Psyllid ID: psy15783

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80------
MTILNLNLSKYAMWMMLQQDTPQDFVIATGETHSVREFVEAAFLYIGKTIVWEGTGKDEVGKEKDTGIVRVKVNENYFRPTEVIGT
ccccccccHHHHHHHHHcccccccEEEEccccEEHHHHHHHHHHHcccEEEEEEEcccEEEEEEccccEEEEEccccccccccccc
ccHHcccHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHcccEEEEEccccccccEEccccEEEEEEccccccccEEccc
MTILNLNLSKYAMWMMLqqdtpqdfviatgetHSVREFVEAAFLYIGKTivwegtgkdevgkekdtgivRVKVnenyfrptevigt
MTILNLNLSKYAMWMMLQQDTPQDFVIATGETHSVREFVEAAFLYIGKTivwegtgkdevgkekdtgivrvkvnenyfrptevigt
MTILNLNLSKYAMWMMLQQDTPQDFVIATGETHSVREFVEAAFLYIGKTIVWEGTGKDEVGKEKDTGIVRVKVNENYFRPTEVIGT
**ILNLNLSKYAMWMMLQQDTPQDFVIATGETHSVREFVEAAFLYIGKTIVWEGTGKDEVGKEKDTGIVRVKVNENYFR*******
*T**N**LSKYAMWMMLQQDTPQDFVIATGETHSVREFVEAAFLYIGKTIVWEGTGKDEVGKEKDTGIVRVKVNENYFRPTEVIG*
MTILNLNLSKYAMWMMLQQDTPQDFVIATGETHSVREFVEAAFLYIGKTIVWEGTGKDEVGKEKDTGIVRVKVNENYFRPTEVIGT
*TILNLNLSKYAMWMMLQQDTPQDFVIATGETHSVREFVEAAFLYIGKTIVWEGTGKDEVGKEKDTGIVRVKVNENYFRPTEVIGT
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTILNLNLSKYAMWMMLQQDTPQDFVIATGETHSVREFVEAAFLYIGKTIVWEGTGKDEVGKEKDTGIVRVKVNENYFRPTEVIGT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query86 2.2.26 [Sep-21-2011]
Q9VMW9395 GDP-mannose 4,6 dehydrata yes N/A 0.837 0.182 0.708 3e-25
O60547372 GDP-mannose 4,6 dehydrata yes N/A 0.837 0.193 0.694 3e-24
Q8K0C9372 GDP-mannose 4,6 dehydrata yes N/A 0.837 0.193 0.680 6e-24
Q8K3X3372 GDP-mannose 4,6 dehydrata yes N/A 0.837 0.193 0.666 8e-24
O45583382 GDP-mannose 4,6 dehydrata yes N/A 0.825 0.185 0.666 2e-21
Q18801399 GDP-mannose 4,6 dehydrata no N/A 0.825 0.177 0.611 2e-19
Q1ZXF7356 GDP-mannose 4,6 dehydrata yes N/A 0.837 0.202 0.611 6e-19
O85713351 GDP-mannose 4,6-dehydrata yes N/A 0.837 0.205 0.569 4e-15
P55354351 GDP-mannose 4,6-dehydrata yes N/A 0.837 0.205 0.569 5e-15
A8Y0L5377 GDP-mannose 4,6 dehydrata N/A N/A 0.825 0.188 0.638 1e-13
>sp|Q9VMW9|GMDS_DROME GDP-mannose 4,6 dehydratase OS=Drosophila melanogaster GN=Gmd PE=1 SV=2 Back     alignment and function desciption
 Score =  113 bits (283), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 51/72 (70%), Positives = 60/72 (83%)

Query: 12  AMWMMLQQDTPQDFVIATGETHSVREFVEAAFLYIGKTIVWEGTGKDEVGKEKDTGIVRV 71
           AMWMMLQ+++P D+VIATGETHSVREFVEAAF +I + I W+G G DEVG E  TGIVRV
Sbjct: 281 AMWMMLQRESPSDYVIATGETHSVREFVEAAFKHIDREITWKGKGVDEVGVENGTGIVRV 340

Query: 72  KVNENYFRPTEV 83
           ++N  YFRPTEV
Sbjct: 341 RINPKYFRPTEV 352
Conversion of GDP-D-mannose to GDP-4-keto-6-D-deoxymannose.
Drosophila melanogaster (taxid: 7227)
EC: 4EC: .EC: 2EC: .EC: 1EC: .EC: 4EC: 7
>sp|O60547|GMDS_HUMAN GDP-mannose 4,6 dehydratase OS=Homo sapiens GN=GMDS PE=1 SV=1 Back     alignment and function description
>sp|Q8K0C9|GMDS_MOUSE GDP-mannose 4,6 dehydratase OS=Mus musculus GN=Gmds PE=2 SV=1 Back     alignment and function description
>sp|Q8K3X3|GMDS_CRIGR GDP-mannose 4,6 dehydratase OS=Cricetulus griseus GN=GMDS PE=2 SV=1 Back     alignment and function description
>sp|O45583|GMD2_CAEEL GDP-mannose 4,6 dehydratase 2 OS=Caenorhabditis elegans GN=gmd-2 PE=1 SV=1 Back     alignment and function description
>sp|Q18801|GMD1_CAEEL GDP-mannose 4,6 dehydratase 1 OS=Caenorhabditis elegans GN=bre-1 PE=1 SV=3 Back     alignment and function description
>sp|Q1ZXF7|GMDS_DICDI GDP-mannose 4,6 dehydratase OS=Dictyostelium discoideum GN=gmd PE=1 SV=1 Back     alignment and function description
>sp|O85713|NOEL_RHIFH GDP-mannose 4,6-dehydratase OS=Rhizobium fredii (strain HH103) GN=noeL PE=3 SV=1 Back     alignment and function description
>sp|P55354|NOEL_RHISN GDP-mannose 4,6-dehydratase OS=Rhizobium sp. (strain NGR234) GN=noeL PE=3 SV=1 Back     alignment and function description
>sp|A8Y0L5|GMD1_CAEBR GDP-mannose 4,6 dehydratase 1 OS=Caenorhabditis briggsae GN=bre-1 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query86
91080057 356 PREDICTED: similar to gdp mannose-4,6-de 0.837 0.202 0.763 3e-27
442754155 359 Putative gdp-mannose 46 dehydratase [Ixo 0.837 0.200 0.763 1e-26
328702582 323 PREDICTED: GDP-mannose 4,6 dehydratase-l 0.848 0.226 0.726 2e-26
167523745 418 hypothetical protein [Monosiga brevicoll 0.825 0.169 0.774 5e-26
328702574 361 PREDICTED: GDP-mannose 4,6 dehydratase-l 0.837 0.199 0.736 5e-26
427783303 359 Putative gdp-mannose 46 dehydratase [Rhi 0.837 0.200 0.736 4e-25
195114358 390 GI17012 [Drosophila mojavensis] gi|19391 0.837 0.184 0.736 4e-25
195437412 397 GK24598 [Drosophila willistoni] gi|19416 0.837 0.181 0.722 7e-25
242019803 364 GDP mannose-4,6-dehydratase, putative [P 0.837 0.197 0.722 7e-25
195386496 387 GJ24378 [Drosophila virilis] gi|19414839 0.837 0.186 0.722 2e-24
>gi|91080057|ref|XP_973322.1| PREDICTED: similar to gdp mannose-4,6-dehydratase [Tribolium castaneum] gi|270004634|gb|EFA01082.1| hypothetical protein TcasGA2_TC004005 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  125 bits (314), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 64/72 (88%)

Query: 12  AMWMMLQQDTPQDFVIATGETHSVREFVEAAFLYIGKTIVWEGTGKDEVGKEKDTGIVRV 71
           AMW+MLQQ  P DFVIA+GETHSVREFVEAAF ++GK I+WEG+G DEVGKEKDTG+VRV
Sbjct: 242 AMWLMLQQPEPDDFVIASGETHSVREFVEAAFRHVGKEILWEGSGVDEVGKEKDTGVVRV 301

Query: 72  KVNENYFRPTEV 83
           ++N  YFRPTEV
Sbjct: 302 RINPRYFRPTEV 313

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|442754155|gb|JAA69237.1| Putative gdp-mannose 46 dehydratase [Ixodes ricinus] Back     alignment and taxonomy information
>gi|328702582|ref|XP_001947454.2| PREDICTED: GDP-mannose 4,6 dehydratase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|167523745|ref|XP_001746209.1| hypothetical protein [Monosiga brevicollis MX1] gi|163775480|gb|EDQ89104.1| predicted protein [Monosiga brevicollis MX1] Back     alignment and taxonomy information
>gi|328702574|ref|XP_001949069.2| PREDICTED: GDP-mannose 4,6 dehydratase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|427783303|gb|JAA57103.1| Putative gdp-mannose 46 dehydratase [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|195114358|ref|XP_002001734.1| GI17012 [Drosophila mojavensis] gi|193912309|gb|EDW11176.1| GI17012 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195437412|ref|XP_002066634.1| GK24598 [Drosophila willistoni] gi|194162719|gb|EDW77620.1| GK24598 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|242019803|ref|XP_002430348.1| GDP mannose-4,6-dehydratase, putative [Pediculus humanus corporis] gi|212515472|gb|EEB17610.1| GDP mannose-4,6-dehydratase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|195386496|ref|XP_002051940.1| GJ24378 [Drosophila virilis] gi|194148397|gb|EDW64095.1| GJ24378 [Drosophila virilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query86
FB|FBgn0031661395 Gmd "GDP-mannose 4,6-dehydrata 0.837 0.182 0.708 4.2e-24
UNIPROTKB|F6Z8R0347 GMDS "Uncharacterized protein" 0.837 0.207 0.694 6.8e-24
UNIPROTKB|F1P299358 GMDS "Uncharacterized protein" 0.837 0.201 0.680 3.8e-23
UNIPROTKB|E9PI88342 GMDS "GDP-mannose 4,6 dehydrat 0.837 0.210 0.694 3.8e-23
UNIPROTKB|O60547372 GMDS "GDP-mannose 4,6 dehydrat 0.837 0.193 0.694 3.8e-23
UNIPROTKB|F6W683343 GMDS "Uncharacterized protein" 0.837 0.209 0.694 3.8e-23
UNIPROTKB|F7EWI9372 GMDS "Uncharacterized protein" 0.837 0.193 0.694 3.8e-23
UNIPROTKB|Q6P621383 gmds "GDP-mannose 4,6-dehydrat 0.837 0.187 0.666 3.8e-23
UNIPROTKB|E2RC02300 GMDS "Uncharacterized protein" 0.837 0.24 0.680 4.8e-23
UNIPROTKB|F6W0W9372 GMDS "GDP-mannose 4,6 dehydrat 0.837 0.193 0.680 6.1e-23
FB|FBgn0031661 Gmd "GDP-mannose 4,6-dehydratase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 276 (102.2 bits), Expect = 4.2e-24, P = 4.2e-24
 Identities = 51/72 (70%), Positives = 60/72 (83%)

Query:    12 AMWMMLQQDTPQDFVIATGETHSVREFVEAAFLYIGKTIVWEGTGKDEVGKEKDTGIVRV 71
             AMWMMLQ+++P D+VIATGETHSVREFVEAAF +I + I W+G G DEVG E  TGIVRV
Sbjct:   281 AMWMMLQRESPSDYVIATGETHSVREFVEAAFKHIDREITWKGKGVDEVGVENGTGIVRV 340

Query:    72 KVNENYFRPTEV 83
             ++N  YFRPTEV
Sbjct:   341 RINPKYFRPTEV 352
GO:0008446 "GDP-mannose 4,6-dehydratase activity" evidence=ISS;IDA
GO:0042351 "'de novo' GDP-L-fucose biosynthetic process" evidence=ISS
GO:0005622 "intracellular" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0019673 "GDP-mannose metabolic process" evidence=IEA
GO:0050662 "coenzyme binding" evidence=IEA
GO:0042350 "GDP-L-fucose biosynthetic process" evidence=IDA
GO:0007219 "Notch signaling pathway" evidence=IMP
GO:2000035 "regulation of stem cell division" evidence=IMP
UNIPROTKB|F6Z8R0 GMDS "Uncharacterized protein" [Monodelphis domestica (taxid:13616)] Back     alignment and assigned GO terms
UNIPROTKB|F1P299 GMDS "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E9PI88 GMDS "GDP-mannose 4,6 dehydratase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O60547 GMDS "GDP-mannose 4,6 dehydratase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F6W683 GMDS "Uncharacterized protein" [Equus caballus (taxid:9796)] Back     alignment and assigned GO terms
UNIPROTKB|F7EWI9 GMDS "Uncharacterized protein" [Callithrix jacchus (taxid:9483)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P621 gmds "GDP-mannose 4,6-dehydratase" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|E2RC02 GMDS "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6W0W9 GMDS "GDP-mannose 4,6 dehydratase isoform 1" [Macaca mulatta (taxid:9544)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8K0C9GMDS_MOUSE4, ., 2, ., 1, ., 4, 70.68050.83720.1935yesN/A
Q9VMW9GMDS_DROME4, ., 2, ., 1, ., 4, 70.70830.83720.1822yesN/A
Q8K3X3GMDS_CRIGR4, ., 2, ., 1, ., 4, 70.66660.83720.1935yesN/A
O45583GMD2_CAEEL4, ., 2, ., 1, ., 4, 70.66660.82550.1858yesN/A
O85713NOEL_RHIFH4, ., 2, ., 1, ., 4, 70.56940.83720.2051yesN/A
O60547GMDS_HUMAN4, ., 2, ., 1, ., 4, 70.69440.83720.1935yesN/A
P55354NOEL_RHISN4, ., 2, ., 1, ., 4, 70.56940.83720.2051yesN/A
Q1ZXF7GMDS_DICDI4, ., 2, ., 1, ., 4, 70.61110.83720.2022yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query86
COG1089345 COG1089, Gmd, GDP-D-mannose dehydratase [Cell enve 2e-34
TIGR01472343 TIGR01472, gmd, GDP-mannose 4,6-dehydratase 4e-33
PLN02653340 PLN02653, PLN02653, GDP-mannose 4,6-dehydratase 6e-22
cd05260316 cd05260, GDP_MD_SDR_e, GDP-mannose 4,6 dehydratase 7e-20
>gnl|CDD|224014 COG1089, Gmd, GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information 
 Score =  119 bits (300), Expect = 2e-34
 Identities = 44/72 (61%), Positives = 54/72 (75%)

Query: 12  AMWMMLQQDTPQDFVIATGETHSVREFVEAAFLYIGKTIVWEGTGKDEVGKEKDTGIVRV 71
           AMW+MLQQ+ P D+VIATGETHSVREFVE AF  +G  + WEGTG DE G +  TG + V
Sbjct: 234 AMWLMLQQEEPDDYVIATGETHSVREFVELAFEMVGIDLEWEGTGVDEKGVDAKTGKIIV 293

Query: 72  KVNENYFRPTEV 83
           +++  YFRP EV
Sbjct: 294 EIDPRYFRPAEV 305

Length = 345
>gnl|CDD|233427 TIGR01472, gmd, GDP-mannose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|178259 PLN02653, PLN02653, GDP-mannose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|187570 cd05260, GDP_MD_SDR_e, GDP-mannose 4,6 dehydratase, extended (e) SDRs Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 86
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 99.96
KOG1372|consensus376 99.89
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 98.77
PLN02653340 GDP-mannose 4,6-dehydratase 98.48
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 97.9
PLN02778298 3,5-epimerase/4-reductase 97.86
PLN02166436 dTDP-glucose 4,6-dehydratase 97.71
PLN02206442 UDP-glucuronate decarboxylase 97.68
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 97.67
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 97.65
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 97.6
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 97.57
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 97.53
PRK10675338 UDP-galactose-4-epimerase; Provisional 97.5
PLN02240352 UDP-glucose 4-epimerase 97.49
PLN02260 668 probable rhamnose biosynthetic enzyme 97.47
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 97.46
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 97.46
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 97.45
PLN02686367 cinnamoyl-CoA reductase 97.44
PLN02695370 GDP-D-mannose-3',5'-epimerase 97.43
PLN02572442 UDP-sulfoquinovose synthase 97.26
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 97.24
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 97.22
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 97.21
PLN02427386 UDP-apiose/xylose synthase 97.2
PLN00016378 RNA-binding protein; Provisional 97.18
PRK11908347 NAD-dependent epimerase/dehydratase family protein 97.18
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 97.03
CHL00194317 ycf39 Ycf39; Provisional 96.96
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 96.92
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 96.82
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 96.82
PLN02650351 dihydroflavonol-4-reductase 96.8
PLN02214342 cinnamoyl-CoA reductase 96.7
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 96.69
PLN02996491 fatty acyl-CoA reductase 96.61
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 96.55
PLN00198338 anthocyanidin reductase; Provisional 96.5
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 96.4
PLN02896353 cinnamyl-alcohol dehydrogenase 96.34
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 96.21
KOG1429|consensus350 96.1
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 96.06
TIGR01746367 Thioester-redct thioester reductase domain. It has 95.99
PRK12320 699 hypothetical protein; Provisional 95.93
PRK07201 657 short chain dehydrogenase; Provisional 95.8
PRK06482276 short chain dehydrogenase; Provisional 95.63
KOG0747|consensus331 95.62
PRK05875276 short chain dehydrogenase; Provisional 95.38
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 95.34
PRK05865 854 hypothetical protein; Provisional 94.96
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 94.83
KOG1371|consensus343 94.64
PLN02260668 probable rhamnose biosynthetic enzyme 94.52
PLN02583297 cinnamoyl-CoA reductase 93.67
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 93.28
PRK09135249 pteridine reductase; Provisional 92.27
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 91.11
KOG1502|consensus327 90.78
PRK06914280 short chain dehydrogenase; Provisional 89.18
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 88.91
KOG1431|consensus315 88.32
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 87.27
PRK07074257 short chain dehydrogenase; Provisional 84.32
PF01935 229 DUF87: Domain of unknown function DUF87; InterPro: 83.12
PLN02503605 fatty acyl-CoA reductase 2 82.86
PRK08263275 short chain dehydrogenase; Provisional 81.59
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information 
Probab=99.96  E-value=4.3e-29  Score=189.98  Aligned_cols=83  Identities=55%  Similarity=0.900  Sum_probs=80.7

Q ss_pred             ccccHHH---------HHHHHHHHhcCCCCCcEEEecCceeeHHHHHHHHHHHhCCceEeecCcccccceeccCCcEEEE
Q psy15783          2 TILNLNL---------SKYAMWMMLQQDTPQDFVIATGETHSVREFVEAAFLYIGKTIVWEGTGKDEVGKEKDTGIVRVK   72 (86)
Q Consensus         2 ~~gn~~~---------~v~a~~~ll~~~~pgdYnI~SG~~~SV~d~l~~~~~~~g~~i~w~g~~~~e~~~~~~~~~~~v~   72 (86)
                      .+||||+         .|+|||+|||+++|+|||||||++|||+||++++|+.+|++++|+|+|.+|+|+|..+|+..|+
T Consensus       215 ~lGNldAkRDWG~A~DYVe~mwlmLQq~~PddyViATg~t~sVrefv~~Af~~~g~~l~w~g~g~~e~g~da~~G~~~V~  294 (345)
T COG1089         215 YLGNLDAKRDWGHAKDYVEAMWLMLQQEEPDDYVIATGETHSVREFVELAFEMVGIDLEWEGTGVDEKGVDAKTGKIIVE  294 (345)
T ss_pred             EeccccccccccchHHHHHHHHHHHccCCCCceEEecCceeeHHHHHHHHHHHcCceEEEeeccccccccccccCceeEE
Confidence            5899998         6999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EcCCCcCCCCCC
Q psy15783         73 VNENYFRPTEVI   84 (86)
Q Consensus        73 iDp~~~RP~dv~   84 (86)
                      +||+||||.||+
T Consensus       295 idp~~fRPaEV~  306 (345)
T COG1089         295 IDPRYFRPAEVD  306 (345)
T ss_pred             ECccccCchhhh
Confidence            999999999986

>KOG1372|consensus Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1429|consensus Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0747|consensus Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>KOG1371|consensus Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1431|consensus Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query86
1t2a_A375 Crystal Structure Of Human Gdp-D-Mannose 4,6-Dehydr 3e-25
2z1m_A345 Crystal Structure Of Gdp-D-Mannose Dehydratase From 1e-17
1db3_A372 E.Coli Gdp-Mannose 4,6-Dehydratase Length = 372 2e-12
1n7g_A381 Crystal Structure Of The Gdp-mannose 4,6-dehydratas 8e-10
>pdb|1T2A|A Chain A, Crystal Structure Of Human Gdp-D-Mannose 4,6-Dehydratase Length = 375 Back     alignment and structure 
Iteration: 1

 Score =  110 bits (274), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 60/72 (83%)
Query: 12  AMWMMLQQDTPQDFVIATGETHSVREFVEAAFLYIGKTIVWEGTGKDEVGKEKDTGIVRV 71
           AMW+MLQ D P+DFVIATGE HSVREFVE +FL+IGKTIVWEG  ++EVG+ K+TG V V
Sbjct: 259 AMWLMLQNDEPEDFVIATGEVHSVREFVEKSFLHIGKTIVWEGKNENEVGRCKETGKVHV 318
Query: 72  KVNENYFRPTEV 83
            V+  Y+RPTEV
Sbjct: 319 TVDLKYYRPTEV 330
>pdb|2Z1M|A Chain A, Crystal Structure Of Gdp-D-Mannose Dehydratase From Aquifex Aeolicus Vf5 Length = 345 Back     alignment and structure
>pdb|1DB3|A Chain A, E.Coli Gdp-Mannose 4,6-Dehydratase Length = 372 Back     alignment and structure
>pdb|1N7G|A Chain A, Crystal Structure Of The Gdp-mannose 4,6-dehydratase Ternary Complex With Nadph And Gdp-rhamnose. Length = 381 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query86
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 5e-40
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 6e-40
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 7e-37
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 1e-28
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 3e-28
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 8e-24
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Length = 345 Back     alignment and structure
 Score =  133 bits (337), Expect = 5e-40
 Identities = 41/72 (56%), Positives = 52/72 (72%)

Query: 12  AMWMMLQQDTPQDFVIATGETHSVREFVEAAFLYIGKTIVWEGTGKDEVGKEKDTGIVRV 71
           AMW+M+QQ  P D+VIATGETH+VREFVE A    G  I W G G +E G +++TG V V
Sbjct: 230 AMWLMMQQPEPDDYVIATGETHTVREFVEKAAKIAGFDIEWVGEGINEKGIDRNTGKVIV 289

Query: 72  KVNENYFRPTEV 83
           +V+E +FRP EV
Sbjct: 290 EVSEEFFRPAEV 301
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Length = 375 Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Length = 372 Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Length = 381 Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Length = 335 Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Length = 321 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query86
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 98.19
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 98.04
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 98.01
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 97.98
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 97.8
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 97.79
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 97.78
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 97.77
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 97.75
3ius_A286 Uncharacterized conserved protein; APC63810, silic 97.73
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 97.7
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 97.64
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 97.64
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 97.58
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 97.58
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 97.55
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 97.5
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 97.46
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 97.45
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 97.44
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 97.43
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 97.41
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 97.41
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 97.4
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 97.38
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 97.36
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 97.35
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 97.34
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 97.34
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 97.3
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 97.27
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 97.25
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 97.25
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 97.18
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 97.16
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 97.15
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 97.12
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 97.1
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 97.09
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 97.07
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 97.06
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 97.05
3slg_A372 PBGP3 protein; structural genomics, seattle struct 97.05
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 97.04
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 97.04
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 97.02
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 96.94
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 96.93
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 96.89
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 96.84
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 96.77
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 96.7
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 96.67
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 96.54
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 96.51
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 96.17
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 96.13
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 95.98
4f6c_A427 AUSA reductase domain protein; thioester reductase 95.83
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 95.83
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 95.57
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 95.54
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 95.43
1xq6_A253 Unknown protein; structural genomics, protein stru 95.31
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 95.29
4f6l_B508 AUSA reductase domain protein; thioester reductase 95.29
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 95.24
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 95.15
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 94.88
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 94.61
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 94.29
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 94.09
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 94.04
2wm3_A299 NMRA-like family domain containing protein 1; unkn 93.93
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 93.84
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 93.58
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 93.41
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 92.94
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 92.78
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 92.67
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 88.72
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 88.16
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 87.45
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 85.39
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 84.4
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 83.08
1spx_A278 Short-chain reductase family member (5L265); paral 80.91
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 86
d1db3a_357 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escheric 5e-11
d1t2aa_347 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (H 6e-09
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Length = 357 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: GDP-mannose 4,6-dehydratase
species: Escherichia coli [TaxId: 562]

 Score = 54.4 bits (130), Expect = 5e-11
 Identities = 37/83 (44%), Positives = 47/83 (56%), Gaps = 10/83 (12%)

Query: 11  YAMWMMLQQDTPQDFVIATGETHSVREFVEAAFLYIGKTIVWEGTGKDEVGKEKDT---- 66
              WMMLQQ+ P+DFVIATG  +SVR+FVE A   +G  + +EGTG +E G         
Sbjct: 234 KMQWMMLQQEQPEDFVIATGVQYSVRQFVEMAAAQLGIKLRFEGTGVEEKGIVVSVTGHD 293

Query: 67  ------GIVRVKVNENYFRPTEV 83
                 G V + V+  YFRP EV
Sbjct: 294 APGVKPGDVIIAVDPRYFRPAEV 316
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 347 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query86
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 98.8
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 98.45
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 98.25
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 98.08
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 98.04
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 97.86
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 97.84
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 97.79
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 97.63
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 97.62
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 97.56
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 97.41
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 97.05
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 96.86
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 96.72
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 96.61
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 96.58
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 96.53
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 96.4
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 96.08
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 96.06
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 95.97
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 95.11
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 93.85
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 92.17
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 91.96
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 89.8
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: GDP-mannose 4,6-dehydratase
species: Escherichia coli [TaxId: 562]

Probab=98.80  E-value=9.9e-09  Score=73.49  Aligned_cols=81  Identities=46%  Similarity=0.667  Sum_probs=62.8

Q ss_pred             cHHHHHHHHHHHhcCCCCCcEEEecCceeeHHHHHHHHHHHhCCceEeecCcccccce----------eccCCcEEEEEc
Q psy15783          5 NLNLSKYAMWMMLQQDTPQDFVIATGETHSVREFVEAAFLYIGKTIVWEGTGKDEVGK----------EKDTGIVRVKVN   74 (86)
Q Consensus         5 n~~~~v~a~~~ll~~~~pgdYnI~SG~~~SV~d~l~~~~~~~g~~i~w~g~~~~e~~~----------~~~~~~~~v~iD   74 (86)
                      .+.++++|++++++++.++.||||||+.+|++|+++++.+..|....|......+...          ....+...+.+|
T Consensus       228 ~v~D~~~a~~~~~~~~~~~~yni~sg~~~s~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  307 (357)
T d1db3a_         228 HAKDYVKMQWMMLQQEQPEDFVIATGVQYSVRQFVEMAAAQLGIKLRFEGTGVEEKGIVVSVTGHDAPGVKPGDVIIAVD  307 (357)
T ss_dssp             EHHHHHHHHHHTTSSSSCCCEEECCCCCEEHHHHHHHHHHTTTEEEEEESCGGGCEEEEEEECSSSCTTCCTTCEEEEEC
T ss_pred             eechHHHHHHHHHhCCCCCeEEECCCCceehHHHHHHHHHHhCCccccccccccccchhhhhhcccccccccCceeEeec
Confidence            4788999999999998777799999999999999999999999876654433322222          123456678899


Q ss_pred             CCCcCCCCCCC
Q psy15783         75 ENYFRPTEVIG   85 (86)
Q Consensus        75 p~~~RP~dv~~   85 (86)
                      +.++||.|++.
T Consensus       308 ~~~~r~~~~~~  318 (357)
T d1db3a_         308 PRYFRPAEVET  318 (357)
T ss_dssp             GGGCCCCC-CC
T ss_pred             cccCCCccccc
Confidence            99999998764
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure