, Sar1p-like members of the Ras-family of small GTPases	Back alignment and domain information

>gnl\|CDD\|206724 cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl10) GTPases	Back alignment and domain information

>gnl\|CDD\|133361 cd04161, Arl2l1_Arl13_like, Arl2-like protein 1 (Arl2l1) and Arl13	Back alignment and domain information

>gnl\|CDD\|214546 smart00184, RING, Ring finger	Back alignment and domain information

>gnl\|CDD\|216039 pfam00643, zf-B_box, B-box zinc finger	Back alignment and domain information

>gnl\|CDD\|233043 TIGR00599, rad18, DNA repair protein rad18	Back alignment and domain information

>gnl\|CDD\|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif	Back alignment and domain information

>gnl\|CDD\|237988 cd00021, BBOX, B-Box-type zinc finger; zinc binding domain (CHC3H2); often present in combination with other motifs, like RING zinc finger, NHL motif, coiled-coil or RFP domain in functionally unrelated proteins, most likely mediating protein-protein interaction	Back alignment and domain information

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		550
KOG4367\|consensus		699		99.97
KOG0070\|consensus		181		99.75
KOG0071\|consensus		180		99.74
PF00025		175	Arf: ADP-ribosylation factor family The prints ent	99.64
KOG0073\|consensus		185		99.62
PLN00223		181	ADP-ribosylation factor; Provisional	99.59
KOG0072\|consensus		182		99.55
KOG0075\|consensus		186		99.53
smart00177		175	ARF ARF-like small GTPases; ARF, ADP-ribosylation	99.53
cd04158		169	ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor	99.53
KOG2177\|consensus		386		99.51
cd04149		168	Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor	99.5
PTZ00133		182	ADP-ribosylation factor; Provisional	99.48
cd04150		159	Arf1_5_like Arf1-Arf5-like subfamily. This subfami	99.47
KOG0076\|consensus		197		99.47
cd04161		167	Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (	99.45
KOG0092\|consensus		200		99.42
smart00178		184	SAR Sar1p-like members of the Ras-family of small	99.39
cd04120		202	Rab12 Rab12 subfamily. Rab12 was first identified	99.38
cd04121		189	Rab40 Rab40 subfamily. This subfamily contains Rab	99.38
cd04153		174	Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a	99.36
KOG0074\|consensus		185		99.35
cd04156		160	ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su	99.33
KOG4185\|consensus		296		99.32
cd04157		162	Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub	99.31
cd04154		173	Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are	99.31
cd04103		158	Centaurin_gamma Centaurin gamma. The centaurins (a	99.29
cd00879		190	Sar1 Sar1 subfamily. Sar1 is an essential componen	99.29
PTZ00099		176	rab6; Provisional	99.28
KOG0078\|consensus		207		99.28
cd04152		183	Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i	99.27
KOG0098\|consensus		216		99.26
cd04162		164	Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9	99.26
PF15227		42	zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB:	99.26
KOG0084\|consensus		205		99.25
smart00176		200	RAN Ran (Ras-related nuclear proteins) /TC4 subfam	99.25
cd04151		158	Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t	99.23
cd04141		172	Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p	99.23
cd04107		201	Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38	99.22
cd01875		191	RhoG RhoG subfamily. RhoG is a GTPase with high se	99.21
cd04133		176	Rop_like Rop subfamily. The Rop (Rho-related prote	99.2
cd04122		166	Rab14 Rab14 subfamily. Rab14 GTPases are localized	99.18
KOG0087\|consensus		222		99.18
smart00502		127	BBC B-Box C-terminal domain. Coiled coil region C-	99.18
cd04155		173	Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f	99.17
PTZ00369		189	Ras-like protein; Provisional	99.17
cd04160		167	Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote	99.16
KOG0088\|consensus		218		99.16
cd00877		166	Ran Ran (Ras-related nuclear proteins) /TC4 subfam	99.16
cd04175		164	Rap1 Rap1 subgroup. The Rap1 subgroup is part of t	99.15
PLN03071		219	GTP-binding nuclear protein Ran; Provisional	99.14
cd01873		195	RhoBTB RhoBTB subfamily. Members of the RhoBTB sub	99.13
cd04127		180	Rab27A Rab27a subfamily. The Rab27a subfamily cons	99.13
TIGR00599		397	rad18 DNA repair protein rad18. This family is bas	99.12
KOG0086\|consensus		214		99.12
cd04134		189	Rho3 Rho3 subfamily. Rho3 is a member of the Rho f	99.12
KOG0094\|consensus		221		99.12
cd04126		220	Rab20 Rab20 subfamily. Rab20 is one of several Rab	99.11
KOG0081\|consensus		219		99.11
cd04117		161	Rab15 Rab15 subfamily. Rab15 colocalizes with the	99.11
cd00878		158	Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik	99.1
cd04136		163	Rap_like Rap-like subfamily. The Rap subfamily con	99.1
cd04174		232	Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb	99.09
cd04172		182	Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE	99.09
cd04111		211	Rab39 Rab39 subfamily. Found in eukaryotes, Rab39	99.08
KOG0287\|consensus		442		99.08
KOG0091\|consensus		213		99.08
cd01865		165	Rab3 Rab3 subfamily. The Rab3 subfamily contains R	99.07
cd04138		162	H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras,	99.05
cd04176		163	Rap2 Rap2 subgroup. The Rap2 subgroup is part of t	99.05
cd04143		247	Rhes_like Rhes_like subfamily. This subfamily incl	99.05
cd04144		190	Ras2 Ras2 subfamily. The Ras2 subfamily, found exc	99.05
cd04110		199	Rab35 Rab35 subfamily. Rab35 is one of several Rab	99.05
cd04145		164	M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf	99.05
cd04109		215	Rab28 Rab28 subfamily. First identified in maize,	99.05
smart00173		164	RAS Ras subfamily of RAS small GTPases. Similar in	99.04
cd04131		178	Rnd Rnd subfamily. The Rnd subfamily contains Rnd1	99.04
KOG0394\|consensus		210		99.03
cd01867		167	Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp	99.03
cd04119		168	RJL RJL (RabJ-Like) subfamily. RJLs are found in m	99.03
cd04112		191	Rab26 Rab26 subfamily. First identified in rat pan	99.03
KOG0079\|consensus		198		99.02
cd04159		159	Arl10_like Arl10-like subfamily. Arl9/Arl10 was id	99.02
cd01871		174	Rac1_like Rac1-like subfamily. The Rac1-like subfa	99.02
cd01874		175	Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas	99.02
cd04128		182	Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi	99.01
smart00504		63	Ubox Modified RING finger domain. Modified RING fi	99.01
KOG0077\|consensus		193		99.01
cd04140		165	ARHI_like ARHI subfamily. ARHI (A Ras homolog memb	99.0
cd01869		166	Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev	99.0
KOG0083\|consensus		192		98.99
cd04116		170	Rab9 Rab9 subfamily. Rab9 is found in late endosom	98.99
PF14835		65	zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM	98.99
PLN03108		210	Rab family protein; Provisional	98.98
cd01864		165	Rab19 Rab19 subfamily. Rab19 proteins are associat	98.96
cd04108		170	Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr	98.96
KOG0080\|consensus		209		98.95
cd01868		165	Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a	98.95
cd01866		168	Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg	98.95
cd04125		188	RabA_like RabA-like subfamily. RabA was first iden	98.94
cd01860		163	Rab5_related Rab5-related subfamily. This subfamil	98.94
cd04113		161	Rab4 Rab4 subfamily. Rab4 has been implicated in n	98.94
cd04142		198	RRP22 RRP22 subfamily. RRP22 (Ras-related protein	98.93
cd04106		162	Rab23_lke Rab23-like subfamily. Rab23 is a member	98.93
cd01863		161	Rab18 Rab18 subfamily. Mammalian Rab18 is implicat	98.93
cd04132		187	Rho4_like Rho4-like subfamily. Rho4 is a GTPase th	98.93
cd04139		164	RalA_RalB RalA/RalB subfamily. The Ral (Ras-like)	98.91
cd04115		170	Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u	98.91
PF13445		43	zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A.	98.91
PLN03110		216	Rab GTPase; Provisional	98.91
KOG0093\|consensus		193		98.91
cd04148		221	RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki	98.9
KOG0097\|consensus		215		98.9
cd04177		168	RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the	98.9
smart00174		174	RHO Rho (Ras homology) subfamily of Ras-like small	98.89
smart00175		164	RAB Rab subfamily of small GTPases. Rab GTPases ar	98.89
cd04146		165	RERG_RasL11_like RERG/RasL11-like subfamily. RERG	98.89
cd04118		193	Rab24 Rab24 subfamily. Rab24 is distinct from othe	98.89
cd04123		162	Rab21 Rab21 subfamily. The localization and functi	98.89
cd04137		180	RheB Rheb (Ras Homolog Enriched in Brain) subfamil	98.87
cd01862		172	Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th	98.86
PF00071		162	Ras: Ras family; InterPro: IPR001806 Small GTPases	98.86
PLN03208		193	E3 ubiquitin-protein ligase RMA2; Provisional	98.86
cd04147		198	Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v	98.86
cd04173		222	Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb	98.85
cd04101		164	RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove	98.84
cd01861		161	Rab6 Rab6 subfamily. Rab6 is involved in microtubu	98.83
cd01897		168	NOG NOG1 is a nucleolar GTP-binding protein presen	98.83
PLN03118		211	Rab family protein; Provisional	98.82
cd04124		161	RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily	98.81
PF04564		73	U-box: U-box domain; InterPro: IPR003613 Quality c	98.81
cd04129		187	Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that	98.8
PF13923		39	zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger);	98.8
PF00097		41	zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I	98.79
PF13639		44	zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C	98.77
COG5432		391	RAD18 RING-finger-containing E3 ubiquitin ligase [	98.75
cd00154		159	Rab Rab family. Rab GTPases form the largest famil	98.75
PF14634		44	zf-RING_5: zinc-RING finger domain	98.75
cd00876		160	Ras Ras family. The Ras family of the Ras superfam	98.73
KOG0320\|consensus		187		98.71
cd01870		175	RhoA_like RhoA-like subfamily. The RhoA subfamily	98.71
PF13920		50	zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger);	98.7
cd04130		173	Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive	98.7
cd01892		169	Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr	98.7
cd04135		174	Tc10 TC10 subfamily. TC10 is a Rho family protein	98.69
cd04114		169	Rab30 Rab30 subfamily. Rab30 appears to be associa	98.68
KOG0395\|consensus		196		98.67
PTZ00132		215	GTP-binding nuclear protein Ran; Provisional	98.65
PRK12299		335	obgE GTPase CgtA; Reviewed	98.62
cd01893		166	Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr	98.58
KOG0823\|consensus		230		98.56
KOG0317\|consensus		293		98.52
cd00157		171	Rho Rho (Ras homology) family. Members of the Rho	98.51
cd01898		170	Obg Obg subfamily. The Obg nucleotide binding prot	98.51
KOG0804\|consensus		493		98.51
TIGR02729		329	Obg_CgtA Obg family GTPase CgtA. This model descri	98.49
PF12126		324	DUF3583: Protein of unknown function (DUF3583); In	98.47
PHA02929		238	N1R/p28-like protein; Provisional	98.47
cd01890		179	LepA LepA subfamily. LepA belongs to the GTPase fa	98.41
cd00162		45	RING RING-finger (Really Interesting New Gene) dom	98.4
TIGR00570		309	cdk7 CDK-activating kinase assembly factor MAT1. A	98.38
PRK04213		201	GTP-binding protein; Provisional	98.36
PHA02926		242	zinc finger-like protein; Provisional	98.32
smart00184		39	RING Ring finger. E3 ubiquitin-protein ligase acti	98.3
cd01878		204	HflX HflX subfamily. A distinct conserved domain w	98.29
PRK12297		424	obgE GTPase CgtA; Reviewed	98.28
PRK12296		500	obgE GTPase CgtA; Reviewed	98.26
TIGR02528		142	EutP ethanolamine utilization protein, EutP. This	98.22
TIGR00157		245	ribosome small subunit-dependent GTPase A. The Aqu	98.2
cd00882		157	Ras_like_GTPase Ras-like GTPase superfamily. The R	98.18
cd01881		176	Obg_like The Obg-like subfamily consists of five w	98.17
TIGR00231		161	small_GTP small GTP-binding protein domain. This m	98.11
COG2229		187	Predicted GTPase [General function prediction only	98.08
KOG2164\|consensus		513		98.07
KOG0090\|consensus		238		98.07
PRK05291		449	trmE tRNA modification GTPase TrmE; Reviewed	98.07
COG5574		271	PEX10 RING-finger-containing E3 ubiquitin ligase [	98.05
cd01887		168	IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo	98.05
KOG0095\|consensus		213		98.04
TIGR03156		351	GTP_HflX GTP-binding protein HflX. This protein fa	98.04
PRK15467		158	ethanolamine utilization protein EutP; Provisional	98.04
PF00643		42	zf-B_box: B-box zinc finger; InterPro: IPR000315 Z	97.99
PRK15494		339	era GTPase Era; Provisional	97.99
PRK12298		390	obgE GTPase CgtA; Reviewed	97.96
cd00021		39	BBOX B-Box-type zinc finger; zinc binding domain (	97.95
KOG0393\|consensus		198		97.93
KOG0096\|consensus		216		97.93
cd04171		164	SelB SelB subfamily. SelB is an elongation factor	97.91
cd01888		203	eIF2_gamma eIF2-gamma (gamma subunit of initiation	97.91
KOG3883\|consensus		198		97.9
cd01879		158	FeoB Ferrous iron transport protein B (FeoB) subfa	97.89
KOG2660\|consensus		331		97.88
PRK11058		426	GTPase HflX; Provisional	97.86
cd00881		189	GTP_translation_factor GTP translation factor fami	97.84
TIGR01393		595	lepA GTP-binding protein LepA. LepA (GUF1 in Sacca	97.83
cd04105		203	SR_beta Signal recognition particle receptor, beta	97.83
PF12678		73	zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766	97.83
KOG4628\|consensus		348		97.83
cd01894		157	EngA1 EngA1 subfamily. This CD represents the firs	97.83
KOG0978\|consensus		698		97.81
KOG4159\|consensus		398		97.79
TIGR03594		429	GTPase_EngA ribosome-associated GTPase EngA. EngA	97.79
KOG4252\|consensus		246		97.79
cd01891		194	TypA_BipA TypA (tyrosine phosphorylated protein A)	97.78
PRK03003		472	GTP-binding protein Der; Reviewed	97.77
cd01889		192	SelB_euk SelB subfamily. SelB is an elongation fac	97.77
PRK03003		472	GTP-binding protein Der; Reviewed	97.76
KOG0311\|consensus		381		97.75
cd01895		174	EngA2 EngA2 subfamily. This CD represents the seco	97.71
COG5540		374	RING-finger-containing ubiquitin ligase [Posttrans	97.7
TIGR00436		270	era GTP-binding protein Era. Era is an essential G	97.68
COG1100		219	GTPase SAR1 and related small G proteins [General	97.65
PF12861		85	zf-Apc11: Anaphase-promoting complex subunit 11 RI	97.65
cd00880		163	Era_like Era (E. coli Ras-like protein)-like. This	97.64
cd04164		157	trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein	97.64
KOG1489\|consensus		366		97.62
PRK05433		600	GTP-binding protein LepA; Provisional	97.61
KOG2879\|consensus		298		97.61
smart00336		42	BBOX B-Box-type zinc finger.	97.6
TIGR00487		587	IF-2 translation initiation factor IF-2. This mode	97.58
cd01883		219	EF1_alpha Eukaryotic elongation factor 1 (EF1) alp	97.57
COG5243		491	HRD1 HRD ubiquitin ligase complex, ER membrane com	97.56
COG0532		509	InfB Translation initiation factor 2 (IF-2; GTPase	97.56
cd01855		190	YqeH YqeH. YqeH is an essential GTP-binding protei	97.56
CHL00189		742	infB translation initiation factor 2; Provisional	97.52
cd04102		202	RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove	97.51
PRK12289		352	GTPase RsgA; Reviewed	97.5
COG5152		259	Uncharacterized conserved protein, contains RING a	97.47
TIGR00437		591	feoB ferrous iron transporter FeoB. FeoB (773 amin	97.46
TIGR00073		207	hypB hydrogenase accessory protein HypB. HypB is i	97.45
PRK05306		787	infB translation initiation factor IF-2; Validated	97.45
PRK00454		196	engB GTP-binding protein YsxC; Reviewed	97.43
COG5222		427	Uncharacterized conserved protein, contains RING Z	97.43
PRK12288		347	GTPase RsgA; Reviewed	97.43
PF11789		57	zf-Nse: Zinc-finger of the MIZ type in Nse subunit	97.41
cd04163		168	Era Era subfamily. Era (E. coli Ras-like protein)	97.4
COG0536		369	Obg Predicted GTPase [General function prediction	97.39
cd01854		287	YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil	97.34
KOG1813\|consensus		313		97.33
KOG1814\|consensus		445		97.32
PRK00089		292	era GTPase Era; Reviewed	97.3
KOG4423\|consensus		229		97.29
PRK00098		298	GTPase RsgA; Reviewed	97.28
PRK09518		712	bifunctional cytidylate kinase/GTPase Der; Reviewe	97.28
PF00009		188	GTP_EFTU: Elongation factor Tu GTP binding domain;	97.26
PF09439		181	SRPRB: Signal recognition particle receptor beta s	97.26
TIGR00750		300	lao LAO/AO transport system ATPase. Mutations have	97.24
TIGR00450		442	mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE	97.24
PRK00093		435	GTP-binding protein Der; Reviewed	97.23
PF02421		156	FeoB_N: Ferrous iron transport protein B; InterPro	97.22
TIGR00101		199	ureG urease accessory protein UreG. This model rep	97.22
cd01859		156	MJ1464 MJ1464. This family represents archaeal GTP	97.17
TIGR00475		581	selB selenocysteine-specific elongation factor Sel	97.16
cd01858		157	NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei	97.13
PLN00023		334	GTP-binding protein; Provisional	97.12
PRK09518		712	bifunctional cytidylate kinase/GTPase Der; Reviewe	97.09
COG2262		411	HflX GTPases [General function prediction only]	97.09
KOG0824\|consensus		324		97.08
PRK13768		253	GTPase; Provisional	97.07
TIGR03680		406	eif2g_arch translation initiation factor 2 subunit	97.07
TIGR03597		360	GTPase_YqeH ribosome biogenesis GTPase YqeH. This	97.07
TIGR03598		179	GTPase_YsxC ribosome biogenesis GTP-binding protei	97.05
cd01896		233	DRG The developmentally regulated GTP-binding prot	97.03
COG0481		603	LepA Membrane GTPase LepA [Cell envelope biogenesi	97.02
KOG0802\|consensus		543		97.0
KOG3161\|consensus		861		96.98
TIGR00491		590	aIF-2 translation initiation factor aIF-2/yIF-2. T	96.97
cd01876		170	YihA_EngB The YihA (EngB) subfamily. This subfamil	96.97
KOG1673\|consensus		205		96.97
cd00066		317	G-alpha G protein alpha subunit. The alpha subunit	96.93
PRK00093		435	GTP-binding protein Der; Reviewed	96.93
TIGR00483		426	EF-1_alpha translation elongation factor EF-1 alph	96.92
PF10662		143	PduV-EutP: Ethanolamine utilisation - propanediol	96.88
smart00275		342	G_alpha G protein alpha subunit. Subunit of G prot	96.86
KOG1145\|consensus		683		96.86
TIGR03594		429	GTPase_EngA ribosome-associated GTPase EngA. EngA	96.84
KOG0825\|consensus		1134		96.83
KOG0297\|consensus		391		96.82
PRK04000		411	translation initiation factor IF-2 subunit gamma;	96.78
PRK13796		365	GTPase YqeH; Provisional	96.75
KOG1532\|consensus		366		96.71
KOG1785\|consensus		563		96.63
cd01849		155	YlqF_related_GTPase YlqF-related GTPases. These pr	96.61
KOG1734\|consensus		328		96.57
PF14447		55	Prok-RING_4: Prokaryotic RING finger family 4	96.56
PRK14845		1049	translation initiation factor IF-2; Provisional	96.55
KOG1002\|consensus		791		96.55
cd04165		224	GTPBP1_like GTPBP1-like. Mammalian GTP binding pro	96.55
PF11793		70	FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A.	96.53
cd01856		171	YlqF YlqF. Proteins of the YlqF family contain all	96.51
PRK04004		586	translation initiation factor IF-2; Validated	96.39
PRK12317		425	elongation factor 1-alpha; Reviewed	96.39
PF00643		42	zf-B_box: B-box zinc finger; InterPro: IPR000315 Z	96.32
PRK09866		741	hypothetical protein; Provisional	96.31
KOG1039\|consensus		344		96.31
PRK10512		614	selenocysteinyl-tRNA-specific translation factor;	96.29
TIGR01394		594	TypA_BipA GTP-binding protein TypA/BipA. This bact	96.22
TIGR03596		276	GTPase_YlqF ribosome biogenesis GTP-binding protei	96.21
PRK10463		290	hydrogenase nickel incorporation protein HypB; Pro	96.2
smart00744		49	RINGv The RING-variant domain is a C4HC3 zinc-fing	96.19
PF07139		302	DUF1387: Protein of unknown function (DUF1387); In	96.16
PRK10218		607	GTP-binding protein; Provisional	96.13
PRK09563		287	rbgA GTPase YlqF; Reviewed	96.1
COG0378		202	HypB Ni2+-binding GTPase involved in regulation of	96.09
KOG1493\|consensus		84		96.04
cd01857		141	HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t	96.04
COG0486		454	ThdF Predicted GTPase [General function prediction	96.03
COG1159		298	Era GTPase [General function prediction only]	96.02
PRK09435		332	membrane ATPase/protein kinase; Provisional	95.95
KOG1645\|consensus		463		95.9
COG0218		200	Predicted GTPase [General function prediction only	95.89
COG1160		444	Predicted GTPases [General function prediction onl	95.77
COG1084		346	Predicted GTPase [General function prediction only	95.76
PRK01889		356	GTPase RsgA; Reviewed	95.75
PRK09554		772	feoB ferrous iron transport protein B; Reviewed	95.7
KOG2817\|consensus		394		95.67
COG1160		444	Predicted GTPases [General function prediction onl	95.67
KOG0462\|consensus		650		95.63
KOG1490\|consensus		620		95.6
KOG4172\|consensus		62		95.51
PF08477		119	Miro: Miro-like protein; InterPro: IPR013684 Mitoc	95.38
PTZ00327		460	eukaryotic translation initiation factor 2 gamma s	95.32
PF14570		48	zf-RING_4: RING/Ubox like zinc-binding domain; PDB	95.29
cd04166		208	CysN_ATPS CysN_ATPS subfamily. CysN, together with	95.24
KOG4265\|consensus		349		95.21
KOG4275\|consensus		350		95.06
KOG1144\|consensus		1064		94.93
PF03308		266	ArgK: ArgK protein; InterPro: IPR005129 Bacterial	94.87
cd04168		237	TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T	94.86
cd01884		195	EF_Tu EF-Tu subfamily. This subfamily includes ort	94.84
KOG0827\|consensus		465		94.82
cd01899		318	Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg	94.77
COG5194		88	APC11 Component of SCF ubiquitin ligase and anapha	94.67
KOG1812\|consensus		384		94.67
COG1162		301	Predicted GTPases [General function prediction onl	94.67
KOG4739\|consensus		233		94.54
PLN00043		447	elongation factor 1-alpha; Provisional	94.47
KOG1941\|consensus		518		94.44
PF05290		140	Baculo_IE-1: Baculovirus immediate-early protein (	94.43
PRK00741		526	prfC peptide chain release factor 3; Provisional	94.41
KOG0082\|consensus		354		94.4
PF08702		146	Fib_alpha: Fibrinogen alpha/beta chain family; Int	94.34
cd00021		39	BBOX B-Box-type zinc finger; zinc binding domain (	94.31
COG1703		323	ArgK Putative periplasmic protein kinase ArgK and	94.2
KOG1423\|consensus		379		94.15
PF04641		260	Rtf2: Rtf2 RING-finger	94.04
KOG3002\|consensus		299		93.93
PRK12736		394	elongation factor Tu; Reviewed	93.92
KOG0828\|consensus		636		93.87
KOG1428\|consensus		3738		93.8
COG5219		1525	Uncharacterized conserved protein, contains RING Z	93.74
KOG1571\|consensus		355		93.73
smart00336		42	BBOX B-Box-type zinc finger.	93.63
COG0370		653	FeoB Fe2+ transport system protein B [Inorganic io	93.56
KOG3039\|consensus		303		93.17
smart00010		124	small_GTPase Small GTPase of the Ras superfamily;	93.16
KOG3800\|consensus		300		92.94
KOG4692\|consensus		489		92.8
COG5109		396	Uncharacterized conserved protein, contains RING Z	92.75
KOG1001\|consensus		674		92.7
PTZ00141		446	elongation factor 1- alpha; Provisional	92.33
COG5236		493	Uncharacterized conserved protein, contains RING Z	92.24
KOG1707\|consensus		625		92.14
COG4917		148	EutP Ethanolamine utilization protein [Amino acid	92.11
PRK13351		687	elongation factor G; Reviewed	92.08
PF10498		359	IFT57: Intra-flagellar transport protein 57 ; Inte	91.62
PF03029		238	ATP_bind_1: Conserved hypothetical ATP binding pro	91.41
COG1163		365	DRG Predicted GTPase [General function prediction	91.23
TIGR02034		406	CysN sulfate adenylyltransferase, large subunit. H	91.2
PF00503		389	G-alpha: G-protein alpha subunit; InterPro: IPR001	91.07
TIGR00485		394	EF-Tu translation elongation factor TU. This align	90.83
PRK12735		396	elongation factor Tu; Reviewed	90.27
TIGR00503		527	prfC peptide chain release factor 3. This translat	90.24
KOG4362\|consensus		684		90.2
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	89.97
PRK08476		141	F0F1 ATP synthase subunit B'; Validated	89.86
COG5220		314	TFB3 Cdk activating kinase (CAK)/RNA polymerase II	89.83
KOG4367\|consensus		699		89.63
PRK12740		668	elongation factor G; Reviewed	89.61
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	89.58
KOG3970\|consensus		299		89.47
PRK09602		396	translation-associated GTPase; Reviewed	89.46
PF06858		58	NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte	89.43
KOG4185\|consensus		296		89.15
cd04169		267	RF3 RF3 subfamily. Peptide chain release factor 3	88.54
COG5257		415	GCD11 Translation initiation factor 2, gamma subun	88.33
PRK05506		632	bifunctional sulfate adenylyltransferase subunit 1	88.28
PF08112		56	ATP-synt_E_2: ATP synthase epsilon subunit; InterP	88.11
COG5175		480	MOT2 Transcriptional repressor [Transcription]	88.08
PRK05124		474	cysN sulfate adenylyltransferase subunit 1; Provis	87.96
cd01886		270	EF-G Elongation factor G (EF-G) subfamily. Translo	87.92
PLN03126		478	Elongation factor Tu; Provisional	87.66
KOG2932\|consensus		389		87.2
CHL00071		409	tufA elongation factor Tu	86.67
PF10186		302	Atg14: UV radiation resistance protein and autopha	86.66
COG5256		428	TEF1 Translation elongation factor EF-1alpha (GTPa	86.04
PRK11637		428	AmiB activator; Provisional	86.02
cd04104		197	p47_IIGP_like p47 (47-kDa) family. The p47 GTPase	86.01
PF10367		109	Vps39_2: Vacuolar sorting protein 39 domain 2; Int	85.96
PRK06569		155	F0F1 ATP synthase subunit B'; Validated	85.42
PF02891		50	zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041	85.04
CHL00118		156	atpG ATP synthase CF0 B' subunit; Validated	84.99
PRK00049		396	elongation factor Tu; Reviewed	84.79
PF07191		70	zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807	84.69
PF05605		54	zf-Di19: Drought induced 19 protein (Di19), zinc-b	84.68
cd04167		213	Snu114p Snu114p subfamily. Snu114p is one of sever	84.36
PF15290		305	Syntaphilin: Golgi-localised syntaxin-1-binding cl	83.85
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	83.58
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	83.41
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	83.27
KOG3850\|consensus		455		83.23
PRK09173		159	F0F1 ATP synthase subunit B; Validated	83.09
PF07800		162	DUF1644: Protein of unknown function (DUF1644); In	82.88
PRK06231		205	F0F1 ATP synthase subunit B; Validated	82.45
COG1217		603	TypA Predicted membrane GTPase involved in stress	82.4
TIGR01837		118	PHA_granule_1 poly(hydroxyalkanoate) granule-assoc	82.27
PRK14474		250	F0F1 ATP synthase subunit B; Provisional	82.25
PRK12739		691	elongation factor G; Reviewed	82.21
COG2895		431	CysN GTPases - Sulfate adenylate transferase subun	82.13
KOG0085\|consensus		359		81.68
COG3276		447	SelB Selenocysteine-specific translation elongatio	81.5
KOG0826\|consensus		357		81.44
PLN03127		447	Elongation factor Tu; Provisional	81.11
KOG2930\|consensus		114		81.0
KOG1940\|consensus		276		80.95
KOG1815\|consensus		444		80.24

>KOG4367\|consensus	Back alignment and domain information

Probab=99.97  E-value=1.3e-30  Score=250.99  Aligned_cols=291  Identities=23%  Similarity=0.452  Sum_probs=256.8

Q ss_pred             cCCcceeccccccccccCCCCcEEecCCCcchhhhHhhccc---------------------------------------
Q psy15732         62 LELALECRVCEDIFLTQGDKVPRLLHCGHTVCLACLLRLPI---------------------------------------  102 (550)
Q Consensus        62 ~~~~l~C~iC~~~~~~~~~~~P~~l~CgH~fC~~Cl~~~~~---------------------------------------  102 (550)
                      ++++|.|+||..+|.   +  |++|+|+|+.|+.|......                                       
T Consensus         1 meeelkc~vc~~f~~---e--piil~c~h~lc~~ca~~~~~~tp~~~spq~~~aa~s~vs~~~~~~~d~msl~~~ad~g~   75 (699)
T KOG4367|consen    1 MEEELKCPVCGSFYR---E--PIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGY   75 (699)
T ss_pred             CcccccCceehhhcc---C--ceEeecccHHHHHHHHhhcccCCCCCCchhhhhcCCCCCccccccccceeeEeeccCCC
Confidence            468999999999999   9  99999999999999966220                                       


Q ss_pred             -------------------------------------------CCCccCCCCCCCcccCCCCCccCccccHHHHHHHHHH
Q psy15732        103 -------------------------------------------KDDTITCPFDRQPTPVGYSGVWGLKKNFALLELIEKI  139 (550)
Q Consensus       103 -------------------------------------------~~~~~~CP~Cr~~~~~~~~~~~~l~~n~~l~~~~~~~  139 (550)
                                                                 .+..+.||.|.+.+...+.++.++|+|..+.++++.+
T Consensus        76 ~~~~~~a~~~~t~~~~~~~g~~~~p~am~pp~t~l~~~lap~~~~~~i~c~~c~rs~~~dd~~l~~~p~n~~le~vi~ry  155 (699)
T KOG4367|consen   76 GSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRY  155 (699)
T ss_pred             CccCCeeecCCCccccCCCCceeCCCCCCCchhhccccccCCCCCceEEcchhhhheEecccccccCchhhHHHHHHHHH
Confidence                                                       1234579999999999999999999999999999999


Q ss_pred             HhccccccccCCcchhhhhcccccccccccCCCCccccccccccccchhhhhHhhhhhcCCC-cccCCcccccCCCCC--
Q psy15732        140 QTNDEKATESIPLFSAELHIKCDFSLQLHIKCDEDESHIAVLYCTVCASHLCEQCASDSHAT-RTLQKHRRIPLSEKP--  216 (550)
Q Consensus       140 ~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~C~~~~~~~A~~~C~~C~~~lC~~C~~~h~~~-~~~~~H~~~~~~~~~--  216 (550)
                      ++.+            +.+.+|+.       |+.- ...|+.+|..|+.+||+.|...-|.. .++++|.++++.+..  
T Consensus       156 q~s~------------~aa~kcql-------ce~a-~k~a~v~ceqcdv~yc~pc~~~~hp~rgplakh~l~~~~~grvs  215 (699)
T KOG4367|consen  156 QQSK------------AAALKCQL-------CEKA-PKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVS  215 (699)
T ss_pred             hhhh------------HHhhhhhh-------hcCC-hhhhhhhHhhCceEEechHHhccCCCCCchhhcccCCcccCcee
Confidence            7764            22234444       4433 36699999999999999999997776 689999999988753  


Q ss_pred             -----CCCCCCCCCcccccceeecccccCCccccccccccccccccccCCCCcccHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy15732        217 -----REKPFCSSHPTNIAEFICLEEHCQTSAQYPPLMCFICKDYGRHKTHKHALVEIEAENLRSYVKNASSNVQHLIEE  291 (550)
Q Consensus       217 -----~~~~~C~~H~~~~l~~fC~~~~C~~~~~c~~~iC~~C~~~~~H~~H~~~~l~~a~~~~~~~l~~~l~~l~~~~~~  291 (550)
                           +....|..|+.+...+||..  |.      .++|..|...+.|..|.+..+..+..-.+.+|...++.|.++.++
T Consensus       216 ~~~s~r~~~~ct~h~~e~~smyc~~--ck------~pvc~~clee~khs~hevkal~~~~k~hksqls~al~~lsdrak~  287 (699)
T KOG4367|consen  216 RRLSPRKVSTCTDHELENHSMYCVQ--CK------MPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKE  287 (699)
T ss_pred             eccchhhhhhccCCCCCCceEEEEe--cC------ChHHHHHHHhhcccchhhhhHHHHHhhhHHHHHHHHHHHHHHHHH
Confidence                 44568999999999999988  65      999999998889999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHhhcCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy15732        292 ITESVNTVDLVVSKIEGNTGPSGTEPGTGDQARAKVHAYFNHLRESLLVQEAAATSAVDMFVRERLGCLVQLHDDMGFWL  371 (550)
Q Consensus       292 ~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~I~~~f~~l~~~L~~~e~~ll~~l~~~~~~~~~~l~~~~~~l~~~~  371 (550)
                      ..+.+.+++...+.+++          +..+.+.-+....+.|++.|..|++.||..++++.+.+++.+++|+.....++
T Consensus       288 a~e~l~~lr~m~~~iq~----------n~~ef~a~l~~q~d~lid~l~~rk~qll~~v~~e~e~k~kv~r~qi~~ct~kl  357 (699)
T KOG4367|consen  288 AKEFLVQLRNMVQQIQE----------NSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKL  357 (699)
T ss_pred             HHHHHHHHHHHHHHHHh----------cchhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhHHHHHHHHhhheeeee
Confidence            99999999999999999          88899999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhccCch-hHhhc
Q psy15732        372 QEVAKLYLKCEQMILQDDA-RVLTS  395 (550)
Q Consensus       372 ~~l~~~~~~~e~~l~~~~~-~~L~~  395 (550)
                      .+-..++++.-+.++++|. -||+.
T Consensus       358 ~qtt~lme~cle~ike~dps~~lqi  382 (699)
T KOG4367|consen  358 RQTTGLMEYCLEVIKENDPSGFLQI  382 (699)
T ss_pred             eehhhHHHHHHHHhccCCCcceeeh
Confidence            9999999999999999554 55553

>KOG0070\|consensus	Back alignment and domain information

>KOG0071\|consensus	Back alignment and domain information

>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>KOG0073\|consensus	Back alignment and domain information

>PLN00223 ADP-ribosylation factor; Provisional	Back alignment and domain information

>KOG0072\|consensus	Back alignment and domain information

>KOG0075\|consensus	Back alignment and domain information

>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor	Back alignment and domain information

>cd04158 ARD1 ARD1 subfamily	Back alignment and domain information

>KOG2177\|consensus	Back alignment and domain information

>cd04149 Arf6 Arf6 subfamily	Back alignment and domain information

>PTZ00133 ADP-ribosylation factor; Provisional	Back alignment and domain information

>cd04150 Arf1_5_like Arf1-Arf5-like subfamily	Back alignment and domain information

>KOG0076\|consensus	Back alignment and domain information

>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily	Back alignment and domain information

>KOG0092\|consensus	Back alignment and domain information

>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases	Back alignment and domain information

>cd04120 Rab12 Rab12 subfamily	Back alignment and domain information

>cd04121 Rab40 Rab40 subfamily	Back alignment and domain information

>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily	Back alignment and domain information

>KOG0074\|consensus	Back alignment and domain information

>cd04156 ARLTS1 ARLTS1 subfamily	Back alignment and domain information

>KOG4185\|consensus	Back alignment and domain information

>cd04157 Arl6 Arl6 subfamily	Back alignment and domain information

>cd04154 Arl2 Arl2 subfamily	Back alignment and domain information

>cd04103 Centaurin_gamma Centaurin gamma	Back alignment and domain information

>cd00879 Sar1 Sar1 subfamily	Back alignment and domain information

>PTZ00099 rab6; Provisional	Back alignment and domain information

>KOG0078\|consensus	Back alignment and domain information

>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily	Back alignment and domain information

>KOG0098\|consensus	Back alignment and domain information

>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily	Back alignment and domain information

>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A	Back alignment and domain information

>KOG0084\|consensus	Back alignment and domain information

>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases	Back alignment and domain information

>cd04151 Arl1 Arl1 subfamily	Back alignment and domain information

>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily	Back alignment and domain information

>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily	Back alignment and domain information

>cd01875 RhoG RhoG subfamily	Back alignment and domain information

>cd04133 Rop_like Rop subfamily	Back alignment and domain information

>cd04122 Rab14 Rab14 subfamily	Back alignment and domain information

>KOG0087\|consensus	Back alignment and domain information

>smart00502 BBC B-Box C-terminal domain	Back alignment and domain information

>cd04155 Arl3 Arl3 subfamily	Back alignment and domain information

>PTZ00369 Ras-like protein; Provisional	Back alignment and domain information

>cd04160 Arfrp1 Arfrp1 subfamily	Back alignment and domain information

>KOG0088\|consensus	Back alignment and domain information

>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases	Back alignment and domain information

>cd04175 Rap1 Rap1 subgroup	Back alignment and domain information

>PLN03071 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>cd01873 RhoBTB RhoBTB subfamily	Back alignment and domain information

>cd04127 Rab27A Rab27a subfamily	Back alignment and domain information

>TIGR00599 rad18 DNA repair protein rad18	Back alignment and domain information

>KOG0086\|consensus	Back alignment and domain information

>cd04134 Rho3 Rho3 subfamily	Back alignment and domain information

>KOG0094\|consensus	Back alignment and domain information

>cd04126 Rab20 Rab20 subfamily	Back alignment and domain information

>KOG0081\|consensus	Back alignment and domain information

>cd04117 Rab15 Rab15 subfamily	Back alignment and domain information

>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases	Back alignment and domain information

>cd04136 Rap_like Rap-like subfamily	Back alignment and domain information

>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily	Back alignment and domain information

>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily	Back alignment and domain information

>cd04111 Rab39 Rab39 subfamily	Back alignment and domain information

>KOG0287\|consensus	Back alignment and domain information

>KOG0091\|consensus	Back alignment and domain information

>cd01865 Rab3 Rab3 subfamily	Back alignment and domain information

>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily	Back alignment and domain information

>cd04176 Rap2 Rap2 subgroup	Back alignment and domain information

>cd04143 Rhes_like Rhes_like subfamily	Back alignment and domain information

>cd04144 Ras2 Ras2 subfamily	Back alignment and domain information

>cd04110 Rab35 Rab35 subfamily	Back alignment and domain information

>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily	Back alignment and domain information

>cd04109 Rab28 Rab28 subfamily	Back alignment and domain information

>smart00173 RAS Ras subfamily of RAS small GTPases	Back alignment and domain information

>cd04131 Rnd Rnd subfamily	Back alignment and domain information

>KOG0394\|consensus	Back alignment and domain information

>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2	Back alignment and domain information

>cd04119 RJL RJL (RabJ-Like) subfamily	Back alignment and domain information

>cd04112 Rab26 Rab26 subfamily	Back alignment and domain information

>KOG0079\|consensus	Back alignment and domain information

>cd04159 Arl10_like Arl10-like subfamily	Back alignment and domain information

>cd01871 Rac1_like Rac1-like subfamily	Back alignment and domain information

>cd01874 Cdc42 Cdc42 subfamily	Back alignment and domain information

>cd04128 Spg1 Spg1p	Back alignment and domain information

>smart00504 Ubox Modified RING finger domain	Back alignment and domain information

>KOG0077\|consensus	Back alignment and domain information

>cd04140 ARHI_like ARHI subfamily	Back alignment and domain information

>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily	Back alignment and domain information

>KOG0083\|consensus	Back alignment and domain information

>cd04116 Rab9 Rab9 subfamily	Back alignment and domain information

>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B	Back alignment and domain information

>PLN03108 Rab family protein; Provisional	Back alignment and domain information

>cd01864 Rab19 Rab19 subfamily	Back alignment and domain information

>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily	Back alignment and domain information

>KOG0080\|consensus	Back alignment and domain information

>cd01868 Rab11_like Rab11-like	Back alignment and domain information

>cd01866 Rab2 Rab2 subfamily	Back alignment and domain information

>cd04125 RabA_like RabA-like subfamily	Back alignment and domain information

>cd01860 Rab5_related Rab5-related subfamily	Back alignment and domain information

>cd04113 Rab4 Rab4 subfamily	Back alignment and domain information

>cd04142 RRP22 RRP22 subfamily	Back alignment and domain information

>cd04106 Rab23_lke Rab23-like subfamily	Back alignment and domain information

>cd01863 Rab18 Rab18 subfamily	Back alignment and domain information

>cd04132 Rho4_like Rho4-like subfamily	Back alignment and domain information

>cd04139 RalA_RalB RalA/RalB subfamily	Back alignment and domain information

>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily	Back alignment and domain information

>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A	Back alignment and domain information

>PLN03110 Rab GTPase; Provisional	Back alignment and domain information

>KOG0093\|consensus	Back alignment and domain information

>cd04148 RGK RGK subfamily	Back alignment and domain information

>KOG0097\|consensus	Back alignment and domain information

>cd04177 RSR1 RSR1 subgroup	Back alignment and domain information

>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases	Back alignment and domain information

>smart00175 RAB Rab subfamily of small GTPases	Back alignment and domain information

>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily	Back alignment and domain information

>cd04118 Rab24 Rab24 subfamily	Back alignment and domain information

>cd04123 Rab21 Rab21 subfamily	Back alignment and domain information

>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily	Back alignment and domain information

>cd01862 Rab7 Rab7 subfamily	Back alignment and domain information

>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional	Back alignment and domain information

>cd04147 Ras_dva Ras-dva subfamily	Back alignment and domain information

>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily	Back alignment and domain information

>cd04101 RabL4 RabL4 (Rab-like4) subfamily	Back alignment and domain information

>cd01861 Rab6 Rab6 subfamily	Back alignment and domain information

>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans	Back alignment and domain information

>PLN03118 Rab family protein; Provisional	Back alignment and domain information

>cd04124 RabL2 RabL2 subfamily	Back alignment and domain information

>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis	Back alignment and domain information

>cd04129 Rho2 Rho2 subfamily	Back alignment and domain information

>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A	Back alignment and domain information

>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A	Back alignment and domain information

>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]	Back alignment and domain information

>cd00154 Rab Rab family	Back alignment and domain information

>PF14634 zf-RING_5: zinc-RING finger domain	Back alignment and domain information

>cd00876 Ras Ras family	Back alignment and domain information

>KOG0320\|consensus	Back alignment and domain information

>cd01870 RhoA_like RhoA-like subfamily	Back alignment and domain information

>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A	Back alignment and domain information

>cd04130 Wrch_1 Wrch-1 subfamily	Back alignment and domain information

>cd01892 Miro2 Miro2 subfamily	Back alignment and domain information

>cd04135 Tc10 TC10 subfamily	Back alignment and domain information

>cd04114 Rab30 Rab30 subfamily	Back alignment and domain information

>KOG0395\|consensus	Back alignment and domain information

>PTZ00132 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>PRK12299 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd01893 Miro1 Miro1 subfamily	Back alignment and domain information

>KOG0823\|consensus	Back alignment and domain information

>KOG0317\|consensus	Back alignment and domain information

>cd00157 Rho Rho (Ras homology) family	Back alignment and domain information

>cd01898 Obg Obg subfamily	Back alignment and domain information

>KOG0804\|consensus	Back alignment and domain information

>TIGR02729 Obg_CgtA Obg family GTPase CgtA	Back alignment and domain information

>PF12126 DUF3583: Protein of unknown function (DUF3583); InterPro: IPR021978 This domain is found in eukaryotes, and is typically between 302 and 338 amino acids in length	Back alignment and domain information

>PHA02929 N1R/p28-like protein; Provisional	Back alignment and domain information

>cd01890 LepA LepA subfamily	Back alignment and domain information

>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1	Back alignment and domain information

>PRK04213 GTP-binding protein; Provisional	Back alignment and domain information

>PHA02926 zinc finger-like protein; Provisional	Back alignment and domain information

>smart00184 RING Ring finger	Back alignment and domain information

>cd01878 HflX HflX subfamily	Back alignment and domain information

>PRK12297 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>PRK12296 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>TIGR02528 EutP ethanolamine utilization protein, EutP	Back alignment and domain information

>TIGR00157 ribosome small subunit-dependent GTPase A	Back alignment and domain information

>cd00882 Ras_like_GTPase Ras-like GTPase superfamily	Back alignment and domain information

>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1	Back alignment and domain information

>TIGR00231 small_GTP small GTP-binding protein domain	Back alignment and domain information

>COG2229 Predicted GTPase [General function prediction only]	Back alignment and domain information

>KOG2164\|consensus	Back alignment and domain information

>KOG0090\|consensus	Back alignment and domain information

>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed	Back alignment and domain information

>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily	Back alignment and domain information

>KOG0095\|consensus	Back alignment and domain information

>TIGR03156 GTP_HflX GTP-binding protein HflX	Back alignment and domain information

>PRK15467 ethanolamine utilization protein EutP; Provisional	Back alignment and domain information

>PF00643 zf-B_box: B-box zinc finger; InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PRK15494 era GTPase Era; Provisional	Back alignment and domain information

>PRK12298 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd00021 BBOX B-Box-type zinc finger; zinc binding domain (CHC3H2); often present in combination with other motifs, like RING zinc finger, NHL motif, coiled-coil or RFP domain in functionally unrelated proteins, most likely mediating protein-protein interaction	Back alignment and domain information

>KOG0393\|consensus	Back alignment and domain information

>KOG0096\|consensus	Back alignment and domain information

>cd04171 SelB SelB subfamily	Back alignment and domain information

>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2)	Back alignment and domain information

>KOG3883\|consensus	Back alignment and domain information

>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily	Back alignment and domain information

>KOG2660\|consensus	Back alignment and domain information

>PRK11058 GTPase HflX; Provisional	Back alignment and domain information

>cd00881 GTP_translation_factor GTP translation factor family	Back alignment and domain information

>TIGR01393 lepA GTP-binding protein LepA	Back alignment and domain information

>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta)	Back alignment and domain information

>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG4628\|consensus	Back alignment and domain information

>cd01894 EngA1 EngA1 subfamily	Back alignment and domain information

>KOG0978\|consensus	Back alignment and domain information

>KOG4159\|consensus	Back alignment and domain information

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA	Back alignment and domain information

>KOG4252\|consensus	Back alignment and domain information

>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily	Back alignment and domain information

>PRK03003 GTP-binding protein Der; Reviewed	Back alignment and domain information

>cd01889 SelB_euk SelB subfamily	Back alignment and domain information

>PRK03003 GTP-binding protein Der; Reviewed	Back alignment and domain information

>KOG0311\|consensus	Back alignment and domain information

>cd01895 EngA2 EngA2 subfamily	Back alignment and domain information

>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00436 era GTP-binding protein Era	Back alignment and domain information

>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]	Back alignment and domain information

>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger	Back alignment and domain information

>cd00880 Era_like Era (E	Back alignment and domain information

>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes	Back alignment and domain information

>KOG1489\|consensus	Back alignment and domain information

>PRK05433 GTP-binding protein LepA; Provisional	Back alignment and domain information

>KOG2879\|consensus	Back alignment and domain information

>smart00336 BBOX B-Box-type zinc finger	Back alignment and domain information

>TIGR00487 IF-2 translation initiation factor IF-2	Back alignment and domain information

>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily	Back alignment and domain information

>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd01855 YqeH YqeH	Back alignment and domain information

>CHL00189 infB translation initiation factor 2; Provisional	Back alignment and domain information

>cd04102 RabL3 RabL3 (Rab-like3) subfamily	Back alignment and domain information

>PRK12289 GTPase RsgA; Reviewed	Back alignment and domain information

>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]	Back alignment and domain information

>TIGR00437 feoB ferrous iron transporter FeoB	Back alignment and domain information

>TIGR00073 hypB hydrogenase accessory protein HypB	Back alignment and domain information

>PRK05306 infB translation initiation factor IF-2; Validated	Back alignment and domain information

>PRK00454 engB GTP-binding protein YsxC; Reviewed	Back alignment and domain information

>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>PRK12288 GTPase RsgA; Reviewed	Back alignment and domain information

>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C	Back alignment and domain information

>cd04163 Era Era subfamily	Back alignment and domain information

>COG0536 Obg Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd01854 YjeQ_engC YjeQ/EngC	Back alignment and domain information

>KOG1813\|consensus	Back alignment and domain information

>KOG1814\|consensus	Back alignment and domain information

>PRK00089 era GTPase Era; Reviewed	Back alignment and domain information

>KOG4423\|consensus	Back alignment and domain information

>PRK00098 GTPase RsgA; Reviewed	Back alignment and domain information

>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed	Back alignment and domain information

>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site	Back alignment and domain information

>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>TIGR00750 lao LAO/AO transport system ATPase	Back alignment and domain information

>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE	Back alignment and domain information

>PRK00093 GTP-binding protein Der; Reviewed	Back alignment and domain information

>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions	Back alignment and domain information

>TIGR00101 ureG urease accessory protein UreG	Back alignment and domain information

>cd01859 MJ1464 MJ1464	Back alignment and domain information

>TIGR00475 selB selenocysteine-specific elongation factor SelB	Back alignment and domain information

>cd01858 NGP_1 NGP-1	Back alignment and domain information

>PLN00023 GTP-binding protein; Provisional	Back alignment and domain information

>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed	Back alignment and domain information

>COG2262 HflX GTPases [General function prediction only]	Back alignment and domain information

>KOG0824\|consensus	Back alignment and domain information

>PRK13768 GTPase; Provisional	Back alignment and domain information

>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma	Back alignment and domain information

>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH	Back alignment and domain information

>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB	Back alignment and domain information

>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins	Back alignment and domain information

>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>KOG0802\|consensus	Back alignment and domain information

>KOG3161\|consensus	Back alignment and domain information

>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2	Back alignment and domain information

>cd01876 YihA_EngB The YihA (EngB) subfamily	Back alignment and domain information

>KOG1673\|consensus	Back alignment and domain information

>cd00066 G-alpha G protein alpha subunit	Back alignment and domain information

>PRK00093 GTP-binding protein Der; Reviewed	Back alignment and domain information

>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha	Back alignment and domain information

>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways	Back alignment and domain information

>smart00275 G_alpha G protein alpha subunit	Back alignment and domain information

>KOG1145\|consensus	Back alignment and domain information

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA	Back alignment and domain information

>KOG0825\|consensus	Back alignment and domain information

>KOG0297\|consensus	Back alignment and domain information

>PRK04000 translation initiation factor IF-2 subunit gamma; Validated	Back alignment and domain information

>PRK13796 GTPase YqeH; Provisional	Back alignment and domain information

>KOG1532\|consensus	Back alignment and domain information

>KOG1785\|consensus	Back alignment and domain information

>cd01849 YlqF_related_GTPase YlqF-related GTPases	Back alignment and domain information

>KOG1734\|consensus	Back alignment and domain information

>PF14447 Prok-RING_4: Prokaryotic RING finger family 4	Back alignment and domain information

>PRK14845 translation initiation factor IF-2; Provisional	Back alignment and domain information

>KOG1002\|consensus	Back alignment and domain information

>cd04165 GTPBP1_like GTPBP1-like	Back alignment and domain information

>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A	Back alignment and domain information

>cd01856 YlqF YlqF	Back alignment and domain information

>PRK04004 translation initiation factor IF-2; Validated	Back alignment and domain information

>PRK12317 elongation factor 1-alpha; Reviewed	Back alignment and domain information

>PF00643 zf-B_box: B-box zinc finger; InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PRK09866 hypothetical protein; Provisional	Back alignment and domain information

>KOG1039\|consensus	Back alignment and domain information

>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional	Back alignment and domain information

>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA	Back alignment and domain information

>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF	Back alignment and domain information

>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional	Back alignment and domain information

>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins	Back alignment and domain information

>PF07139 DUF1387: Protein of unknown function (DUF1387); InterPro: IPR009816 This family represents a conserved region approximately 300 residues long within a number of hypothetical proteins of unknown function that seem to be restricted to mammals	Back alignment and domain information

>PRK10218 GTP-binding protein; Provisional	Back alignment and domain information

>PRK09563 rbgA GTPase YlqF; Reviewed	Back alignment and domain information

>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription]	Back alignment and domain information

>KOG1493\|consensus	Back alignment and domain information

>cd01857 HSR1_MMR1 HSR1/MMR1	Back alignment and domain information

>COG0486 ThdF Predicted GTPase [General function prediction only]	Back alignment and domain information

>COG1159 Era GTPase [General function prediction only]	Back alignment and domain information

>PRK09435 membrane ATPase/protein kinase; Provisional	Back alignment and domain information

>KOG1645\|consensus	Back alignment and domain information

>COG0218 Predicted GTPase [General function prediction only]	Back alignment and domain information

>COG1160 Predicted GTPases [General function prediction only]	Back alignment and domain information

>COG1084 Predicted GTPase [General function prediction only]	Back alignment and domain information

>PRK01889 GTPase RsgA; Reviewed	Back alignment and domain information

>PRK09554 feoB ferrous iron transport protein B; Reviewed	Back alignment and domain information

>KOG2817\|consensus	Back alignment and domain information

>COG1160 Predicted GTPases [General function prediction only]	Back alignment and domain information

>KOG0462\|consensus	Back alignment and domain information

>KOG1490\|consensus	Back alignment and domain information

>KOG4172\|consensus	Back alignment and domain information

>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases	Back alignment and domain information

>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional	Back alignment and domain information

>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B	Back alignment and domain information

>cd04166 CysN_ATPS CysN_ATPS subfamily	Back alignment and domain information

>KOG4265\|consensus	Back alignment and domain information

>KOG4275\|consensus	Back alignment and domain information

>KOG1144\|consensus	Back alignment and domain information

>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components	Back alignment and domain information

>cd04168 TetM_like Tet(M)-like subfamily	Back alignment and domain information

>cd01884 EF_Tu EF-Tu subfamily	Back alignment and domain information

>KOG0827\|consensus	Back alignment and domain information

>cd01899 Ygr210 Ygr210 subfamily	Back alignment and domain information

>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning]	Back alignment and domain information

>KOG1812\|consensus	Back alignment and domain information

>COG1162 Predicted GTPases [General function prediction only]	Back alignment and domain information

>KOG4739\|consensus	Back alignment and domain information

>PLN00043 elongation factor 1-alpha; Provisional	Back alignment and domain information

>KOG1941\|consensus	Back alignment and domain information

>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0	Back alignment and domain information

>PRK00741 prfC peptide chain release factor 3; Provisional	Back alignment and domain information

>KOG0082\|consensus	Back alignment and domain information

>PF08702 Fib_alpha: Fibrinogen alpha/beta chain family; InterPro: IPR012290 Fibrinogen plays key roles in both blood clotting and platelet aggregation	Back alignment and domain information

>cd00021 BBOX B-Box-type zinc finger; zinc binding domain (CHC3H2); often present in combination with other motifs, like RING zinc finger, NHL motif, coiled-coil or RFP domain in functionally unrelated proteins, most likely mediating protein-protein interaction	Back alignment and domain information

>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]	Back alignment and domain information

>KOG1423\|consensus	Back alignment and domain information

>PF04641 Rtf2: Rtf2 RING-finger	Back alignment and domain information

>KOG3002\|consensus	Back alignment and domain information

>PRK12736 elongation factor Tu; Reviewed	Back alignment and domain information

>KOG0828\|consensus	Back alignment and domain information

>KOG1428\|consensus	Back alignment and domain information

>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG1571\|consensus	Back alignment and domain information

>smart00336 BBOX B-Box-type zinc finger	Back alignment and domain information

>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG3039\|consensus	Back alignment and domain information

>smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily	Back alignment and domain information

>KOG3800\|consensus	Back alignment and domain information

>KOG4692\|consensus	Back alignment and domain information

>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG1001\|consensus	Back alignment and domain information

>PTZ00141 elongation factor 1- alpha; Provisional	Back alignment and domain information

>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG1707\|consensus	Back alignment and domain information

>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism]	Back alignment and domain information

>PRK13351 elongation factor G; Reviewed	Back alignment and domain information

>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms	Back alignment and domain information

>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity	Back alignment and domain information

>COG1163 DRG Predicted GTPase [General function prediction only]	Back alignment and domain information

>TIGR02034 CysN sulfate adenylyltransferase, large subunit	Back alignment and domain information

>PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) []	Back alignment and domain information

>TIGR00485 EF-Tu translation elongation factor TU	Back alignment and domain information

>PRK12735 elongation factor Tu; Reviewed	Back alignment and domain information

>TIGR00503 prfC peptide chain release factor 3	Back alignment and domain information

>KOG4362\|consensus	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>PRK08476 F0F1 ATP synthase subunit B'; Validated	Back alignment and domain information

>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>KOG4367\|consensus	Back alignment and domain information

>PRK12740 elongation factor G; Reviewed	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>KOG3970\|consensus	Back alignment and domain information

>PRK09602 translation-associated GTPase; Reviewed	Back alignment and domain information

>PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1)	Back alignment and domain information

>KOG4185\|consensus	Back alignment and domain information

>cd04169 RF3 RF3 subfamily	Back alignment and domain information

>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional	Back alignment and domain information

>PF08112 ATP-synt_E_2: ATP synthase epsilon subunit; InterPro: IPR012508 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane	Back alignment and domain information

>COG5175 MOT2 Transcriptional repressor [Transcription]	Back alignment and domain information

>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional	Back alignment and domain information

>cd01886 EF-G Elongation factor G (EF-G) subfamily	Back alignment and domain information

>PLN03126 Elongation factor Tu; Provisional	Back alignment and domain information

>KOG2932\|consensus	Back alignment and domain information

>CHL00071 tufA elongation factor Tu	Back alignment and domain information

>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking	Back alignment and domain information

>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>cd04104 p47_IIGP_like p47 (47-kDa) family	Back alignment and domain information

>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1	Back alignment and domain information

>PRK06569 F0F1 ATP synthase subunit B'; Validated	Back alignment and domain information

>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>CHL00118 atpG ATP synthase CF0 B' subunit; Validated	Back alignment and domain information

>PRK00049 elongation factor Tu; Reviewed	Back alignment and domain information

>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length	Back alignment and domain information

>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins	Back alignment and domain information

>cd04167 Snu114p Snu114p subfamily	Back alignment and domain information

>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>KOG3850\|consensus	Back alignment and domain information

>PRK09173 F0F1 ATP synthase subunit B; Validated	Back alignment and domain information

>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function	Back alignment and domain information

>PRK06231 F0F1 ATP synthase subunit B; Validated	Back alignment and domain information

>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms]	Back alignment and domain information

>TIGR01837 PHA_granule_1 poly(hydroxyalkanoate) granule-associated protein	Back alignment and domain information

>PRK14474 F0F1 ATP synthase subunit B; Provisional	Back alignment and domain information

>PRK12739 elongation factor G; Reviewed	Back alignment and domain information

>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG0085\|consensus	Back alignment and domain information

>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0826\|consensus	Back alignment and domain information

>PLN03127 Elongation factor Tu; Provisional	Back alignment and domain information

>KOG2930\|consensus	Back alignment and domain information

>KOG1940\|consensus	Back alignment and domain information

>KOG1815\|consensus	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		550
1re0_A		164	Structure Of Arf1-Gdp Bound To Sec7 Domain Complexe		5e-10
1j2j_A		166	Crystal Structure Of Gga1 Gat N-terminal Region In		5e-10
1hur_A		180	Human Adp-Ribosylation Factor 1 Complexed With Gdp,		5e-10
1rrg_A		181	Non-Myristoylated Rat Adp-Ribosylation Factor-1 Com		5e-10
3o47_A		329	Crystal Structure Of Arfgap1-Arf1 Fusion Protein Le		2e-09
1z6x_A		180	Structure Of Human Adp-Ribosylation Factor 4 Length		4e-08
3aq4_A		184	Molecular Insights Into Plant Cell Proliferation Di		5e-08
2b6h_A		192	Structure Of Human Adp-Ribosylation Factor 5 Length		2e-07
3tjz_A		164	Crystal Structure Of Arf1 Bound To The GammaZETA-Co		4e-07
2k5u_A		181	Solution Structure Of Myirstoylated Yeast Arf1 Prot		4e-07
1z6y_A		179	Structure Of Human Adp-Ribosylation Factor-Like 5 L		9e-07
1mr3_F		181	Saccharomyces Cerevisiae Adp-Ribosylation Factor 2		1e-06
3lrp_A		181	Crystal Structure Of Plasmodium Falciparum Adp-Ribo		2e-06
1moz_A		183	Adp-Ribosylation Factor-Like 1 (Arl1) From Saccharo		2e-06
3rd1_A		178	Structure Of An Adp Ribosylation Factor From Entamo		2e-06
1zj6_A		187	Crystal Structure Of Human Arl5 Length = 187		4e-06
2h16_A		183	Structure Of Human Adp-Ribosylation Factor-Like 5 (		4e-06
2ksq_A		181	The Myristoylated Yeast Arf1 In A Gtp And Bicelle B		4e-06
2h17_A		181	Structure Of Human Adp-Ribosylation Factor-Like 5 (		4e-06
1yzg_A		179	Structure Of Human Adp-ribosylation Factor-like 8 L		6e-06
3pcr_B		162	Structure Of Espg-Arf6 Complex Length = 162		1e-05
1ksh_A		186	Complex Of Arl2 And Pde Delta, Crystal Form 2 (Nati		2e-05
2a5g_A		175	Cholera Toxin A1 Subunit Bound To Arf6(Q67l) Length		2e-05
4fme_C		160	Espg-Rab1-Arf6 Complex Length = 160		2e-05
2a5d_A		175	Structural Basis For The Activation Of Cholera Toxi		2e-05
1ksg_A		186	Complex Of Arl2 And Pde Delta, Crystal Form 1 Lengt		2e-05
4gok_B		169	The Crystal Structure Of Arl2gppnhp In Complex With		2e-05
3n5c_A		162	Crystal Structure Of Arf6delta13 Complexed With Gdp		4e-05
3vhx_A		172	The Crystal Structure Of Arf6-Mklp1 (Mitotic Kinesi		5e-05
2w83_A		165	Crystal Structure Of The Arf6 Gtpase In Complex Wit		5e-05
1ksj_A		186	Complex Of Arl2 And Pde Delta, Crystal Form 2 (Seme		5e-05
1e0s_A		174	Small G Protein Arf6-Gdp Length = 174		5e-05
3lvr_E		497	The Crystal Structure Of Asap3 In Complex With Arf6		7e-05
3doe_A		192	Complex Of Arl2 And Bart, Crystal Form 1 Length = 1		1e-04

>pdb|1RE0|A Chain A, Structure Of Arf1-Gdp Bound To Sec7 Domain Complexed With Brefeldin A Length = 164