Psyllid ID: psy1579

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26
MLMITVFLKVQGFFFEACQIFYTRKDMAHFSRITKKTENSNRVNAVIMGRKTWDSIPEKFRPLPGRYNVVLTRNSDLGSQLTGPNVTTTSSLDQAIDLLRHKKSKGEIENVWVIGGSSIYKLTEPLMNRLSTFPKKKGLILLCTRKSNASFMFSVLSLQESLNSPYCDKVYVTQIHHHFDCDTFFPSLSDKFQLIKDPNIPDDVQKENDLNFQFKVFQKELAPKPHSLNVWNHKNYNFRVTVILTYMCGRYNNNNLPM
cEEEEEEccccEEEcccccccccHHHHHHHHHHcccccccccccEEEEccccccccccccccccccccEEEccccccccccccccEEEEccHHHHHHHHHcccccccccEEEEEEcHHHHHcccccccccccccccccHHHHHHccccccHHHHHHHHHHHccccccccEEEEEEcccccccccccccccccEEEccccccccccccccEEEEEEEEEEccccccccccccccccccEEEEEEEEEEEcccccccccc
ccEEEEEEccccEccccccccccHHHHHHHHHHHHccccccccEEEEEEHHHHHcccHHHcccccEEEEEEccccccccccccccEEEEccHHHHHHHHHccHHHccccEEEEEcHHHHHHHHHHHccccEEEEccccccccccccccHHHHHHHHHHHHHHccccccEEEEEEEccccccccccccccHHcEEccccccccccccccccEEEEEEEEEEEccccHHccccccccccEEEEHccccEEEEcccccccc
MLMITVFLKVQGFFFEACQIFYTRKDMAHFSRItkktensnrVNAVIMGRktwdsipekfrplpgrynvvltrnsdlgsqltgpnvtttsSLDQAIDLLRHkkskgeienvWVIGGSSIYKLTEPLmnrlstfpkkkgLILLCTRKSNASFMFSVLSLqeslnspycdkvyvtqihhhfdcdtffpslsdkfqlikdpnipddvqkendLNFQFKVFqkelapkphslnvwnhknyNFRVTVILTYMCgrynnnnlpm
MLMITVFLKVQGFFFEACQIFYTRKDMAHFsritkktensnrvnavimgrktwdsipekfrplpGRYNVVLTrnsdlgsqltgpnvtttsSLDQAIDLLrhkkskgeienvwvIGGSSIYKLTEPLMNRLSTFPKKKGLILLCTRKSNASFMFSVLSLQESLNSPYCDKVYVTQIHHHFDCDTFFPSLSDKFQLIKDPNIPDDVQKENDLNFQFKVFQKELapkphslnvwnhknYNFRVTVILTYMCGRYNNNNLPM
MLMITVFLKVQGFFFEACQIFYTRKDMAHFSRITKKTENSNRVNAVIMGRKTWDSIPEKFRPLPGRYNVVLTRNSDLGSQLTGPNVTTTSSLDQAIDLLRHKKSKGEIENVWVIGGSSIYKLTEPLMNRLSTFPKKKGLILLCTRKSNASFMFSVLSLQESLNSPYCDKVYVTQIHHHFDCDTFFPSLSDKFQLIKDPNIPDDVQKENDLNFQFKVFQKELAPKPHSLNVWNHKNYNFRVTVILTYMCGRYNNNNLPM
**MITVFLKVQGFFFEACQIFYTRKDMAHFSRITKKTENSNRVNAVIMGRKTWDSIPEKFRPLPGRYNVVLTRNS******************QAIDLLRHKKSKGEIENVWVIGGSSIYKLTEPLMNRLSTFPKKKGLILLCTRKSNASFMFSVLSLQESLNSPYCDKVYVTQIHHHFDCDTFFPSLSDKFQLIKDPNIPDDVQKENDLNFQFKVFQKELAPKPHSLNVWNHKNYNFRVTVILTYMCGRYN******
MLMITVFLKVQGFFFEACQIFYTRKDMAHFSRITKKTENSNRVNAVIMGRKTWDSIPEKFRPLPGRYNVVLTRNSDLGSQLTGPNVTTTSSLDQAIDLLRHKKSKGEIENVWVIGGSSIYKLTEPLMNRLSTFPKKKGLILLCTRKSNASFMFSVLSLQESLNSPYCDKVYVTQIHHHFDCDTFFPSLSDKFQLIKDPNI****QKENDLNFQFKVFQ*******************FRVTVILTYMCGRYNN*****
MLMITVFLKVQGFFFEACQIFYTRKDMAHFSRITKKTENSNRVNAVIMGRKTWDSIPEKFRPLPGRYNVVLTRNSDLGSQLTGPNVTTTSSLDQAIDLLRHKKSKGEIENVWVIGGSSIYKLTEPLMNRLSTFPKKKGLILLCTRKSNASFMFSVLSLQESLNSPYCDKVYVTQIHHHFDCDTFFPSLSDKFQLIKDPNIPDDVQKENDLNFQFKVFQKELAPKPHSLNVWNHKNYNFRVTVILTYMCGRYNNNNLPM
MLMITVFLKVQGFFFEACQIFYTRKDMAHFSRITKKTENSNRVNAVIMGRKTWDSIPEKFRPLPGRYNVVLTRNSDLGSQLTGPNVTTTSSLDQAIDLLRHKKSKGEIENVWVIGGSSIYKLTEPLMNRLSTFPKKKGLILLCTRKSNASFMFSVLSLQESLNSPYCDKVYVTQIHHHFDCDTFFPSLSDKFQLIKDPNIPDDVQKENDLNFQFKVFQKELAPKPHSLN***HKNYNFRVTVILTYMCGRYNN*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLMITVFLKVQGFFFEACQIFYTRKDMAHFSRITKKTENSNRVNAVIMGRKTWDSIPEKFRPLPGRYNVVLTRNSDLGSQLTGPNVTTTSSLDQAIDLLRHKKSKGEIENVWVIGGSSIYKLTEPLMNRLSTFPKKKGLILLCTRKSNASFMFSVLSLQESLNSPYCDKVYVTQIHHHFDCDTFFPSLSDKFQLIKDPNIPDDVQKENDLNFQFKVFQKELAPKPHSLNVWNHKNYNFRVTVILTYMCGRYNNNNLPM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query258 2.2.26 [Sep-21-2011]
P28019186 Dihydrofolate reductase O N/A N/A 0.604 0.838 0.335 2e-31
Q9U8B8185 Dihydrofolate reductase O N/A N/A 0.600 0.837 0.350 6e-30
P17719182 Dihydrofolate reductase O yes N/A 0.581 0.824 0.325 3e-27
P00378189 Dihydrofolate reductase O yes N/A 0.608 0.830 0.32 1e-23
Q05762 519 Bifunctional dihydrofolat yes N/A 0.589 0.292 0.365 3e-23
Q05763 565 Bifunctional dihydrofolat no N/A 0.480 0.219 0.380 1e-22
P09503187 Viral dihydrofolate reduc N/A N/A 0.589 0.812 0.340 2e-22
P00376187 Dihydrofolate reductase O yes N/A 0.600 0.828 0.318 3e-22
P00377186 Dihydrofolate reductase O yes N/A 0.600 0.833 0.323 3e-22
Q920D2187 Dihydrofolate reductase O yes N/A 0.604 0.834 0.311 5e-22
>sp|P28019|DYR_AEDAL Dihydrofolate reductase OS=Aedes albopictus GN=DHFR PE=3 SV=1 Back     alignment and function desciption
 Score =  135 bits (341), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 66/197 (33%), Positives = 111/197 (56%), Gaps = 41/197 (20%)

Query: 24  RKDMAHFSRITKKTENSNRVNAVIMGRKTWDSIPEKFRPLPGRYNVVLTRNSDLGSQLTG 83
           R+++ +FSR+TKK ++S + NA+IMGRKT+  +PE  RPLP R N++LTR  D  +    
Sbjct: 27  RQELKYFSRMTKKIQDSGKRNAIIMGRKTYFGVPESKRPLPERLNIILTR--DPSANAYP 84

Query: 84  PNVTTTSSLDQAIDLLRHKKSKGEIENVWVIGGSSIYKLTEPLMNRLSTFPKKKGLILLC 143
             V   +S+ +A+  L       EIENVW++GG+++YK                      
Sbjct: 85  SEVMVCTSMQEALKKLDEAPLVNEIENVWIVGGNAVYK---------------------- 122

Query: 144 TRKSNASFMFSVLSLQESLNSPYCDKVYVTQIHHHFDCDTFFPSLSDKFQLIK-DPNIPD 202
                           E++ S  C ++Y+T+I   F+CD FFP ++  FQL+K D ++P+
Sbjct: 123 ----------------EAMQSDRCHRIYLTEIKETFECDAFFPEITSDFQLVKNDDDVPE 166

Query: 203 DVQKENDLNFQFKVFQK 219
           D+Q+EN + +Q+++++K
Sbjct: 167 DIQEENGIQYQYRIYEK 183
Key enzyme in folate metabolism. Catalyzes an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis.
Aedes albopictus (taxid: 7160)
EC: 1EC: .EC: 5EC: .EC: 1EC: .EC: 3
>sp|Q9U8B8|DYR_HELVI Dihydrofolate reductase OS=Heliothis virescens GN=DHFR PE=1 SV=1 Back     alignment and function description
>sp|P17719|DYR_DROME Dihydrofolate reductase OS=Drosophila melanogaster GN=Dhfr PE=1 SV=3 Back     alignment and function description
>sp|P00378|DYR_CHICK Dihydrofolate reductase OS=Gallus gallus GN=DHFR PE=1 SV=1 Back     alignment and function description
>sp|Q05762|DRTS1_ARATH Bifunctional dihydrofolate reductase-thymidylate synthase 1 OS=Arabidopsis thaliana GN=THY-1 PE=2 SV=2 Back     alignment and function description
>sp|Q05763|DRTS2_ARATH Bifunctional dihydrofolate reductase-thymidylate synthase 2 OS=Arabidopsis thaliana GN=THY-2 PE=2 SV=2 Back     alignment and function description
>sp|P09503|DYR_SHV21 Viral dihydrofolate reductase OS=Saimiriine herpesvirus 2 (strain 11) GN=DHFR PE=3 SV=1 Back     alignment and function description
>sp|P00376|DYR_BOVIN Dihydrofolate reductase OS=Bos taurus GN=DHFR PE=1 SV=3 Back     alignment and function description
>sp|P00377|DYR_PIG Dihydrofolate reductase OS=Sus scrofa GN=DHFR PE=1 SV=1 Back     alignment and function description
>sp|Q920D2|DYR_RAT Dihydrofolate reductase OS=Rattus norvegicus GN=Dhfr PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query258
400234900185 dihydrofolate reductase [Bombyx mori] 0.600 0.837 0.360 7e-31
383857393180 PREDICTED: dihydrofolate reductase-like 0.596 0.855 0.353 1e-30
260806074185 hypothetical protein BRAFLDRAFT_268308 [ 0.589 0.821 0.361 2e-30
118980186 RecName: Full=Dihydrofolate reductase gi 0.604 0.838 0.335 1e-29
332372822185 unknown [Dendroctonus ponderosae] 0.600 0.837 0.353 5e-29
350426448180 PREDICTED: dihydrofolate reductase-like 0.678 0.972 0.324 8e-29
340723742180 PREDICTED: dihydrofolate reductase-like 0.678 0.972 0.315 2e-28
25090191185 RecName: Full=Dihydrofolate reductase gi 0.600 0.837 0.350 4e-28
307208958166 Dihydrofolate reductase [Harpegnathos sa 0.581 0.903 0.338 4e-28
157115922186 hypothetical protein AaeL_AAEL007370 [Ae 0.604 0.838 0.309 6e-28
>gi|400234900|gb|AFP74113.1| dihydrofolate reductase [Bombyx mori] Back     alignment and taxonomy information
 Score =  140 bits (352), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 106/197 (53%), Gaps = 42/197 (21%)

Query: 24  RKDMAHFSRITKKTENSNRVNAVIMGRKTWDSIPEKFRPLPGRYNVVLTRNSDLGSQLTG 83
           +K+MA+F+ +T    + N+VNAVIMGR+TWD IP K+RPL  R N+VLT N D   +   
Sbjct: 29  KKEMAYFTTMTTSVSDKNKVNAVIMGRRTWDCIPIKYRPLSNRINIVLTHNVDYVKKQVP 88

Query: 84  PNVTTTSSLDQAIDLLRHKKSKGEIENVWVIGGSSIYKLTEPLMNRLSTFPKKKGLILLC 143
             V     LD+AID   H  S+ +IE+ WVIGGSSIYK                      
Sbjct: 89  EGVIVVPGLDEAID---HIDSRSDIESTWVIGGSSIYK---------------------- 123

Query: 144 TRKSNASFMFSVLSLQESLNSPYCDKVYVTQIHHHFDCDTFFPSLS-DKFQLIKDPNIPD 202
                            ++  P C K+Y+T+I   FDCDTFFP ++  +F L+ +  +P 
Sbjct: 124 ----------------AAMEHPNCGKIYLTEIQKSFDCDTFFPDINQQQFHLVNEEEVPG 167

Query: 203 DVQKENDLNFQFKVFQK 219
           + Q E D+N+ ++++++
Sbjct: 168 EKQSEGDINYYYRIYKR 184

Source: Bombyx mori

Species: Bombyx mori

Genus: Bombyx

Family: Bombycidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383857393|ref|XP_003704189.1| PREDICTED: dihydrofolate reductase-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|260806074|ref|XP_002597910.1| hypothetical protein BRAFLDRAFT_268308 [Branchiostoma floridae] gi|229283179|gb|EEN53922.1| hypothetical protein BRAFLDRAFT_268308 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|118980|sp|P28019.1|DYR_AEDAL RecName: Full=Dihydrofolate reductase gi|5556|emb|CAA42748.1| dihydrofolate reductase [Aedes albopictus] Back     alignment and taxonomy information
>gi|332372822|gb|AEE61553.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|350426448|ref|XP_003494440.1| PREDICTED: dihydrofolate reductase-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340723742|ref|XP_003400248.1| PREDICTED: dihydrofolate reductase-like isoform 1 [Bombus terrestris] gi|340723744|ref|XP_003400249.1| PREDICTED: dihydrofolate reductase-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|25090191|sp|Q9U8B8.1|DYR_HELVI RecName: Full=Dihydrofolate reductase gi|6164599|gb|AAF04459.1|AF104106_1 dihydrofolate reductase [Heliothis virescens] Back     alignment and taxonomy information
>gi|307208958|gb|EFN86169.1| Dihydrofolate reductase [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|157115922|ref|XP_001652716.1| hypothetical protein AaeL_AAEL007370 [Aedes aegypti] gi|108876718|gb|EAT40943.1| AAEL007370-PA [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query258
UNIPROTKB|Q9U8B8185 DHFR "Dihydrofolate reductase" 0.383 0.535 0.461 1.5e-33
FB|FBgn0004087182 Dhfr "Dihydrofolate reductase" 0.395 0.560 0.366 9.9e-31
UNIPROTKB|P00378189 DHFR "Dihydrofolate reductase" 0.403 0.550 0.403 4.7e-29
UNIPROTKB|P00377186 DHFR "Dihydrofolate reductase" 0.368 0.510 0.428 1.7e-27
UNIPROTKB|J9P092184 DHFR "Uncharacterized protein" 0.368 0.516 0.428 2.2e-27
UNIPROTKB|P00376187 DHFR "Dihydrofolate reductase" 0.368 0.508 0.418 2.8e-27
UNIPROTKB|P00374187 DHFR "Dihydrofolate reductase" 0.368 0.508 0.418 4.5e-27
RGD|2500187 Dhfr "dihydrofolate reductase" 0.368 0.508 0.418 9.4e-27
UNIPROTKB|P04753187 DHFR "Dihydrofolate reductase" 0.368 0.508 0.418 1.2e-26
UNIPROTKB|F1RF10186 DHFR "Dihydrofolate reductase" 0.344 0.478 0.434 1.5e-26
UNIPROTKB|Q9U8B8 DHFR "Dihydrofolate reductase" [Heliothis virescens (taxid:7102)] Back     alignment and assigned GO terms
 Score = 237 (88.5 bits), Expect = 1.5e-33, Sum P(2) = 1.5e-33
 Identities = 48/104 (46%), Positives = 68/104 (65%)

Query:    24 RKDMAHFSRITKKTENSNRVNAVIMGRKTWDSIPEKFRPLPGRYNVVLTRNSDLGSQLTG 83
             +K+MA+F+ +T K     +VNAVIMGR+TWD IP+K+RPL  R N+VLT N D   +   
Sbjct:    29 KKEMAYFTTMTSKVSEPTKVNAVIMGRRTWDCIPDKYRPLQDRVNIVLTHNVDSVKENVP 88

Query:    84 PNVTTTSSLDQAIDLLRHKKSKGEIENVWVIGGSSIYK--LTEP 125
               V     LD+AI   ++ + + +IE+ WVIGGSSIY+  +T P
Sbjct:    89 EGVMVFPGLDEAI---KYIEGREDIESTWVIGGSSIYRAAMTHP 129
GO:0005575 "cellular_component" evidence=ND
FB|FBgn0004087 Dhfr "Dihydrofolate reductase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P00378 DHFR "Dihydrofolate reductase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P00377 DHFR "Dihydrofolate reductase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J9P092 DHFR "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P00376 DHFR "Dihydrofolate reductase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P00374 DHFR "Dihydrofolate reductase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|2500 Dhfr "dihydrofolate reductase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P04753 DHFR "Dihydrofolate reductase" [Mesocricetus auratus (taxid:10036)] Back     alignment and assigned GO terms
UNIPROTKB|F1RF10 DHFR "Dihydrofolate reductase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P00378DYR_CHICK1, ., 5, ., 1, ., 30.320.60850.8306yesN/A
P00374DYR_HUMAN1, ., 5, ., 1, ., 30.32320.60070.8288yesN/A
P00375DYR_MOUSE1, ., 5, ., 1, ., 30.31150.60460.8342yesN/A
P00376DYR_BOVIN1, ., 5, ., 1, ., 30.31810.60070.8288yesN/A
P00377DYR_PIG1, ., 5, ., 1, ., 30.32320.60070.8333yesN/A
Q920D2DYR_RAT1, ., 5, ., 1, ., 30.31150.60460.8342yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.5.1.3LOW CONFIDENCE prediction!
3rd Layer1.5.10.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query258
cd00209158 cd00209, DHFR, Dihydrofolate reductase (DHFR) 2e-41
pfam00186159 pfam00186, DHFR_1, Dihydrofolate reductase 8e-39
PTZ00164 514 PTZ00164, PTZ00164, bifunctional dihydrofolate red 7e-32
COG0262167 COG0262, FolA, Dihydrofolate reductase [Coenzyme m 3e-24
PRK10769159 PRK10769, folA, dihydrofolate reductase; Provision 3e-15
>gnl|CDD|238127 cd00209, DHFR, Dihydrofolate reductase (DHFR) Back     alignment and domain information 
 Score =  139 bits (352), Expect = 2e-41
 Identities = 56/195 (28%), Positives = 92/195 (47%), Gaps = 62/195 (31%)

Query: 25  KDMAHFSRITKKTENSNRVNAVIMGRKTWDSIPEKFRPLPGRYNVVLTRNSDLGSQLTGP 84
           +D+ HF + T         N VIMGRKT++SIP   RPLPGR N+VL+R  D        
Sbjct: 25  EDLKHFKKTTTG-------NPVIMGRKTFESIPR--RPLPGRTNIVLSRQLDYQD---AE 72

Query: 85  NVTTTSSLDQAIDLLRHKKSKGEIENVWVIGGSSIYKLTEPLMNRLSTFPKKKGLILLCT 144
            V    SL++A++L  +      +E ++VIGG+ IYK                       
Sbjct: 73  GVEVVHSLEEALELAENT-----VEEIFVIGGAEIYKQ---------------------- 105

Query: 145 RKSNASFMFSVLSLQESLNSPYCDKVYVTQIHHHFDCDTFFPSLS-DKFQLIKDPNIPDD 203
                  +            PY D++Y+T+IH  F+ DTFFP +   +++L+      ++
Sbjct: 106 ------AL------------PYADRLYLTRIHAEFEGDTFFPEIDESEWELVS----EEE 143

Query: 204 VQKENDLNFQFKVFQ 218
           V +E+  ++ F+ ++
Sbjct: 144 VFEEDGYSYTFETYE 158

Reduces 7,8-dihydrofolate to 5,6,7,8-tetrahydrofolate with NADPH as a cofactor. This is an essential step in the biosynthesis of deoxythymidine phosphate since 5,6,7,8-tetrahydrofolate is required to regenerate 5,10-methylenetetrahydrofolate which is then utilized by thymidylate synthase. Inhibition of DHFR interrupts thymidilate synthesis and DNA replication, inhibitors of DHFR (such as Methotrexate) are used in cancer chemotherapy. 5,6,7,8-tetrahydrofolate also is involved in glycine, serine, and threonine metabolism and aminoacyl-tRNA biosynthesis. Length = 158
>gnl|CDD|215777 pfam00186, DHFR_1, Dihydrofolate reductase Back     alignment and domain information
>gnl|CDD|240299 PTZ00164, PTZ00164, bifunctional dihydrofolate reductase-thymidylate synthase; Provisional Back     alignment and domain information
>gnl|CDD|223340 COG0262, FolA, Dihydrofolate reductase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|182714 PRK10769, folA, dihydrofolate reductase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 258
KOG1324|consensus190 100.0
PF00186161 DHFR_1: Dihydrofolate reductase; InterPro: IPR0017 100.0
PRK10769159 folA dihydrofolate reductase; Provisional 100.0
PTZ00164 514 bifunctional dihydrofolate reductase-thymidylate s 100.0
COG0262167 FolA Dihydrofolate reductase [Coenzyme metabolism] 100.0
PRK00478 505 scpA segregation and condensation protein A/unknow 100.0
cd00209158 DHFR Dihydrofolate reductase (DHFR). Reduces 7,8-d 99.97
PF01872200 RibD_C: RibD C-terminal domain; InterPro: IPR00273 99.19
TIGR00227216 ribD_Cterm riboflavin-specific deaminase C-termina 98.9
PRK05625217 5-amino-6-(5-phosphoribosylamino)uracil reductase; 98.89
TIGR00326344 eubact_ribD riboflavin biosynthesis protein RibD. 98.71
PRK14059251 hypothetical protein; Provisional 98.1
TIGR01508210 rib_reduct_arch 2,5-diamino-6-hydroxy-4-(5-phospho 97.9
PRK14719360 bifunctional RNAse/5-amino-6-(5-phosphoribosylamin 97.4
PRK10786367 ribD bifunctional diaminohydroxyphosphoribosylamin 97.24
COG1985218 RibD Pyrimidine reductase, riboflavin biosynthesis 96.96
PLN02807380 diaminohydroxyphosphoribosylaminopyrimidine deamin 94.69
>KOG1324|consensus Back     alignment and domain information 
Probab=100.00  E-value=5.3e-50  Score=348.74  Aligned_cols=179  Identities=41%  Similarity=0.657  Sum_probs=156.9

Q ss_pred             eEEEEEeccceeecCCCcccCChhhhhHHHHHHcCCCCCCccceEEEeccccccccCCCCCCCCCcEEEEcCcCCCCCCC
Q psy1579           2 LMITVFLKVQGFFFEACQIFYTRKDMAHFSRITKKTENSNRVNAVIMGRKTWDSIPEKFRPLPGRYNVVLTRNSDLGSQL   81 (258)
Q Consensus         2 ~~I~a~~~~~giG~~g~lPW~l~~Dm~~F~~iT~~~~~~~~~naVIMGRKTweSip~~~rPL~~R~nvVlSr~~~~~~~~   81 (258)
                      -+|+|+.++.|||++|+|||++|.||+||+++|+.+.+|++.||||||||||||||+++|||+||.||||||+..... .
T Consensus         5 ~~Vva~~~~mGIGk~g~LPW~lpsemkyF~~vT~~tsd~~k~NaViMGRKtweSiP~k~RPL~gRiNiVLSR~~~~~~-~   83 (190)
T KOG1324|consen    5 NLVVALSPNMGIGKNGDLPWPLPSEMKYFRRVTTSTSDPSKKNAVIMGRKTWESIPEKFRPLPGRINVVLSRSLKEDF-A   83 (190)
T ss_pred             EEEEEEccccCcccCCCCCCCCHHHHHHHHHHhhccCCcccceeEEecccccccCCcccCCCCCceEEEEecccCcCc-C
Confidence            579999999999999999999999999999999999999999999999999999999999999999999999987522 2


Q ss_pred             CCCcEEEeCCHHHHHHHHHhhccCCCCCcEEEEeChhhhcccccccccccCCcccccchhhhcccCCccchhhhhhhHhh
Q psy1579          82 TGPNVTTTSSLDQAIDLLRHKKSKGEIENVWVIGGSSIYKLTEPLMNRLSTFPKKKGLILLCTRKSNASFMFSVLSLQES  161 (258)
Q Consensus        82 ~~~~v~v~~sl~~ai~~l~~~~~~~~~~~I~ViGGa~iy~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~l~~~~~  161 (258)
                      ..+++++++|+|.|+++|.+..++.+.++||||||+++|.                                      ++
T Consensus        84 ~t~~~~~~~slesAl~lL~~pp~~~~ve~vfvIGG~~vy~--------------------------------------~a  125 (190)
T KOG1324|consen   84 PTENVFLSSSLESALDLLEEPPSSNSVEMVFVIGGSEVYS--------------------------------------EA  125 (190)
T ss_pred             CccCEEEeccHHHHHHhhcCCccccceeEEEEEcCHHHHH--------------------------------------HH
Confidence            3467999999999999999988888899999999999999                                      99


Q ss_pred             hCCCcccEEEEEeecccccccccCCCCC-CCcEEEec--CCC--CCCCcccCCccEEEEEEEE
Q psy1579         162 LNSPYCDKVYVTQIHHHFDCDTFFPSLS-DKFQLIKD--PNI--PDDVQKENDLNFQFKVFQK  219 (258)
Q Consensus       162 l~~p~~D~i~lT~I~~~fe~DtfFP~l~-~~f~li~~--~~i--~~~~~een~~~f~f~~y~r  219 (258)
                      |++|.||+|++|+|+..|+||+|||.++ ..++-+..  |..  ...+|+|+++++.+..|..
T Consensus       126 l~~p~~~~i~~T~I~~~~~cDtffP~id~s~y~~~~~~~pv~~~~~~~~~e~~lk~k~~~~e~  188 (190)
T KOG1324|consen  126 LNSPRCDAIHITEIFQSFECDTFFPAIDTSSYEKWDKLFPVSENGLRVQEETFLKPKSAIFEE  188 (190)
T ss_pred             HcCcCcceEEEEEecccCCcccccccCChHHhchhhhcCcccccccchhhhcCccceeecccc
Confidence            9999999999999999999999999998 33333211  111  1236788888888877654

>PF00186 DHFR_1: Dihydrofolate reductase; InterPro: IPR001796 Dihydrofolate reductase (DHFR) (1 Back     alignment and domain information
>PRK10769 folA dihydrofolate reductase; Provisional Back     alignment and domain information
>PTZ00164 bifunctional dihydrofolate reductase-thymidylate synthase; Provisional Back     alignment and domain information
>COG0262 FolA Dihydrofolate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK00478 scpA segregation and condensation protein A/unknown domain fusion protein; Provisional Back     alignment and domain information
>cd00209 DHFR Dihydrofolate reductase (DHFR) Back     alignment and domain information
>PF01872 RibD_C: RibD C-terminal domain; InterPro: IPR002734 This domain is found in the C terminus of the bifunctional deaminase-reductase of Escherichia coli, Bacillus subtilis and other bacteria in combination with IPR002125 from INTERPRO that catalyses the second and third steps in the biosynthesis of riboflavin, i Back     alignment and domain information
>TIGR00227 ribD_Cterm riboflavin-specific deaminase C-terminal domain Back     alignment and domain information
>PRK05625 5-amino-6-(5-phosphoribosylamino)uracil reductase; Validated Back     alignment and domain information
>TIGR00326 eubact_ribD riboflavin biosynthesis protein RibD Back     alignment and domain information
>PRK14059 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01508 rib_reduct_arch 2,5-diamino-6-hydroxy-4-(5-phosphoribosylamino)pyrimidine 1'-reductase, archaeal Back     alignment and domain information
>PRK14719 bifunctional RNAse/5-amino-6-(5-phosphoribosylamino)uracil reductase; Provisional Back     alignment and domain information
>PRK10786 ribD bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase; Provisional Back     alignment and domain information
>COG1985 RibD Pyrimidine reductase, riboflavin biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PLN02807 diaminohydroxyphosphoribosylaminopyrimidine deaminase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query258
3f91_A187 Structural Data For Human Active Site Mutant Enzyme 8e-25
1dr1_A189 2.2 Angstroms Crystal Structure Of Chicken Liver Di 1e-24
3oaf_A186 Structural And Kinetic Data For Antifolate Interact 1e-24
3ghv_A186 Human Dihydrofolate Reductase Q35kN64F DOUBLE MUTAN 3e-24
3f8z_A187 Human Dihydrofolate Reductase Structural Data With 9e-24
3ghc_A186 Design, Synthesis, And X-Ray Crystal Structure Of C 1e-23
1mvs_A187 Analysis Of Two Polymorphic Forms Of A Pyrido[2,3- 4e-23
3f8y_A187 Correlations Of Human Dihydrofolate Reductase With 5e-23
1dhf_A186 Crystal Structures Of Recombinant Human Dihydrofola 5e-23
1dlr_A186 Methotrexate-Resistant Variants Of Human Dihydrofol 5e-23
1dls_A186 Methotrexate-Resistant Variants Of Human Dihydrofol 5e-23
3l3r_A186 Structural, Computational And Kinetic Data For Anti 5e-23
1u71_A186 Understanding The Role Of Leu22 Variants In Methotr 6e-23
3eig_A186 Crystal Structure Of A Methotrexate-Resistant Mutan 6e-23
1hfq_A186 Comparison Of Ternary Crystal Complexes Of Human Di 7e-23
1boz_A186 Structure-Based Design And Synthesis Of Lipophilic 8e-23
3nxo_A186 Perferential Selection Of Isomer Binding From Chira 9e-23
2fzj_A186 New Insights Into Dhfr Interactions: Analysis Of Pn 1e-22
1u70_A186 Understanding The Role Of Leu22 Variants In Methotr 1e-22
3k45_A186 Alternate Binding Modes Observed For The E- And Z-I 3e-22
1ai9_A192 Candida Albicans Dihydrofolate Reductase Length = 1 9e-18
1cd2_A206 Ligand Induced Conformational Changes In The Crysta 9e-17
1vj3_A205 Structural Studies On Bio-Active Compounds. Crystal 1e-16
3ro9_A225 Candida Glabrata Dihydrofolate Reductase Complexed 2e-16
3cse_A227 Candida Glabrata Dihydrofolate Reductase Complexed 2e-16
3qfx_A241 Trypanosoma Brucei Dihydrofolate Reductase Pyrimeth 2e-15
3rg9_A240 Trypanosoma Brucei Dihydrofolate Reductase (Tbdhfr) 2e-15
2h2q_A 521 Crystal Structure Of Trypanosoma Cruzi Dihydrofolat 3e-15
3inv_A 521 Trypanosoma Cruzi Dihydrofolate Reductase-Thymidyla 7e-15
1df7_A159 Dihydrofolate Reductase Of Mycobacterium Tuberculos 1e-13
3dl5_A 521 Crystal Structure Of The A287f Active Site Mutant O 4e-13
3dl6_A 521 Crystal Structure Of The A287fS290G ACTIVE SITE MUT 4e-13
2oip_A 519 Crystal Structure Of The S290g Active Site Mutant O 4e-13
1qzf_A 521 Crystal Structure Of Dhfr-Ts From Cryptosporidium H 5e-13
3hj3_A 521 Crystal Structure Of The Chts-Dhfr F207a Non-Active 5e-13
2cig_A159 Dihydrofolate Reductase From Mycobacterium Tubercul 5e-13
3jw3_A168 Crystal Structure Of Bacillus Anthracis (F96i) Dihy 6e-12
3um5_A 608 Double Mutant (A16v+s108t) Plasmodium Falciparum Di 1e-11
3fl8_A166 Crystal Structure Of B. Anthracis Dihydrofolate Red 1e-11
1j3i_A280 Wild-Type Plasmodium Falciparum Dihydrofolate Reduc 2e-11
2qk8_A162 Crystal Structure Of The Anthrax Drug Target, Bacil 2e-11
3jvx_A168 Crystal Structure Of Bacillus Anthracis Dihydrofola 2e-11
2kgk_A172 Solution Structure Of Bacillus Anthracis Dihydrofol 2e-11
3s9u_A165 Bacillus Anthracis Dihydrofolate Reductase Bound To 2e-11
3e0b_A166 Bacillus Anthracis Dihydrofolate Reductase Complexe 2e-11
1j3j_A280 Double Mutant (C59r+s108n) Plasmodium Falciparum Di 2e-11
3qgt_A 608 Crystal Structure Of Wild-Type Pfdhfr-Ts Complexed 3e-11
2w3v_A167 Mycobacterium Avium Dihydrofolate Reductase Complex 4e-11
1j3k_A280 Quadruple Mutant (n51i+c59r+s108n+i164l) Plasmodium 5e-11
3jw5_A168 Crystal Structure Of Bacillus Anthracis (Y102f) Dih 6e-11
3jsu_A 608 Quadruple Mutant(N51i+c59r+s108n+i164l) Plasmodium 8e-11
1zdr_A164 Dhfr From Bacillus Stearothermophilus Length = 164 2e-09
3i3r_A 511 X-Ray Structure Dihydrofolate ReductaseTHYMIDYLATE 2e-09
3nrr_A 515 Co-Crystal Structure Of Dihydrofolate Reductase-Thy 3e-09
2bl9_A238 X-Ray Crystal Structure Of Plasmodium Vivax Dihydro 9e-09
2bla_A238 Sp21 Double Mutant P. Vivax Dihydrofolate Reductase 2e-08
2zza_A162 Moritella Profunda Dihydrofolate Reductase Complex 4e-08
3ia4_A162 Moritella Profunda Dihydrofolate Reductase (Dhfr) I 4e-08
2drc_A159 Investigation Of The Functional Role Of Tryptophan- 3e-07
3ql0_A160 Crystal Structure Of N23ppS148A MUTANT OF E. COLI D 3e-07
2inq_B159 Neutron Crystal Structure Of Escherichia Coli Dihyd 3e-07
4dfr_A159 Crystal Structures Of Escherichia Coli And Lactobac 3e-07
3drc_A159 Investigation Of The Functional Role Of Tryptophan- 3e-07
1drb_A159 Crystal Structure Of Unliganded Escherichia Coli Di 3e-07
1dds_A159 Molecule: Dihydrofolate Reductase (E.C.1.5.1.3) Com 3e-07
3tq8_A178 Structure Of The Dihydrofolate Reductase (Fola) Fro 4e-07
1dra_A159 Crystal Structure Of Unliganded Escherichia Coli Di 4e-07
1dhi_A159 Long-Range Structural Effects In A Second-Site Reve 4e-07
1dhj_A159 Long-Range Structural Effects In A Second-Site Reve 4e-07
2d0k_A159 Methionine-Free Mutant Of Escherichia Coli Dihydrof 6e-07
3q1h_A163 Crystal Structure Of Dihydrofolate Reductase From Y 3e-06
1cz3_A168 Dihydrofolate Reductase From Thermotoga Maritima Le 5e-05
3ix9_A190 Crystal Structure Of Streptococcus Pneumoniae Dihyd 5e-05
1vdr_A162 Dihydrofolate Reductase Length = 162 4e-04
2jyb_A162 Binary Hvdhfr1:folate Complex Length = 162 4e-04
2w9s_A161 Staphylococcus Aureus S1:dhfr In Complex With Trime 5e-04
>pdb|3F91|A Chain A, Structural Data For Human Active Site Mutant Enzyme Complexes Length = 187 Back     alignment and structure 
Iteration: 1

 Score =  110 bits (275), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 105/198 (53%), Gaps = 43/198 (21%)
Query: 24  RKDMAHFSRITKKTENSNRVNAVIMGRKTWDSIPEKFRPLPGRYNVVLTRNSDLGSQLTG 83
           R +  +FSR+T  +    + N VIMG+KTW SIPEKFRPL GR N+VL+R  +L     G
Sbjct: 29  RNEFRYFSRMTTTSSVEGKQNLVIMGKKTWFSIPEKFRPLKGRINLVLSR--ELKEPPQG 86
Query: 84  PNVTTTSSLDQAIDLLRHKKSKGEIENVWVIGGSSIYKLTEPLMNRLSTFPKKKGLILLC 143
            +   + SLD A+ L    +   +++ VW++GGSS+YK                      
Sbjct: 87  AHF-LSRSLDDALKLTEQPELANKVDMVWIVGGSSVYK---------------------- 123
Query: 144 TRKSNASFMFSVLSLQESLNSPYCDKVYVTQIHHHFDCDTFFPSLS-DKFQLIKD-PNIP 201
                           E++N P   K++VT+I   F+ DTFFP +  +K++L+ + P + 
Sbjct: 124 ----------------EAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVL 167
Query: 202 DDVQKENDLNFQFKVFQK 219
            DVQ+E  + ++F+V++K
Sbjct: 168 SDVQEEKGIKYKFEVYEK 185
>pdb|1DR1|A Chain A, 2.2 Angstroms Crystal Structure Of Chicken Liver Dihydrofolate Reductase Complexed With Nadp+ And Biopterin Length = 189 Back     alignment and structure
>pdb|3OAF|A Chain A, Structural And Kinetic Data For Antifolate Interactions Against Pneumocystis Jirovecii, Pneumocystis Carinii And Human Dihydrofolate Reductase And Thier Active Site Mutants Length = 186 Back     alignment and structure
>pdb|3GHV|A Chain A, Human Dihydrofolate Reductase Q35kN64F DOUBLE MUTANT INHIBITOR Complex Length = 186 Back     alignment and structure
>pdb|3F8Z|A Chain A, Human Dihydrofolate Reductase Structural Data With Active Site Mutant Enzyme Complexes Length = 187 Back     alignment and structure
>pdb|3GHC|A Chain A, Design, Synthesis, And X-Ray Crystal Structure Of Classical And Nonclassical 2-Amino-4-Oxo-5-Substituted-6-Thieno[2,3- D]pyrimidines As Dual Thymidylate Synthase And Dihydrofolate Reductase Inhibitors And As Potential Antitumor Agenst Length = 186 Back     alignment and structure
>pdb|1MVS|A Chain A, Analysis Of Two Polymorphic Forms Of A Pyrido[2,3- D]pyrimidine N9-C10 Reverse-Bridge Antifolate Binary Complex With Human Dihydrofolate Reductase Length = 187 Back     alignment and structure
>pdb|3F8Y|A Chain A, Correlations Of Human Dihydrofolate Reductase With Structural Data For Human Active Site Mutant Enzyme Complexes Length = 187 Back     alignment and structure
>pdb|1DHF|A Chain A, Crystal Structures Of Recombinant Human Dihydrofolate Reductase Complexed With Folate And 5-Deazofolate Length = 186 Back     alignment and structure
>pdb|1DLR|A Chain A, Methotrexate-Resistant Variants Of Human Dihydrofolate Reductase With Substitution Of Leucine 22: Kinetics, Crystallography And Potential As Selectable Markers Length = 186 Back     alignment and structure
>pdb|1DLS|A Chain A, Methotrexate-Resistant Variants Of Human Dihydrofolate Reductase With Substitution Of Leucine 22: Kinetics, Crystallography And Potential As Selectable Markers Length = 186 Back     alignment and structure
>pdb|3L3R|A Chain A, Structural, Computational And Kinetic Data For Antifolate Interactions Against Pneumocystis Jirovecii, Pneumocystis Carinii And Human Dihydrofolate Reductase And Their Active Site Mutants Length = 186 Back     alignment and structure
>pdb|1U71|A Chain A, Understanding The Role Of Leu22 Variants In Methotrexate Resistance: Comparison Of Wild-type And Leu22arg Variant Mouse And Human Dihydrofolate Reductase Ternary Crystal Complexes With Methotrexate And Nadph Length = 186 Back     alignment and structure
>pdb|3EIG|A Chain A, Crystal Structure Of A Methotrexate-Resistant Mutant Of Human Dihydrofolate Reductase Length = 186 Back     alignment and structure
>pdb|1HFQ|A Chain A, Comparison Of Ternary Crystal Complexes Of Human Dihydrofolate Reductase With Nadph And A Classical Antitumor Furopyrimdine Length = 186 Back     alignment and structure
>pdb|1BOZ|A Chain A, Structure-Based Design And Synthesis Of Lipophilic 2,4- Diamino-6-Substituted Quinazolines And Their Evaluation As Inhibitors Of Dihydrofolate Reductase And Potential Antitumor Agents Length = 186 Back     alignment and structure
>pdb|3NXO|A Chain A, Perferential Selection Of Isomer Binding From Chiral Mixtures: Alternate Binding Modes Observed For The E- And Z-Isomers Of A Series Of 5-Substituted 2,4-Diaminofuro[2,3-D]pyrimidines As Ternary Complexes With Nadph And Human Dihydrofolate Reductase Length = 186 Back     alignment and structure
>pdb|2FZJ|A Chain A, New Insights Into Dhfr Interactions: Analysis Of Pneumocystis Carinii And Mouse Dhfr Complexes With Nadph And Two Highly Potent Trimethoprim Derivatives Length = 186 Back     alignment and structure
>pdb|1U70|A Chain A, Understanding The Role Of Leu22 Variants In Methotrexate Resistance: Comparison Of Wild-Type And Leu22arg Variant Mouse And Human Dihydrofolate Reductase Length = 186 Back     alignment and structure
>pdb|3K45|A Chain A, Alternate Binding Modes Observed For The E- And Z-Isomers Of 2,4- Diaminofuro[2,3d]pyrimidines As Ternary Complexes With Nadph And Mouse Dihydrofolate Reductase Length = 186 Back     alignment and structure
>pdb|1AI9|A Chain A, Candida Albicans Dihydrofolate Reductase Length = 192 Back     alignment and structure
>pdb|1CD2|A Chain A, Ligand Induced Conformational Changes In The Crystal Structures Of Pneumocystis Carinii Dihydrofolate Reductase Complexes With Folate And Nadp+ Length = 206 Back     alignment and structure
>pdb|1VJ3|A Chain A, Structural Studies On Bio-Active Compounds. Crystal Structure And Molecular Modeling Studies On The Pneumocystis Carinii Dihydrofolate Reductase Cofactor Complex With Tab, A Highly Selective Antifolate Length = 205 Back     alignment and structure
>pdb|3RO9|A Chain A, Candida Glabrata Dihydrofolate Reductase Complexed With Nadph And 6- Ethyl-5-[(3r)-3-[3-Methoxy-5-(Pyridin-4-Yl)phenyl]but-1- Yn-1- Yl]pyrimidine-2,4-Diamine (Ucp1006) Length = 225 Back     alignment and structure
>pdb|3CSE|A Chain A, Candida Glabrata Dihydrofolate Reductase Complexed With Nadph And 2,4-Diamino-5-(3-(2,5-Dimethoxyphenyl)prop-1- Ynyl)-6-Ethylpyrimidine (Ucp120b) Length = 227 Back     alignment and structure
>pdb|3QFX|A Chain A, Trypanosoma Brucei Dihydrofolate Reductase Pyrimethamine Complex Length = 241 Back     alignment and structure
>pdb|3RG9|A Chain A, Trypanosoma Brucei Dihydrofolate Reductase (Tbdhfr) In Complex With Wr99210 Length = 240 Back     alignment and structure
>pdb|2H2Q|A Chain A, Crystal Structure Of Trypanosoma Cruzi Dihydrofolate Reductase- Thymidylate Synthase Length = 521 Back     alignment and structure
>pdb|3INV|A Chain A, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate Synthase Complexed With Nadph, Dump And C-448 Antifolate Length = 521 Back     alignment and structure
>pdb|1DF7|A Chain A, Dihydrofolate Reductase Of Mycobacterium Tuberculosis Complexed With Nadph And Methotrexate Length = 159 Back     alignment and structure
>pdb|3DL5|A Chain A, Crystal Structure Of The A287f Active Site Mutant Of Ts- Dhfr From Cryptosporidium Hominis Length = 521 Back     alignment and structure
>pdb|3DL6|A Chain A, Crystal Structure Of The A287fS290G ACTIVE SITE MUTANT OF Ts-Dhfr From Cryptosporidium Hominis Length = 521 Back     alignment and structure
>pdb|2OIP|A Chain A, Crystal Structure Of The S290g Active Site Mutant Of Ts- Dhfr From Cryptosporidium Hominis Length = 519 Back     alignment and structure
>pdb|1QZF|A Chain A, Crystal Structure Of Dhfr-Ts From Cryptosporidium Hominis Length = 521 Back     alignment and structure
>pdb|3HJ3|A Chain A, Crystal Structure Of The Chts-Dhfr F207a Non-Active Site Mut Length = 521 Back     alignment and structure
>pdb|2CIG|A Chain A, Dihydrofolate Reductase From Mycobacterium Tuberculosis Inhibited By The Acyclic 4r Isomer Of Inh-Nadp A Derivative Of The Prodrug Isoniazid Length = 159 Back     alignment and structure
>pdb|3JW3|A Chain A, Crystal Structure Of Bacillus Anthracis (F96i) Dihydrofolate Reductase Complexed With Nadph And Trimethoprim Length = 168 Back     alignment and structure
>pdb|3UM5|A Chain A, Double Mutant (A16v+s108t) Plasmodium Falciparum Dihydrofolate Reductase-Thymidylate Synthase (Pfdhfr-Ts-T994) COMPLEXED WITH Pyrimethamine, Nadph, And Dump Length = 608 Back     alignment and structure
>pdb|3FL8|A Chain A, Crystal Structure Of B. Anthracis Dihydrofolate Reductase (Dhfr) With Rab1, A Tmp-Dihydrophthalazine Derivative Length = 166 Back     alignment and structure
>pdb|1J3I|A Chain A, Wild-Type Plasmodium Falciparum Dihydrofolate Reductase- Thymidylate Synthase (Pfdhfr-Ts) Complexed With Wr99210, Nadph, And Dump Length = 280 Back     alignment and structure
>pdb|2QK8|A Chain A, Crystal Structure Of The Anthrax Drug Target, Bacillus Anthracis Dihydrofolate Reductase Length = 162 Back     alignment and structure
>pdb|3JVX|A Chain A, Crystal Structure Of Bacillus Anthracis Dihydrofolate Reductase Complexed With Nadph And 2,4-Diamino-5-(3-(3,4,5-Trimethoxyphenyl) Prop-1-Ynyl)-6-Ethylpyrimidine (Ucp120a) Length = 168 Back     alignment and structure
>pdb|2KGK|A Chain A, Solution Structure Of Bacillus Anthracis Dihydrofolate Reductase Length = 172 Back     alignment and structure
>pdb|3S9U|A Chain A, Bacillus Anthracis Dihydrofolate Reductase Bound To Propargyl-Linked Tmp Analog, Ucp120j Length = 165 Back     alignment and structure
>pdb|3E0B|A Chain A, Bacillus Anthracis Dihydrofolate Reductase Complexed With Nadph And 2,4-Diamino-5-(3-(2,5-Dimethoxyphenyl)prop-1- Ynyl)-6-Ethylpyrimidine (Ucp120b) Length = 166 Back     alignment and structure
>pdb|1J3J|A Chain A, Double Mutant (C59r+s108n) Plasmodium Falciparum Dihydrofolate Reductase-Thymidylate Synthase (Pfdhfr-Ts) Complexed With Pyrimethamine, Nadph, And Dump Length = 280 Back     alignment and structure
>pdb|3QGT|A Chain A, Crystal Structure Of Wild-Type Pfdhfr-Ts Complexed With Nadph, Dump And Pyrimethamine Length = 608 Back     alignment and structure
>pdb|2W3V|A Chain A, Mycobacterium Avium Dihydrofolate Reductase Complexed With Nadph And Trimethoprim Length = 167 Back     alignment and structure
>pdb|1J3K|A Chain A, Quadruple Mutant (n51i+c59r+s108n+i164l) Plasmodium Falciparum Dihydrofolate Reductase-thymidylate Synthase (pfdhfr-ts) Complexed With Wr99210, Nadph, And Dump Length = 280 Back     alignment and structure
>pdb|3JW5|A Chain A, Crystal Structure Of Bacillus Anthracis (Y102f) Dihydrofolate Reductase Complexed With Nadph And Trimethoprim Length = 168 Back     alignment and structure
>pdb|3JSU|A Chain A, Quadruple Mutant(N51i+c59r+s108n+i164l) Plasmodium Falciparum Dihydrofolate Reductase-Thymidylate Synthase(Pfdhfr-Ts) Complexed With Qn254, Nadph, And Dump Length = 608 Back     alignment and structure
>pdb|1ZDR|A Chain A, Dhfr From Bacillus Stearothermophilus Length = 164 Back     alignment and structure
>pdb|3I3R|A Chain A, X-Ray Structure Dihydrofolate ReductaseTHYMIDYLATE SYNTHASE FROM Babesia Bovis At 2.35a Resolution Length = 511 Back     alignment and structure
>pdb|3NRR|A Chain A, Co-Crystal Structure Of Dihydrofolate Reductase-Thymidylate Synthase From Babesia Bovis With Dump, Raltitrexed And Nadp Length = 515 Back     alignment and structure
>pdb|2BL9|A Chain A, X-Ray Crystal Structure Of Plasmodium Vivax Dihydrofolate Reductase In Complex With Pyrimethamine And Its Derivative Length = 238 Back     alignment and structure
>pdb|2BLA|A Chain A, Sp21 Double Mutant P. Vivax Dihydrofolate Reductase In Complex With Pyrimethamine Length = 238 Back     alignment and structure
>pdb|2ZZA|A Chain A, Moritella Profunda Dihydrofolate Reductase Complex With Nadp+ And Folate Length = 162 Back     alignment and structure
>pdb|3IA4|A Chain A, Moritella Profunda Dihydrofolate Reductase (Dhfr) In Complex With Nadph And Methotrexate (Mtx) Length = 162 Back     alignment and structure
>pdb|2DRC|A Chain A, Investigation Of The Functional Role Of Tryptophan-22 In Escherichia Coli Dihydrofolate Reductase By Site-Directed Mutagenesis Length = 159 Back     alignment and structure
>pdb|3QL0|A Chain A, Crystal Structure Of N23ppS148A MUTANT OF E. COLI DIHYDROFOLATE Reductase Length = 160 Back     alignment and structure
>pdb|2INQ|B Chain B, Neutron Crystal Structure Of Escherichia Coli Dihydrofolate Reductase Bound To The Anti-Cancer Drug, Methotrexate Length = 159 Back     alignment and structure
>pdb|4DFR|A Chain A, Crystal Structures Of Escherichia Coli And Lactobacillus Casei Dihydrofolate Reductase Refined At 1.7 Angstroms Resolution. I. General Features And Binding Of Methotrexate Length = 159 Back     alignment and structure
>pdb|3DRC|A Chain A, Investigation Of The Functional Role Of Tryptophan-22 In Escherichia Coli Dihydrofolate Reductase By Site-Directed Mutagenesis Length = 159 Back     alignment and structure
>pdb|1DRB|A Chain A, Crystal Structure Of Unliganded Escherichia Coli Dihydrofolate Reductase. Ligand-Induced Conformational Changes And Cooperativity In Binding Length = 159 Back     alignment and structure
>pdb|1DDS|A Chain A, Molecule: Dihydrofolate Reductase (E.C.1.5.1.3) Complexed With Methotrexate Length = 159 Back     alignment and structure
>pdb|3TQ8|A Chain A, Structure Of The Dihydrofolate Reductase (Fola) From Coxiella Burnetii In Complex With Trimethoprim Length = 178 Back     alignment and structure
>pdb|1DRA|A Chain A, Crystal Structure Of Unliganded Escherichia Coli Dihydrofolate Reductase. Ligand-Induced Conformational Changes And Cooperativity In Binding Length = 159 Back     alignment and structure
>pdb|1DHI|A Chain A, Long-Range Structural Effects In A Second-Site Revertant Of A Mutant Dihydrofolate Reductase Length = 159 Back     alignment and structure
>pdb|1DHJ|A Chain A, Long-Range Structural Effects In A Second-Site Revertant Of A Mutant Dihydrofolate Reductase Length = 159 Back     alignment and structure
>pdb|2D0K|A Chain A, Methionine-Free Mutant Of Escherichia Coli Dihydrofolate Reductase Length = 159 Back     alignment and structure
>pdb|3Q1H|A Chain A, Crystal Structure Of Dihydrofolate Reductase From Yersinia Pestis Length = 163 Back     alignment and structure
>pdb|1CZ3|A Chain A, Dihydrofolate Reductase From Thermotoga Maritima Length = 168 Back     alignment and structure
>pdb|3IX9|A Chain A, Crystal Structure Of Streptococcus Pneumoniae Dihydrofolate Reductase - Sp9 Mutant Length = 190 Back     alignment and structure
>pdb|1VDR|A Chain A, Dihydrofolate Reductase Length = 162 Back     alignment and structure
>pdb|2JYB|A Chain A, Binary Hvdhfr1:folate Complex Length = 162 Back     alignment and structure
>pdb|2W9S|A Chain A, Staphylococcus Aureus S1:dhfr In Complex With Trimethoprim Length = 161 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query258
1kmv_A186 DHFR, dihydrofolate reductase; oxidoreductase, ant 4e-61
3nzb_X206 Dihydrofolate reductase; pneumocystius carinii DHF 4e-57
1aoe_A192 DHFR, dihydrofolate reductase; oxidoreductase, ant 1e-56
3cse_A227 Dihydrofolate reductase; protein-ligand complex, o 5e-52
1j3k_A280 Bifunctional dihydrofolate reductase-thymidylate s 2e-51
2bl9_A238 Dihydrofolate reductase-thymidylate synthase; plam 2e-50
3rg9_A240 Bifunctional dihydrofolate reductase-thymidylate; 8e-50
3nrr_A 515 Dihydrofolate reductase-thymidylate synthase; stru 5e-43
3hj3_A 521 Chain A, crystal structure of DHFR; TS, enzyme, cr 4e-42
3dfr_A162 Dihydrofolate reductase; oxido-reductase; HET: NDP 2e-41
2w3w_A167 Dihydrofolate reductase; nonclassical antifolates, 2e-40
1df7_A159 DHFR, dihydrofolate reductase; structure-based inh 2e-39
1zdr_A164 Dihydrofolate reductase; DHFR, NADP, oxidoreductas 3e-39
3ia4_A162 Dihydrofolate reductase; NADPH, methotrexate, oxid 5e-38
3s9u_A165 Dihydrofolate reductase; oxidoreductase; HET: NAP 6e-38
3dau_A159 Dihydrofolate reductase; oxidoreductase, pseudo-ro 1e-37
3tq8_A178 Dihydrofolate reductase; oxidoreductase-oxidoreduc 2e-37
3qg2_A 608 Bifunctional dihydrofolate reductase-thymidylate; 2e-37
3ix9_A190 Dihydrofolate reductase; central beta sheet surrou 4e-37
2w9h_A159 DHFR, dihydrofolate reductase; oxidoreductase, one 2e-36
1vdr_A162 DHFR, dihydrofolate reductase; oxidoreductase, hal 8e-36
3irm_A 521 Bifunctional dihydrofolate reductase-thymidylate; 1e-33
1juv_A193 DHFR, dihydrofolate reductase; complexed with NADP 7e-31
1cz3_A168 Dihydrofolate reductase; dimer, hyperthermophIle, 3e-30
3kgy_A231 Bifunctional deaminase-reductase domain protein; p 5e-07
3ky8_A197 Putative riboflavin biosynthesis protein; structur 1e-05
3jtw_A178 Dihydrofolate reductase; YP_805003.1, structural G 1e-05
2xw7_A178 Dihydrofolate reductase; oxidoreductase, NADPH; HE 1e-05
2gd9_A189 Hypothetical protein YYAP; structural genomics, jo 1e-04
>1kmv_A DHFR, dihydrofolate reductase; oxidoreductase, antiparasitic drugs, lipophilic antifolates; HET: LII NDP; 1.05A {Homo sapiens} SCOP: c.71.1.1 PDB: 1dhf_A* 1hfr_A* 1drf_A* 1kms_A* 1ohj_A* 1ohk_A* 1pd8_A* 1pd9_A* 1pdb_A 1s3u_A* 1s3v_A* 1s3w_A* 1u72_A* 1yho_A* 2c2s_A* 2c2t_A* 2dhf_A* 3ghw_A* 3ntz_A* 3nu0_A* ... Length = 186 Back     alignment and structure
 Score =  190 bits (484), Expect = 4e-61
 Identities = 63/198 (31%), Positives = 100/198 (50%), Gaps = 43/198 (21%)

Query: 24  RKDMAHFSRITKKTENSNRVNAVIMGRKTWDSIPEKFRPLPGRYNVVLTRNSDLGSQLTG 83
           R +  +F R+T  +    + N VIMG+KTW SIPEK RPL GR N+VL+R         G
Sbjct: 28  RNEFRYFQRMTTTSSVEGKQNLVIMGKKTWFSIPEKNRPLKGRINLVLSRELKE--PPQG 85

Query: 84  PNVTTTSSLDQAIDLLRHKKSKGEIENVWVIGGSSIYKLTEPLMNRLSTFPKKKGLILLC 143
                + SLD A+ L    +   +++ VW++GGSS+YK                      
Sbjct: 86  -AHFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYK---------------------- 122

Query: 144 TRKSNASFMFSVLSLQESLNSPYCDKVYVTQIHHHFDCDTFFPSLS-DKFQLI-KDPNIP 201
                           E++N P   K++VT+I   F+ DTFFP +  +K++L+ + P + 
Sbjct: 123 ----------------EAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVL 166

Query: 202 DDVQKENDLNFQFKVFQK 219
            DVQ+E  + ++F+V++K
Sbjct: 167 SDVQEEKGIKYKFEVYEK 184
>3nzb_X Dihydrofolate reductase; pneumocystius carinii DHFR inhibitor complexes, oxidoreducta oxidoreductase-oxidoreductase inhibitor complex; HET: D2N NAP; 1.45A {Pneumocystis carinii} PDB: 1daj_A* 1cd2_A* 1e26_A* 1klk_A* 1ly3_A* 1ly4_A* 1s3y_A* 2cd2_A* 2fzh_A* 1dyr_A* 3cd2_A* 3nz6_X* 3nz9_X* 3nza_X* 2fzi_A* 3nzc_X* 3td8_A* 4cd2_A* 1vj3_A* Length = 206 Back     alignment and structure
>1aoe_A DHFR, dihydrofolate reductase; oxidoreductase, antifungal target; HET: NDP GW3; 1.60A {Candida albicans} SCOP: c.71.1.1 PDB: 1ai9_A* 1ia1_A* 1ia2_A* 1ia3_A* 1ia4_A* 1m78_A* 1m79_A* 1m7a_A* 3qlr_A* 3qls_A* 3qlw_A* Length = 192 Back     alignment and structure
>3cse_A Dihydrofolate reductase; protein-ligand complex, oxidoreductase; HET: NAP N22; 1.60A {Candida glabrata} PDB: 3eej_A* 3eek_A* 3eel_A* 3eem_A* 3qlx_A* 3qly_A* 3qlz_A* Length = 227 Back     alignment and structure
>1j3k_A Bifunctional dihydrofolate reductase-thymidylate synthase; oxidoreductase, transferase; HET: WRA NDP UMP; 2.10A {Plasmodium falciparum} SCOP: c.71.1.1 PDB: 3dg8_A* 1j3j_A* 1j3i_A* 3dga_A* Length = 280 Back     alignment and structure
>2bl9_A Dihydrofolate reductase-thymidylate synthase; plamodium vivax, pyrimethamine, malaria, drug resistance, oxidoreductase; HET: NDP CP6; 1.9A {Plasmodium vivax} PDB: 2blb_A* 2blc_A* 2bla_A* Length = 238 Back     alignment and structure
>3rg9_A Bifunctional dihydrofolate reductase-thymidylate; oxidoreductase, oxidoreductase-oxidoreductase inhibitor complex; HET: NDP WRA; 2.00A {Trypanosoma brucei rhodesiense} PDB: 3qfx_A* Length = 240 Back     alignment and structure
>3nrr_A Dihydrofolate reductase-thymidylate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, niaid, DHFR; HET: NAP D16 UMP; 1.80A {Babesia bovis} PDB: 3kjr_A* 3i3r_A* 3k2h_A* Length = 515 Back     alignment and structure
>3hj3_A Chain A, crystal structure of DHFR; TS, enzyme, crossover, non-active site, oxidoreductase; HET: UMP CB3 MTX NDP; 2.70A {Cryptosporidium hominis} PDB: 1qzf_A* 1sej_A* 3dl5_A* 3dl6_A* 2oip_A* Length = 521 Back     alignment and structure
>3dfr_A Dihydrofolate reductase; oxido-reductase; HET: NDP MTX; 1.70A {Lactobacillus casei} SCOP: c.71.1.1 PDB: 1ao8_A* 1bzf_A* 1dis_A* 1diu_A* 1lud_A* 2hm9_A* 2hqp_A* 2l28_A 2lf1_A* Length = 162 Back     alignment and structure
>2w3w_A Dihydrofolate reductase; nonclassical antifolates, one-carbon metabolism, lipophilic antifolates, NADP, oxidoreductase; HET: VG9 NDP; 1.60A {Mycobacterium avium} PDB: 2w3v_A* Length = 167 Back     alignment and structure
>1df7_A DHFR, dihydrofolate reductase; structure-based inhibitor design, folateanalogs, rossmann fold; HET: NDP MTX; 1.70A {Mycobacterium tuberculosis} SCOP: c.71.1.1 PDB: 1dg5_A* 1dg7_A* 1dg8_A* 2cig_A* Length = 159 Back     alignment and structure
>1zdr_A Dihydrofolate reductase; DHFR, NADP, oxidoreductase; 2.00A {Geobacillus stearothermophilus} Length = 164 Back     alignment and structure
>3ia4_A Dihydrofolate reductase; NADPH, methotrexate, oxidoreductase; HET: NDP MTX; 1.70A {Moritella profunda} PDB: 3ia5_A 2zza_A* Length = 162 Back     alignment and structure
>3s9u_A Dihydrofolate reductase; oxidoreductase; HET: NAP 5DR; 1.90A {Bacillus anthracis} PDB: 3sa1_A* 3sa2_A* 3sai_A* 3e0b_A* 3jvx_A* 3jwm_A* 3jwk_A* 3jw5_A* 3jwf_A* 3jwc_A* 3jw3_A* 3dat_A* 2qk8_A* 3fl8_A* 3fl9_A* 2kgk_A* Length = 165 Back     alignment and structure
>3dau_A Dihydrofolate reductase; oxidoreductase, pseudo-rossmann fold, adenine nucleotide BIN domain, antibiotic resistance, methotrexate resistance; HET: MTX NAP; 1.50A {Escherichia coli} PDB: 1ddr_A* 1dds_A* 3k74_A 1ra9_A* 1dre_A* 1drh_A* 1dyi_A* 1dyh_A* 1jol_A* 1jom_A* 1ra1_A* 1dyj_A* 1ra3_A* 1ra8_A* 1ra2_A* 1rb2_A* 1rb3_A* 1rc4_A* 1rd7_A* 1re7_A* ... Length = 159 Back     alignment and structure
>3tq8_A Dihydrofolate reductase; oxidoreductase-oxidoreductase inhib complex; HET: NDP TOP; 1.90A {Coxiella burnetii} PDB: 3tq9_A* 3tqa_A* 3tqb_A* Length = 178 Back     alignment and structure
>3qg2_A Bifunctional dihydrofolate reductase-thymidylate; pyrimethamine, antifolate resistance, oxidoreductase, transferase; HET: CP6 NDP UMP; 2.30A {Plasmodium falciparum} PDB: 3jsu_A* 3qgt_A* Length = 608 Back     alignment and structure
>3ix9_A Dihydrofolate reductase; central beta sheet surrounded by 4 alpha helices, oxidoreductase; HET: NDP MTX; 1.95A {Streptococcus pneumoniae} Length = 190 Back     alignment and structure
>2w9h_A DHFR, dihydrofolate reductase; oxidoreductase, one-carbon metabolism; HET: TOP; 1.48A {Staphylococcus aureus} PDB: 2w9g_A* 3sqy_X* 3srq_X* 3srr_X* 3srs_X* 3sru_X* 3srw_X* 3frd_X* 3fre_X* 3frf_X* 3fyv_X* 3fyw_X* 3sr5_X* 3frb_X* 3fra_X* 3fy8_X* 3fy9_X* 3fq0_A* 3f0b_X* 3f0s_X* ... Length = 159 Back     alignment and structure
>1vdr_A DHFR, dihydrofolate reductase; oxidoreductase, halophilic enzyme; 2.55A {Haloferax volcanii} SCOP: c.71.1.1 PDB: 2ith_A 2jyb_A Length = 162 Back     alignment and structure
>3irm_A Bifunctional dihydrofolate reductase-thymidylate; DHFR-TS antifolate complex, methyltransfe multifunctional enzyme, NADP; HET: 1CY; 2.10A {Trypanosoma cruzi} PDB: 3inv_A* 3irn_A* 3iro_A* 2h2q_A* 3cl9_A* 3clb_A* 3hbb_A* 3kjs_A* Length = 521 Back     alignment and structure
>1juv_A DHFR, dihydrofolate reductase; complexed with NADPH, oxidoreductase; HET: NDP; 1.70A {Enterobacteria phage T4} SCOP: c.71.1.1 Length = 193 Back     alignment and structure
>1cz3_A Dihydrofolate reductase; dimer, hyperthermophIle, oxidoreductase; 2.10A {Thermotoga maritima} SCOP: c.71.1.1 PDB: 1d1g_A* Length = 168 Back     alignment and structure
>3kgy_A Bifunctional deaminase-reductase domain protein; putative dihydrofolate reductase, structural genomics; HET: MSE NDP; 1.50A {Chloroflexus aurantiacus j-10-fl} Length = 231 Back     alignment and structure
>3ky8_A Putative riboflavin biosynthesis protein; structural genomic center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE UNL; 2.12A {Shewanella loihica} Length = 197 Back     alignment and structure
>3jtw_A Dihydrofolate reductase; YP_805003.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 1.90A {Pediococcus pentosaceus atcc 25745} Length = 178 Back     alignment and structure
>2xw7_A Dihydrofolate reductase; oxidoreductase, NADPH; HET: PG4 NDP; 2.00A {Mycobacterium smegmatis} Length = 178 Back     alignment and structure
>2gd9_A Hypothetical protein YYAP; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, oxidoreductase; 2.30A {Bacillus subtilis} Length = 189 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query258
3rg9_A240 Bifunctional dihydrofolate reductase-thymidylate; 100.0
3nzb_X206 Dihydrofolate reductase; pneumocystius carinii DHF 100.0
3dau_A159 Dihydrofolate reductase; oxidoreductase, pseudo-ro 100.0
3irm_A 521 Bifunctional dihydrofolate reductase-thymidylate; 100.0
3ia4_A162 Dihydrofolate reductase; NADPH, methotrexate, oxid 100.0
3tq8_A178 Dihydrofolate reductase; oxidoreductase-oxidoreduc 100.0
3s9u_A165 Dihydrofolate reductase; oxidoreductase; HET: NAP 100.0
1kmv_A186 DHFR, dihydrofolate reductase; oxidoreductase, ant 100.0
2bl9_A238 Dihydrofolate reductase-thymidylate synthase; plam 100.0
3dfr_A162 Dihydrofolate reductase; oxido-reductase; HET: NDP 100.0
3qg2_A 608 Bifunctional dihydrofolate reductase-thymidylate; 100.0
3cse_A227 Dihydrofolate reductase; protein-ligand complex, o 100.0
1aoe_A192 DHFR, dihydrofolate reductase; oxidoreductase, ant 100.0
3ix9_A190 Dihydrofolate reductase; central beta sheet surrou 100.0
1j3k_A280 Bifunctional dihydrofolate reductase-thymidylate s 100.0
1zdr_A164 Dihydrofolate reductase; DHFR, NADP, oxidoreductas 100.0
3nrr_A 515 Dihydrofolate reductase-thymidylate synthase; stru 100.0
2w3w_A167 Dihydrofolate reductase; nonclassical antifolates, 100.0
2w9h_A159 DHFR, dihydrofolate reductase; oxidoreductase, one 100.0
1df7_A159 DHFR, dihydrofolate reductase; structure-based inh 100.0
1vdr_A162 DHFR, dihydrofolate reductase; oxidoreductase, hal 100.0
3hj3_A 521 Chain A, crystal structure of DHFR; TS, enzyme, cr 100.0
1juv_A193 DHFR, dihydrofolate reductase; complexed with NADP 100.0
1cz3_A168 Dihydrofolate reductase; dimer, hyperthermophIle, 99.96
3jtw_A178 Dihydrofolate reductase; YP_805003.1, structural G 99.95
3ky8_A197 Putative riboflavin biosynthesis protein; structur 99.92
2xw7_A178 Dihydrofolate reductase; oxidoreductase, NADPH; HE 99.92
2gd9_A189 Hypothetical protein YYAP; structural genomics, jo 99.89
3kgy_A231 Bifunctional deaminase-reductase domain protein; p 99.82
2b3z_A373 Riboflavin biosynthesis protein RIBD; alpha/beta/a 99.44
2azn_A219 HTP reductase, putative 5-amino-6-(5-phosphoribosy 99.18
2hxv_A360 Diaminohydroxyphosphoribosylaminopyrimidine deami 98.9
2g6v_A402 Riboflavin biosynthesis protein RIBD; RIBD APO str 98.78
2p4g_A270 Hypothetical protein; pyrimidine reductase-like pr 98.74
>3rg9_A Bifunctional dihydrofolate reductase-thymidylate; oxidoreductase, oxidoreductase-oxidoreductase inhibitor complex; HET: NDP WRA; 2.00A {Trypanosoma brucei rhodesiense} PDB: 3qfx_A* Back     alignment and structure
Probab=100.00  E-value=1.1e-48  Score=347.18  Aligned_cols=179  Identities=29%  Similarity=0.474  Sum_probs=153.4

Q ss_pred             eEEEEEeccceeecCCCcccCChhhhhHHHHHHcC------CCCCCccceEEEeccccccccCCCCCCCCCcEEEEcCcC
Q psy1579           2 LMITVFLKVQGFFFEACQIFYTRKDMAHFSRITKK------TENSNRVNAVIMGRKTWDSIPEKFRPLPGRYNVVLTRNS   75 (258)
Q Consensus         2 ~~I~a~~~~~giG~~g~lPW~l~~Dm~~F~~iT~~------~~~~~~~naVIMGRKTweSip~~~rPL~~R~nvVlSr~~   75 (258)
                      .+|+|++.+++||.+|+|||++|+||+||+++|++      .++++++|+||||||||||||.++||||+|.||||||+.
T Consensus        30 ~lIvA~s~ng~IG~~g~LPW~lp~Dm~~Fk~~T~g~p~~~~~~~~~~~naVIMGRKT~ESip~~~rPLp~R~nIVlSr~~  109 (240)
T 3rg9_A           30 SVVVASDEKGGIGDGGTIPWEIPEDMQYFRRVTTNLRGKNVKPSPSKRNAVVMGRKTWDSLPPKFRPLSNRLNVVLSRSA  109 (240)
T ss_dssp             EEEEEEETTCEEESSSSCSCCCHHHHHHHHHHHHCCSSSSCCCBTTBEEEEEEEHHHHHHSCGGGSSCTTSEEEEECSSC
T ss_pred             EEEEEECCCCcEECCCCcCCCCHHHHHHHHHHHcCCcccccccccccCcEEEEehhHHhhhhhhccCCCCCeEEEEccCc
Confidence            58999999999999999999999999999999999      567899999999999999999988999999999999987


Q ss_pred             CCCC---CC---------CCCcEEEeCCHHHHHHHHHhhccCCCCCcEEEEeChhhhcccccccccccCCcccccchhhh
Q psy1579          76 DLGS---QL---------TGPNVTTTSSLDQAIDLLRHKKSKGEIENVWVIGGSSIYKLTEPLMNRLSTFPKKKGLILLC  143 (258)
Q Consensus        76 ~~~~---~~---------~~~~v~v~~sl~~ai~~l~~~~~~~~~~~I~ViGGa~iy~~~~~~~~~~~~~~~~~~~~~~~  143 (258)
                      ....   ..         ..+++.+++|+++|++.+++.......++||||||++||+                      
T Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~v~v~~sl~eal~~l~~~~~~~~~~~I~VIGGa~IY~----------------------  167 (240)
T 3rg9_A          110 TKEQLLAGIPDPIKRAEAANDVVAVNGGLEDALRMLVSKEHTSSIETVFCIGGGTIYK----------------------  167 (240)
T ss_dssp             CHHHHHTTCSSHHHHHHHGGGEEEESSCHHHHHHHTTSHHHHHHEEEEEECCCHHHHH----------------------
T ss_pred             ccccccccccccccccccCCCCEEEECCHHHHHHHHhccccccCCCeEEEECCHHHHH----------------------
Confidence            5300   00         1467899999999999997641111247899999999999                      


Q ss_pred             cccCCccchhhhhhhHhhhCCC---cccEEEEEeec-ccccccccC--CCCC-CC-----cEEEec-CCCCCCCcccCCc
Q psy1579         144 TRKSNASFMFSVLSLQESLNSP---YCDKVYVTQIH-HHFDCDTFF--PSLS-DK-----FQLIKD-PNIPDDVQKENDL  210 (258)
Q Consensus       144 ~~~~~~~~~~s~l~~~~~l~~p---~~D~i~lT~I~-~~fe~DtfF--P~l~-~~-----f~li~~-~~i~~~~~een~~  210 (258)
                                      ++|.++   +||++|+|+|+ ..|+||+||  |.++ +.     |++++. +.+.  .+++|++
T Consensus       168 ----------------~~L~~~~~~l~D~l~lT~I~p~~~egDtfFp~P~~d~~~~~~~~w~~~~~~~~~~--~~~~~~~  229 (240)
T 3rg9_A          168 ----------------QALCAPCVNVLQAIHRTVVRPASNSCSVFFDIPAAGTKTPEGLELVRESITDERV--STGAGGK  229 (240)
T ss_dssp             ----------------HHTSTTGGGGEEEEEEEEEESCCSSCCEECCCCCTTCCCTTSCCEEEEEECCCEE--CSSTTCC
T ss_pred             ----------------HHHhcCccccCCEEEEEEEcCCCcCcceecCCCCCChhhcccCceEEEEeecccc--ccCCCCC
Confidence                            999888   99999999999 999999999  8887 66     999874 3322  2357999


Q ss_pred             cEEEEEEEEc
Q psy1579         211 NFQFKVFQKE  220 (258)
Q Consensus       211 ~f~f~~y~r~  220 (258)
                      .|+|.+|+|+
T Consensus       230 ~y~f~~y~r~  239 (240)
T 3rg9_A          230 KYQFEKLVPR  239 (240)
T ss_dssp             EEEEEEEEEC
T ss_pred             ceEEEEEEeC
Confidence            9999999997
>3nzb_X Dihydrofolate reductase; pneumocystius carinii DHFR inhibitor complexes, oxidoreducta oxidoreductase-oxidoreductase inhibitor complex; HET: D2N NAP; 1.45A {Pneumocystis carinii} SCOP: c.71.1.1 PDB: 1daj_A* 1cd2_A* 1e26_A* 1klk_A* 1ly3_A* 1ly4_A* 1s3y_A* 2cd2_A* 2fzh_A* 1dyr_A* 3cd2_A* 3nz6_X* 3nz9_X* 3nza_X* 2fzi_A* 3nzc_X* 3td8_A* 4cd2_A* 1vj3_A* Back     alignment and structure
>3dau_A Dihydrofolate reductase; oxidoreductase, pseudo-rossmann fold, adenine nucleotide BIN domain, antibiotic resistance, methotrexate resistance; HET: MTX NAP; 1.50A {Escherichia coli} SCOP: c.71.1.1 PDB: 1ddr_A* 1dds_A* 3k74_A 1ra9_A* 1dre_A* 1drh_A* 1dyi_A* 1dyh_A* 1jol_A* 1jom_A* 1ra1_A* 1dyj_A* 1ra3_A* 1ra8_A* 1ra2_A* 1rb2_A* 1rb3_A* 1rc4_A* 1rd7_A* 1re7_A* ... Back     alignment and structure
>3irm_A Bifunctional dihydrofolate reductase-thymidylate; DHFR-TS antifolate complex, methyltransfe multifunctional enzyme, NADP; HET: 1CY; 2.10A {Trypanosoma cruzi} PDB: 3inv_A* 3irn_A* 3iro_A* 2h2q_A* 3cl9_A* 3clb_A* 3hbb_A* 3kjs_A* Back     alignment and structure
>3ia4_A Dihydrofolate reductase; NADPH, methotrexate, oxidoreductase; HET: NDP MTX; 1.70A {Moritella profunda} SCOP: c.71.1.0 PDB: 3ia5_A 2zza_A* Back     alignment and structure
>3tq8_A Dihydrofolate reductase; oxidoreductase-oxidoreductase inhib complex; HET: NDP TOP; 1.90A {Coxiella burnetii} SCOP: c.71.1.0 PDB: 3tq9_A* 3tqa_A* 3tqb_A* Back     alignment and structure
>3s9u_A Dihydrofolate reductase; oxidoreductase; HET: NAP 5DR; 1.90A {Bacillus anthracis} PDB: 3sa1_A* 3sa2_A* 3sai_A* 3e0b_A* 3jvx_A* 3jwm_A* 3jwk_A* 3jw5_A* 3jwf_A* 3jwc_A* 3jw3_A* 3dat_A* 2qk8_A* 3fl8_A* 3fl9_A* 2kgk_A* Back     alignment and structure
>1kmv_A DHFR, dihydrofolate reductase; oxidoreductase, antiparasitic drugs, lipophilic antifolates; HET: LII NDP; 1.05A {Homo sapiens} SCOP: c.71.1.1 PDB: 1dhf_A* 1hfr_A* 1drf_A* 1kms_A* 1ohj_A* 1ohk_A* 1pd8_A* 1pd9_A* 1pdb_A 1s3u_A* 1s3v_A* 1s3w_A* 1u72_A* 1yho_A* 2c2s_A* 2c2t_A* 2dhf_A* 3ghw_A* 3ntz_A* 3nu0_A* ... Back     alignment and structure
>2bl9_A Dihydrofolate reductase-thymidylate synthase; plamodium vivax, pyrimethamine, malaria, drug resistance, oxidoreductase; HET: NDP CP6; 1.9A {Plasmodium vivax} PDB: 2blb_A* 2blc_A* 2bla_A* Back     alignment and structure
>3dfr_A Dihydrofolate reductase; oxido-reductase; HET: NDP MTX; 1.70A {Lactobacillus casei} SCOP: c.71.1.1 PDB: 1ao8_A* 1bzf_A* 1dis_A* 1diu_A* 1lud_A* 2hm9_A* 2hqp_A* 2l28_A 2lf1_A* Back     alignment and structure
>3qg2_A Bifunctional dihydrofolate reductase-thymidylate; pyrimethamine, antifolate resistance, oxidoreductase, transferase; HET: CP6 NDP UMP; 2.30A {Plasmodium falciparum} PDB: 3jsu_A* 4dp3_A* 4dph_A* 3qgt_A* 3um8_A* 4dpd_A* 3um5_A* 3um6_A* Back     alignment and structure
>3cse_A Dihydrofolate reductase; protein-ligand complex, oxidoreductase; HET: NAP N22; 1.60A {Candida glabrata} PDB: 3eej_A* 3eek_A* 3eel_A* 3eem_A* 3qlx_A* 3qly_A* 3qlz_A* Back     alignment and structure
>1aoe_A DHFR, dihydrofolate reductase; oxidoreductase, antifungal target; HET: NDP GW3; 1.60A {Candida albicans} SCOP: c.71.1.1 PDB: 1ai9_A* 1ia1_A* 1ia2_A* 1ia3_A* 1ia4_A* 1m78_A* 1m79_A* 1m7a_A* 3qlr_A* 3qls_A* 3qlw_A* Back     alignment and structure
>3ix9_A Dihydrofolate reductase; central beta sheet surrounded by 4 alpha helices, oxidoreductase; HET: NDP MTX; 1.95A {Streptococcus pneumoniae} Back     alignment and structure
>1j3k_A Bifunctional dihydrofolate reductase-thymidylate synthase; oxidoreductase, transferase; HET: WRA NDP UMP; 2.10A {Plasmodium falciparum} SCOP: c.71.1.1 PDB: 3dg8_A* 1j3j_A* 1j3i_A* 3dga_A* Back     alignment and structure
>1zdr_A Dihydrofolate reductase; DHFR, NADP, oxidoreductase; 2.00A {Geobacillus stearothermophilus} Back     alignment and structure
>3nrr_A Dihydrofolate reductase-thymidylate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, niaid, DHFR; HET: NAP D16 UMP; 1.80A {Babesia bovis} PDB: 3kjr_A* 3i3r_A* 3k2h_A* Back     alignment and structure
>2w3w_A Dihydrofolate reductase; nonclassical antifolates, one-carbon metabolism, lipophilic antifolates, NADP, oxidoreductase; HET: VG9 NDP; 1.60A {Mycobacterium avium} PDB: 2w3v_A* Back     alignment and structure
>2w9h_A DHFR, dihydrofolate reductase; oxidoreductase, one-carbon metabolism; HET: TOP; 1.48A {Staphylococcus aureus} PDB: 2w9g_A* 3sqy_X* 3srq_X* 3srr_X* 3srs_X* 3sru_X* 3srw_X* 3frd_X* 3fre_X* 3frf_X* 3fyv_X* 3fyw_X* 3sr5_X* 3frb_X* 3fra_X* 3fy8_X* 3fy9_X* 3fq0_A* 3f0b_X* 3f0s_X* ... Back     alignment and structure
>1df7_A DHFR, dihydrofolate reductase; structure-based inhibitor design, folateanalogs, rossmann fold; HET: NDP MTX; 1.70A {Mycobacterium tuberculosis} SCOP: c.71.1.1 PDB: 1dg5_A* 1dg7_A* 1dg8_A* 2cig_A* Back     alignment and structure
>1vdr_A DHFR, dihydrofolate reductase; oxidoreductase, halophilic enzyme; 2.55A {Haloferax volcanii} SCOP: c.71.1.1 PDB: 2ith_A 2jyb_A Back     alignment and structure
>3hj3_A Chain A, crystal structure of DHFR; TS, enzyme, crossover, non-active site, oxidoreductase; HET: UMP CB3 MTX NDP; 2.70A {Cryptosporidium hominis} PDB: 1qzf_A* 1sej_A* 3dl5_A* 3dl6_A* 2oip_A* Back     alignment and structure
>1juv_A DHFR, dihydrofolate reductase; complexed with NADPH, oxidoreductase; HET: NDP; 1.70A {Enterobacteria phage T4} SCOP: c.71.1.1 Back     alignment and structure
>1cz3_A Dihydrofolate reductase; dimer, hyperthermophIle, oxidoreductase; 2.10A {Thermotoga maritima} SCOP: c.71.1.1 PDB: 1d1g_A* Back     alignment and structure
>3jtw_A Dihydrofolate reductase; YP_805003.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 1.90A {Pediococcus pentosaceus atcc 25745} Back     alignment and structure
>3ky8_A Putative riboflavin biosynthesis protein; structural genomic center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE UNL; 2.12A {Shewanella loihica} Back     alignment and structure
>2xw7_A Dihydrofolate reductase; oxidoreductase, NADPH; HET: PG4 NDP; 2.00A {Mycobacterium smegmatis} Back     alignment and structure
>2gd9_A Hypothetical protein YYAP; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, oxidoreductase; 2.30A {Bacillus subtilis} Back     alignment and structure
>3kgy_A Bifunctional deaminase-reductase domain protein; putative dihydrofolate reductase, structural genomics; HET: MSE NDP; 1.50A {Chloroflexus aurantiacus j-10-fl} Back     alignment and structure
>2b3z_A Riboflavin biosynthesis protein RIBD; alpha/beta/alpha, deaminase domain and reductase domain, hydrolase, oxidoreductase; 2.41A {Bacillus subtilis} SCOP: c.71.1.2 c.97.1.2 PDB: 2d5n_A* 3ex8_A* Back     alignment and structure
>2azn_A HTP reductase, putative 5-amino-6-(5-phosphoribosylamino)uracil; oxidoreductase; HET: MA5 NAP EPE; 2.70A {Methanocaldococcus jannaschii} SCOP: c.71.1.2 Back     alignment and structure
>2hxv_A Diaminohydroxyphosphoribosylaminopyrimidine deami amino-6-(5-phosphoribosylamino)uracil...; oxidoreductase, structural genomics; HET: NDP; 1.80A {Thermotoga maritima} SCOP: c.71.1.2 c.97.1.2 Back     alignment and structure
>2g6v_A Riboflavin biosynthesis protein RIBD; RIBD APO structure, structural genomics, structural proteomi europe, spine, hydrolase, oxidoreductase; 2.60A {Escherichia coli} PDB: 2obc_A* 2o7p_A* Back     alignment and structure
>2p4g_A Hypothetical protein; pyrimidine reductase-like protein, structural genomics, JOIN for structural genomics, JCSG; 2.30A {Corynebacterium diphtheriae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 258
d1kmva_186 c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic 5e-28
d2fzia1206 c.71.1.1 (A:1-206) Dihydrofolate reductases, eukar 1e-24
d1j3ka_231 c.71.1.1 (A:) Bifunctional enzyme dihydrofolate re 1e-24
d1aoea_192 c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic 1e-22
d1seja1178 c.71.1.1 (A:3-180) Bifunctional enzyme dihydrofola 2e-20
d1juva_193 c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic 8e-20
d1df7a_159 c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic 5e-17
d1ra9a_159 c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic 7e-16
d1vdra_157 c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic 1e-13
d3dfra_162 c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic 1e-13
d1d1ga_164 c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic 2e-06
>d1kmva_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Dihydrofolate reductase-like
superfamily: Dihydrofolate reductase-like
family: Dihydrofolate reductases
domain: Dihydrofolate reductases, eukaryotic type
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  103 bits (258), Expect = 5e-28
 Identities = 62/198 (31%), Positives = 100/198 (50%), Gaps = 43/198 (21%)

Query: 24  RKDMAHFSRITKKTENSNRVNAVIMGRKTWDSIPEKFRPLPGRYNVVLTRNSDLGSQLTG 83
           R +  +F R+T  +    + N VIMG+KTW SIPEK RPL GR N+VL+R      Q   
Sbjct: 28  RNEFRYFQRMTTTSSVEGKQNLVIMGKKTWFSIPEKNRPLKGRINLVLSRELKEPPQ--- 84

Query: 84  PNVTTTSSLDQAIDLLRHKKSKGEIENVWVIGGSSIYKLTEPLMNRLSTFPKKKGLILLC 143
                + SLD A+ L    +   +++ VW++GGSS+Y                       
Sbjct: 85  GAHFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVY----------------------- 121

Query: 144 TRKSNASFMFSVLSLQESLNSPYCDKVYVTQIHHHFDCDTFFPSLS-DKFQLIKD-PNIP 201
                          +E++N P   K++VT+I   F+ DTFFP +  +K++L+ + P + 
Sbjct: 122 ---------------KEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVL 166

Query: 202 DDVQKENDLNFQFKVFQK 219
            DVQ+E  + ++F+V++K
Sbjct: 167 SDVQEEKGIKYKFEVYEK 184
>d2fzia1 c.71.1.1 (A:1-206) Dihydrofolate reductases, eukaryotic type {Fungus (Pneumocystis carinii) [TaxId: 4754]} Length = 206 Back     information, alignment and structure
>d1j3ka_ c.71.1.1 (A:) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 231 Back     information, alignment and structure
>d1aoea_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]} Length = 192 Back     information, alignment and structure
>d1seja1 c.71.1.1 (A:3-180) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Cryptosporidium hominis [TaxId: 237895]} Length = 178 Back     information, alignment and structure
>d1juva_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Bacteriophage T4 [TaxId: 10665]} Length = 193 Back     information, alignment and structure
>d1df7a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Mycobacterium tuberculosis [TaxId: 1773]} Length = 159 Back     information, alignment and structure
>d1ra9a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]} Length = 159 Back     information, alignment and structure
>d1vdra_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Haloferax volcanii [TaxId: 2246]} Length = 157 Back     information, alignment and structure
>d3dfra_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Lactobacillus casei [TaxId: 1582]} Length = 162 Back     information, alignment and structure
>d1d1ga_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Thermotoga maritima [TaxId: 2336]} Length = 164 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query258
d1kmva_186 Dihydrofolate reductases, eukaryotic type {Human ( 100.0
d2fzia1206 Dihydrofolate reductases, eukaryotic type {Fungus 100.0
d1aoea_192 Dihydrofolate reductases, eukaryotic type {Yeast ( 100.0
d1seja1178 Bifunctional enzyme dihydrofolate reductase-thymid 100.0
d3dfra_162 Dihydrofolate reductase, prokaryotic type {Lactoba 100.0
d1df7a_159 Dihydrofolate reductase, prokaryotic type {Mycobac 100.0
d1ra9a_159 Dihydrofolate reductase, prokaryotic type {Escheri 100.0
d1j3ka_231 Bifunctional enzyme dihydrofolate reductase-thymid 100.0
d1vdra_157 Dihydrofolate reductase, prokaryotic type {Halofer 100.0
d1juva_193 Dihydrofolate reductase, prokaryotic type {Bacteri 100.0
d1d1ga_164 Dihydrofolate reductase, prokaryotic type {Thermot 99.98
d2azna1219 HTP reductase {Methanococcus jannaschii [TaxId: 21 98.73
d2hxva1198 Riboflavin biosynthesis protein RibD {Thermotoga m 98.53
d2b3za1214 Riboflavin biosynthesis protein RibD {Bacillus sub 98.01
>d1kmva_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Dihydrofolate reductase-like
superfamily: Dihydrofolate reductase-like
family: Dihydrofolate reductases
domain: Dihydrofolate reductases, eukaryotic type
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=9.4e-52  Score=347.57  Aligned_cols=180  Identities=36%  Similarity=0.623  Sum_probs=159.6

Q ss_pred             CeEEEEEeccceeecCCCccc-CChhhhhHHHHHHcCCCCCCccceEEEeccccccccCCCCCCCCCcEEEEcCcCCCCC
Q psy1579           1 MLMITVFLKVQGFFFEACQIF-YTRKDMAHFSRITKKTENSNRVNAVIMGRKTWDSIPEKFRPLPGRYNVVLTRNSDLGS   79 (258)
Q Consensus         1 ~~~I~a~~~~~giG~~g~lPW-~l~~Dm~~F~~iT~~~~~~~~~naVIMGRKTweSip~~~rPL~~R~nvVlSr~~~~~~   79 (258)
                      |.+|+|+++++|||.+|+||| ++|+||+||+++|++.+.+++.|+||||||||||||.+.||||+|.||||||+...  
T Consensus         4 ~~~IvA~~~n~~IG~~g~LPW~~~~~D~~~Fk~~T~~~~~~~~~~~vIMGrkT~eSlp~~~~pLp~R~niVlSr~~~~--   81 (186)
T d1kmva_           4 LNCIVAVSQNMGIGKNGDLPWPPLRNEFRYFQRMTTTSSVEGKQNLVIMGKKTWFSIPEKNRPLKGRINLVLSRELKE--   81 (186)
T ss_dssp             EEEEEEECTTCEEEBTTBCSSCCCHHHHHHHHHHHHCCSSTTCEEEEEEEHHHHHHSCGGGCSCTTSEEEEECSSCSS--
T ss_pred             EEEEEEECCCCcccCCCcCCCCCCHHHHHHHHHHhCCCCCCCCceEEEEeecccccccccCcccCCceEEEEeccccc--
Confidence            469999999999999999999 79999999999999988888999999999999999998899999999999999864  


Q ss_pred             CCCCCcEEEeCCHHHHHHHHHhhccCCCCCcEEEEeChhhhcccccccccccCCcccccchhhhcccCCccchhhhhhhH
Q psy1579          80 QLTGPNVTTTSSLDQAIDLLRHKKSKGEIENVWVIGGSSIYKLTEPLMNRLSTFPKKKGLILLCTRKSNASFMFSVLSLQ  159 (258)
Q Consensus        80 ~~~~~~v~v~~sl~~ai~~l~~~~~~~~~~~I~ViGGa~iy~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~l~~~  159 (258)
                       ....++.++.|+++|++.+.........++||||||++||+                                      
T Consensus        82 -~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~i~IiGG~~iY~--------------------------------------  122 (186)
T d1kmva_          82 -PPQGAHFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYK--------------------------------------  122 (186)
T ss_dssp             -CCTTCSEEESSHHHHHHHHTSTTTTTTEEEEEECCCHHHHH--------------------------------------
T ss_pred             -ccccceeeccCHHHHHHHhhhHhhccCCCeEEEEccHHHHH--------------------------------------
Confidence             23445778899999999987643334557899999999999                                      


Q ss_pred             hhhCCCcccEEEEEeecccccccccCCCCC-CCcEEEec-CCCCCCCcccCCccEEEEEEEEcC
Q psy1579         160 ESLNSPYCDKVYVTQIHHHFDCDTFFPSLS-DKFQLIKD-PNIPDDVQKENDLNFQFKVFQKEL  221 (258)
Q Consensus       160 ~~l~~p~~D~i~lT~I~~~fe~DtfFP~l~-~~f~li~~-~~i~~~~~een~~~f~f~~y~r~~  221 (258)
                      ++|++++||+||+|+|+..|+||+|||.++ ++|++++. ..+..+.++++++.|+|++|+|+.
T Consensus       123 ~~L~~~~~~~i~lT~I~~~~~~D~ffP~id~~~~~~~~~~~~~~~~~~~~~~~~y~F~~y~r~~  186 (186)
T d1kmva_         123 EAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND  186 (186)
T ss_dssp             HHHTSCSCEEEEEEEESSCCCCSEECCCCCTTTCEECSCCTTCCCSCEEETTEEEEEEEEEEC-
T ss_pred             HHHhcCcccEEEEEEEcceeCCCEECCCCChHHcEEEEEecccccCCcccCCCcEEEEEEEECc
Confidence            999999999999999999999999999998 88999876 344455678899999999999973
>d2fzia1 c.71.1.1 (A:1-206) Dihydrofolate reductases, eukaryotic type {Fungus (Pneumocystis carinii) [TaxId: 4754]} Back     information, alignment and structure
>d1aoea_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1seja1 c.71.1.1 (A:3-180) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Cryptosporidium hominis [TaxId: 237895]} Back     information, alignment and structure
>d3dfra_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1df7a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ra9a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j3ka_ c.71.1.1 (A:) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1vdra_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Haloferax volcanii [TaxId: 2246]} Back     information, alignment and structure
>d1juva_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1d1ga_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2azna1 c.71.1.2 (A:6-224) HTP reductase {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hxva1 c.71.1.2 (A:148-345) Riboflavin biosynthesis protein RibD {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b3za1 c.71.1.2 (A:146-359) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure