Psyllid ID: psy15805

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150
MNRQVDSTCPPGLQVLFYFNCFLLAMQEDSIEGILATFTQCGLISKAAGGIGLNVHNIRATGNDLKKISKFEEPSKKDPSLNPFIRECGIYVSAPVSTYLLNPILFLITPCPPLTLRPRSILRTHSVQWSQTKMDAAYKGSGREVHIGLY
ccccccccccccccccccccEEEEccccccHHHHHHHHHHHHHHHcccccEEEEEEccccccccccccccccccccccccHHHHHHHHcccccccEEEEEEccEEEEEccccccccccccccccccccccccccccccccccEEEEEEcc
ccccccccccccccHHHHHHHHHEEcccccHHHHHHHHHHHHHHHHcccccEEEEEEEEccccEEEccccccccccccccccHHHHHccEEEEccHcHHHHcHHHHEccccccccccccHHHcccccEEccccccHHccccccEEEEEcc
mnrqvdstcppglqvLFYFNCFLLAMQEDSIEGILATFTQcgliskaaggiglnvhniratgndlkkiskfeepskkdpslnpfirecgiyvsapvstyllnpilflitpcppltlrprsilrthsvqwsQTKMDaaykgsgrevhigly
mnrqvdstcppglQVLFYFNCFLLAMQEDSIEGILATFTQCGLISKAAGGIGLNVHNIRATGNDLKKISKfeepskkdpslnpFIRECGIYVSAPVSTYLLNPILFLITPCPPLTLRPRSILRthsvqwsqtkmdaaykgsgREVHIGLY
MNRQVDSTCPPGLQVLFYFNCFLLAMQEDSIEGILATFTQCGLISKAAGGIGLNVHNIRATGNDLKKISKFEEPSKKDPSLNPFIRECGIYVSAPVSTYLLNPILFLITPCPPLTLRPRSILRTHSVQWSQTKMDAAYKGSGREVHIGLY
*********PPGLQVLFYFNCFLLAMQEDSIEGILATFTQCGLISKAAGGIGLNVHNIRATGND*****************NPFIRECGIYVSAPVSTYLLNPILFLITPCPPLTLRPRSILRTHSVQWSQ*******************
*********PPGLQVLFYFNCFLLAMQEDSIEGILATFTQCGLISKAAGGIGLNVHNIRATGNDLKKISKFEEPSKKDPSLNPFIRECGIYVSAPVSTYLLNPILFLITPCPPLTLRPRSILRTHSVQWSQTKM*****GSGR*VHIGLY
********CPPGLQVLFYFNCFLLAMQEDSIEGILATFTQCGLISKAAGGIGLNVHNIRATGNDLKKISKFEEPSKKDPSLNPFIRECGIYVSAPVSTYLLNPILFLITPCPPLTLRPRSILRTHSVQWSQTKMDAAYKGSGREVHIGLY
**********PGLQVLFYFNCFLLAMQEDSIEGILATFTQCGLISKAAGGIGLNVHNIRATGNDLKKISKFEEPSKKDPSLNPFIRECGIYVSAPVSTYLLNPILFLITPCPPLTLRPRSILRTHSVQWSQTKMDAAYKGSGREVHIGLY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNRQVDSTCPPGLQVLFYFNCFLLAMQEDSIEGILATFTQCGLISKAAGGIGLNVHNIRATGNDLKKISKFEEPSKKDPSLNPFIRECGIYVSAPVSTYLLNPILFLITPCPPLTLRPRSILRTHSVQWSQTKMDAAYKGSGREVHIGLY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query150 2.2.26 [Sep-21-2011]
P21524 888 Ribonucleoside-diphosphat yes N/A 0.293 0.049 0.681 3e-12
Q03604 788 Ribonucleoside-diphosphat yes N/A 0.34 0.064 0.625 4e-12
P36602 811 Ribonucleoside-diphosphat yes N/A 0.293 0.054 0.636 2e-11
O15909 838 Ribonucleoside-diphosphat N/A N/A 0.293 0.052 0.636 3e-11
Q9SJ20 816 Ribonucleoside-diphosphat yes N/A 0.313 0.057 0.595 3e-11
Q9UW15 929 Ribonucleoside-diphosphat N/A N/A 0.293 0.047 0.659 5e-11
P21672 869 Ribonucleoside-diphosphat no N/A 0.293 0.050 0.590 1e-10
P48591 812 Ribonucleoside-diphosphat yes N/A 0.306 0.056 0.630 2e-10
P79732 794 Ribonucleoside-diphosphat yes N/A 0.286 0.054 0.697 3e-10
Q5R919 792 Ribonucleoside-diphosphat yes N/A 0.293 0.055 0.659 6e-10
>sp|P21524|RIR1_YEAST Ribonucleoside-diphosphate reductase large chain 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNR1 PE=1 SV=2 Back     alignment and function desciption
 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 38/44 (86%)

Query: 20  NCFLLAMQEDSIEGILATFTQCGLISKAAGGIGLNVHNIRATGN 63
           +CFL+AM+EDSIEGI  T  +C LISK AGGIGL++HNIR+TG+
Sbjct: 217 SCFLVAMKEDSIEGIYDTLKECALISKTAGGIGLHIHNIRSTGS 260
Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides.
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (taxid: 559292)
EC: 1EC: .EC: 1EC: 7EC: .EC: 4EC: .EC: 1
>sp|Q03604|RIR1_CAEEL Ribonucleoside-diphosphate reductase large subunit OS=Caenorhabditis elegans GN=rnr-1 PE=3 SV=1 Back     alignment and function description
>sp|P36602|RIR1_SCHPO Ribonucleoside-diphosphate reductase large chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc22 PE=1 SV=2 Back     alignment and function description
>sp|O15909|RIR1_TRYBB Ribonucleoside-diphosphate reductase large subunit OS=Trypanosoma brucei brucei GN=RNR1 PE=2 SV=1 Back     alignment and function description
>sp|Q9SJ20|RIR1_ARATH Ribonucleoside-diphosphate reductase large subunit OS=Arabidopsis thaliana GN=RNR1 PE=1 SV=1 Back     alignment and function description
>sp|Q9UW15|RIR1_NEUCR Ribonucleoside-diphosphate reductase large chain OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rnr-1 PE=1 SV=2 Back     alignment and function description
>sp|P21672|RIR3_YEAST Ribonucleoside-diphosphate reductase large chain 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNR3 PE=1 SV=4 Back     alignment and function description
>sp|P48591|RIR1_DROME Ribonucleoside-diphosphate reductase large subunit OS=Drosophila melanogaster GN=RnrL PE=1 SV=2 Back     alignment and function description
>sp|P79732|RIR1_DANRE Ribonucleoside-diphosphate reductase large subunit OS=Danio rerio GN=rrm1 PE=2 SV=1 Back     alignment and function description
>sp|Q5R919|RIR1_PONAB Ribonucleoside-diphosphate reductase large subunit OS=Pongo abelii GN=RRM1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query150
163801386 752 hypothetical protein 1103602000598_AND4_ 0.286 0.057 0.744 4e-11
340059001 799 putative ribonucleoside-diphosphate redu 0.313 0.058 0.680 4e-11
324506544 790 Ribonucleoside-diphosphate reductase lar 0.333 0.063 0.68 5e-11
269963258 752 conserved hypothetical protein [Vibrio h 0.286 0.057 0.744 8e-11
444425041 752 ribonucleoside-diphosphate reductase sub 0.286 0.057 0.744 8e-11
424032642 752 ribonucleoside-diphosphate reductase, al 0.286 0.057 0.744 8e-11
350532635 752 ribonucleoside-diphosphate reductase, al 0.286 0.057 0.744 8e-11
424046201 752 ribonucleoside-diphosphate reductase, al 0.286 0.057 0.744 8e-11
269105097 647 ribonucleotide reductase of class Ia (ae 0.286 0.066 0.744 9e-11
269105082 729 ribonucleoside-diphosphate reductase alp 0.286 0.058 0.744 9e-11
>gi|163801386|ref|ZP_02195285.1| hypothetical protein 1103602000598_AND4_10974 [Vibrio sp. AND4] gi|159174875|gb|EDP59675.1| hypothetical protein AND4_10974 [Vibrio sp. AND4] Back     alignment and taxonomy information
 Score = 72.8 bits (177), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%)

Query: 20  NCFLLAMQEDSIEGILATFTQCGLISKAAGGIGLNVHNIRATG 62
           +CFLLAMQEDSI+GI  T   C LISK+AGGIGL++HNIRATG
Sbjct: 204 SCFLLAMQEDSIDGIYDTLKDCALISKSAGGIGLHIHNIRATG 246

Source: Vibrio sp. AND4

Species: Vibrio sp. AND4

Genus: Vibrio

Family: Vibrionaceae

Order: Vibrionales

Class: Gammaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria
>gi|340059001|emb|CCC53372.1| putative ribonucleoside-diphosphate reductase large chain [Trypanosoma vivax Y486] Back     alignment and taxonomy information
>gi|324506544|gb|ADY42792.1| Ribonucleoside-diphosphate reductase large subunit, partial [Ascaris suum] Back     alignment and taxonomy information
>gi|269963258|ref|ZP_06177591.1| conserved hypothetical protein [Vibrio harveyi 1DA3] gi|269832006|gb|EEZ86132.1| conserved hypothetical protein [Vibrio harveyi 1DA3] Back     alignment and taxonomy information
>gi|444425041|ref|ZP_21220489.1| ribonucleoside-diphosphate reductase subunit alpha [Vibrio campbellii CAIM 519 = NBRC 15631] gi|444241651|gb|ELU53172.1| ribonucleoside-diphosphate reductase subunit alpha [Vibrio campbellii CAIM 519 = NBRC 15631] Back     alignment and taxonomy information
>gi|424032642|ref|ZP_17772059.1| ribonucleoside-diphosphate reductase, alpha subunit [Vibrio cholerae HENC-01] gi|408875700|gb|EKM14844.1| ribonucleoside-diphosphate reductase, alpha subunit [Vibrio cholerae HENC-01] Back     alignment and taxonomy information
>gi|350532635|ref|ZP_08911576.1| ribonucleoside-diphosphate reductase, alpha subunit [Vibrio rotiferianus DAT722] Back     alignment and taxonomy information
>gi|424046201|ref|ZP_17783764.1| ribonucleoside-diphosphate reductase, alpha subunit [Vibrio cholerae HENC-03] gi|408885458|gb|EKM24175.1| ribonucleoside-diphosphate reductase, alpha subunit [Vibrio cholerae HENC-03] Back     alignment and taxonomy information
>gi|269105097|ref|ZP_06157792.1| ribonucleotide reductase of class Ia (aerobic) alpha subunit [Photobacterium damselae subsp. damselae CIP 102761] gi|268160732|gb|EEZ39230.1| ribonucleotide reductase of class Ia (aerobic) alpha subunit [Photobacterium damselae subsp. damselae CIP 102761] Back     alignment and taxonomy information
>gi|269105082|ref|ZP_06157777.1| ribonucleoside-diphosphate reductase alpha subunit [Photobacterium damselae subsp. damselae CIP 102761] gi|268160717|gb|EEZ39215.1| ribonucleoside-diphosphate reductase alpha subunit [Photobacterium damselae subsp. damselae CIP 102761] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query150
TAIR|locus:2052469 816 RNR1 "ribonucleotide reductase 0.313 0.057 0.595 8.7e-12
UNIPROTKB|O15909 838 RNR1 "Ribonucleoside-diphospha 0.293 0.052 0.636 1.9e-11
SGD|S000000872 888 RNR1 "Major isoform of large s 0.293 0.049 0.681 6.2e-11
WB|WBGene00004391 788 rnr-1 [Caenorhabditis elegans 0.34 0.064 0.625 6.7e-11
UNIPROTKB|Q03604 788 rnr-1 "Ribonucleoside-diphosph 0.34 0.064 0.625 6.7e-11
CGD|CAL0001524 854 RNR1 [Candida albicans (taxid: 0.286 0.050 0.697 9.6e-11
UNIPROTKB|Q5A0N3 854 RNR1 "Ribonucleoside-diphospha 0.286 0.050 0.697 9.6e-11
POMBASE|SPAC1F7.05 811 cdc22 "ribonucleoside reductas 0.293 0.054 0.636 1.9e-10
UNIPROTKB|H0YCY7130 RRM1 "Ribonucleoside-diphospha 0.293 0.338 0.659 3.2e-10
UNIPROTKB|I3LEK6135 I3LEK6 "Ribonucleoside-diphosp 0.293 0.325 0.659 3.2e-10
TAIR|locus:2052469 RNR1 "ribonucleotide reductase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 158 (60.7 bits), Expect = 8.7e-12, Sum P(2) = 8.7e-12
 Identities = 28/47 (59%), Positives = 40/47 (85%)

Query:    20 NCFLLAMQEDSIEGILATFTQCGLISKAAGGIGLNVHNIRATGNDLK 66
             +CFL+ M++DSIEGI  T  +C +ISK+AGGIG++VHNIRATG+ ++
Sbjct:   217 SCFLVCMKDDSIEGIYETLKECAVISKSAGGIGVSVHNIRATGSYIR 263
GO:0004748 "ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0005971 "ribonucleoside-diphosphate reductase complex" evidence=IEA;ISS
GO:0006260 "DNA replication" evidence=IEA;ISS;IMP
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0009202 "deoxyribonucleoside triphosphate biosynthetic process" evidence=IMP
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0006261 "DNA-dependent DNA replication" evidence=RCA
GO:0007010 "cytoskeleton organization" evidence=RCA
GO:0009165 "nucleotide biosynthetic process" evidence=RCA
GO:0010498 "proteasomal protein catabolic process" evidence=RCA
UNIPROTKB|O15909 RNR1 "Ribonucleoside-diphosphate reductase large subunit" [Trypanosoma brucei brucei (taxid:5702)] Back     alignment and assigned GO terms
SGD|S000000872 RNR1 "Major isoform of large subunit of ribonucleotide-diphosphate reductase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
WB|WBGene00004391 rnr-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q03604 rnr-1 "Ribonucleoside-diphosphate reductase large subunit" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
CGD|CAL0001524 RNR1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5A0N3 RNR1 "Ribonucleoside-diphosphate reductase" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
POMBASE|SPAC1F7.05 cdc22 "ribonucleoside reductase large subunit Cdc22" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|H0YCY7 RRM1 "Ribonucleoside-diphosphate reductase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LEK6 I3LEK6 "Ribonucleoside-diphosphate reductase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
PLN02437 813 PLN02437, PLN02437, ribonucleoside--diphosphate re 6e-18
pfam02867 516 pfam02867, Ribonuc_red_lgC, Ribonucleotide reducta 1e-15
cd01679 460 cd01679, RNR_I, Class I ribonucleotide reductase 9e-15
TIGR02506 617 TIGR02506, NrdE_NrdA, ribonucleoside-diphosphate r 9e-10
PRK06539 822 PRK06539, PRK06539, ribonucleotide-diphosphate red 6e-06
cd02888 464 cd02888, RNR_II_dimer, Class II ribonucleotide red 2e-05
TIGR02504 589 TIGR02504, NrdJ_Z, ribonucleoside-diphosphate redu 2e-05
PRK08447 789 PRK08447, PRK08447, ribonucleotide-diphosphate red 0.001
TIGR04170 698 TIGR04170, RNR_1b_NrdE, ribonucleoside-diphosphate 0.002
PRK09102 601 PRK09102, PRK09102, ribonucleotide-diphosphate red 0.002
PRK09209 761 PRK09209, PRK09209, ribonucleotide-diphosphate red 0.003
>gnl|CDD|178056 PLN02437, PLN02437, ribonucleoside--diphosphate reductase large subunit Back     alignment and domain information 
 Score = 79.0 bits (195), Expect = 6e-18
 Identities = 29/42 (69%), Positives = 36/42 (85%)

Query: 21  CFLLAMQEDSIEGILATFTQCGLISKAAGGIGLNVHNIRATG 62
           CFL+ M++DSIEGI  T  +C +ISK+AGGIGL+VHNIRATG
Sbjct: 218 CFLICMKDDSIEGIYDTLKECAVISKSAGGIGLSVHNIRATG 259

Length = 813
>gnl|CDD|217257 pfam02867, Ribonuc_red_lgC, Ribonucleotide reductase, barrel domain Back     alignment and domain information
>gnl|CDD|153088 cd01679, RNR_I, Class I ribonucleotide reductase Back     alignment and domain information
>gnl|CDD|233902 TIGR02506, NrdE_NrdA, ribonucleoside-diphosphate reductase, alpha subunit Back     alignment and domain information
>gnl|CDD|180610 PRK06539, PRK06539, ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|153089 cd02888, RNR_II_dimer, Class II ribonucleotide reductase, dimeric form Back     alignment and domain information
>gnl|CDD|233900 TIGR02504, NrdJ_Z, ribonucleoside-diphosphate reductase, adenosylcobalamin-dependent Back     alignment and domain information
>gnl|CDD|236266 PRK08447, PRK08447, ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|211905 TIGR04170, RNR_1b_NrdE, ribonucleoside-diphosphate reductase, class 1b, alpha subunit Back     alignment and domain information
>gnl|CDD|236378 PRK09102, PRK09102, ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|181700 PRK09209, PRK09209, ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 150
KOG1112|consensus 796 99.96
PRK09209 761 ribonucleotide-diphosphate reductase subunit alpha 99.96
PRK07187 721 ribonucleotide-diphosphate reductase subunit alpha 99.96
PRK06539 822 ribonucleotide-diphosphate reductase subunit alpha 99.96
PRK07207 965 ribonucleotide-diphosphate reductase subunit alpha 99.95
PRK12365 1046 ribonucleotide-diphosphate reductase subunit alpha 99.95
PRK08447 789 ribonucleotide-diphosphate reductase subunit alpha 99.95
PRK12364 842 ribonucleotide-diphosphate reductase subunit alpha 99.95
PRK07088 764 ribonucleotide-diphosphate reductase subunit alpha 99.95
PLN02437 813 ribonucleoside--diphosphate reductase large subuni 99.95
PRK07632 699 ribonucleotide-diphosphate reductase subunit alpha 99.95
PRK09103 758 ribonucleotide-diphosphate reductase subunit alpha 99.94
PRK07306 720 ribonucleotide-diphosphate reductase subunit alpha 99.94
PRK08188 714 ribonucleotide-diphosphate reductase subunit alpha 99.94
PHA02572 753 nrdA ribonucleoside-diphosphate reductase subunit 99.94
PRK06406 771 ribonucleotide-diphosphate reductase subunit alpha 99.93
PRK08665 752 ribonucleotide-diphosphate reductase subunit alpha 99.93
TIGR02506 617 NrdE_NrdA ribonucleoside-diphosphate reductase, al 99.93
PRK09102 601 ribonucleotide-diphosphate reductase subunit alpha 99.93
PRK06948 595 ribonucleotide reductase-like protein; Provisional 99.93
cd02888 464 RNR_II_dimer Class II ribonucleotide reductase, di 99.93
cd01679 460 RNR_I Class I ribonucleotide reductase. Ribonucleo 99.93
PRK08115 858 ribonucleotide-diphosphate reductase subunit alpha 99.93
TIGR02510 571 NrdE-prime ribonucleoside-diphosphate reductase, a 99.93
TIGR02504 586 NrdJ_Z ribonucleoside-diphosphate reductase, adeno 99.92
PRK06556 953 vitamin B12-dependent ribonucleotide reductase; Va 99.91
PRK07562 1220 ribonucleotide-diphosphate reductase subunit alpha 99.88
PF02867 538 Ribonuc_red_lgC: Ribonucleotide reductase, barrel 99.86
PRK08332 1740 ribonucleotide-diphosphate reductase subunit alpha 99.22
COG0209 651 NrdA Ribonucleotide reductase, alpha subunit [Nucl 99.05
PRK08332 1740 ribonucleotide-diphosphate reductase subunit alpha 99.0
cd01676 658 RNR_II_monomer Class II ribonucleotide reductase, 98.47
cd00576 401 RNR_PFL Ribonucleotide reductase and Pyruvate form 98.42
TIGR02505 713 RTPR ribonucleoside-triphosphate reductase, adenos 98.38
>KOG1112|consensus Back     alignment and domain information 
Probab=99.96  E-value=1.8e-30  Score=237.39  Aligned_cols=106  Identities=42%  Similarity=0.577  Sum_probs=101.8

Q ss_pred             ccccccCCCCCCCccceEeeecCcCCHHHHHHHHHHHHHHhhhcCeeeeecCCccCCCCccccCCCCCCCCCCCCCcchH
Q psy15805          5 VDSTCPPGLQVLFYFNCFLLAMQEDSIEGILATFTQCGLISKAAGGIGLNVHNIRATGNDLKKISKFEEPSKKDPSLNPF   84 (150)
Q Consensus         5 ~~~l~NAGT~~~qLSSCFll~v~dDSLegI~dtl~e~A~IsK~GGGVGid~S~IRpkGS~Irgt~G~Ss~~g~~~G~VpF   84 (150)
                      +-.||||||+++||||||++.|+|||||||||++++||+|+|.+||||+++++||++||+|+||||.|+      |+||+
T Consensus       202 sPTLfnagt~rPQlsSCFL~tmk~DSIeGiydtlkqcA~IsKsaGGIGl~vh~IRatGs~i~gTnGtSN------GliPm  275 (796)
T KOG1112|consen  202 SPTLFNAGTPRPQLSSCFLLTMKDDSIEGIYDTLKQCAMISKSAGGIGLNVHNIRATGSYIAGTNGTSN------GLIPM  275 (796)
T ss_pred             CchhhhcCCCCccccceEEEEecccchHHHHHHHHHhhhhhhccCcceEEEeeeeccCcEEecCCCCCC------Cccch
Confidence            446899999999999999999999999999999999999999999999999999999999999999999      99999


Q ss_pred             HHHhhhhhhcc----------eeeecccceEEEeecCCCCCcCCC
Q psy15805         85 IRECGIYVSAP----------VSTYLLNPILFLITPCPPLTLRPR  119 (150)
Q Consensus        85 lk~~d~~vsa~----------~s~~~~~~~~~~~~~~~~~~~~~~  119 (150)
                      +|+|+.+..-+          .+.| |||||..|--|  |+||.|
T Consensus       276 irV~NntaRYvdQGg~kRpGafAiy-LEPWHadifdF--lelrKn  317 (796)
T KOG1112|consen  276 IRVFNNTARYVDQGGNKRPGAFAIY-LEPWHADIFDF--LELRKN  317 (796)
T ss_pred             hhhhcchhhHhhcCCCCCCceeEEE-echhHHHHHHH--HHHHhc
Confidence            99999998876          7889 99999999999  999987

>PRK09209 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PRK07187 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PRK06539 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PRK07207 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PRK12365 ribonucleotide-diphosphate reductase subunit alpha; Provisional Back     alignment and domain information
>PRK08447 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PRK12364 ribonucleotide-diphosphate reductase subunit alpha; Provisional Back     alignment and domain information
>PRK07088 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PLN02437 ribonucleoside--diphosphate reductase large subunit Back     alignment and domain information
>PRK07632 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PRK09103 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PRK07306 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PRK08188 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PHA02572 nrdA ribonucleoside-diphosphate reductase subunit alpha; Provisional Back     alignment and domain information
>PRK06406 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PRK08665 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>TIGR02506 NrdE_NrdA ribonucleoside-diphosphate reductase, alpha subunit Back     alignment and domain information
>PRK09102 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PRK06948 ribonucleotide reductase-like protein; Provisional Back     alignment and domain information
>cd02888 RNR_II_dimer Class II ribonucleotide reductase, dimeric form Back     alignment and domain information
>cd01679 RNR_I Class I ribonucleotide reductase Back     alignment and domain information
>PRK08115 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>TIGR02510 NrdE-prime ribonucleoside-diphosphate reductase, alpha chain Back     alignment and domain information
>TIGR02504 NrdJ_Z ribonucleoside-diphosphate reductase, adenosylcobalamin-dependent Back     alignment and domain information
>PRK06556 vitamin B12-dependent ribonucleotide reductase; Validated Back     alignment and domain information
>PRK07562 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PF02867 Ribonuc_red_lgC: Ribonucleotide reductase, barrel domain; InterPro: IPR000788 Ribonucleotide reductase (1 Back     alignment and domain information
>PRK08332 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>COG0209 NrdA Ribonucleotide reductase, alpha subunit [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08332 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>cd01676 RNR_II_monomer Class II ribonucleotide reductase, monomeric form Back     alignment and domain information
>cd00576 RNR_PFL Ribonucleotide reductase and Pyruvate formate lyase Back     alignment and domain information
>TIGR02505 RTPR ribonucleoside-triphosphate reductase, adenosylcobalamin-dependent Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
3tb9_A 888 Structure Of Yeast Ribonucleotide Reductase 1 Q288a 3e-13
1zyz_A 888 Structures Of Yeast Ribonucloetide Reductase I Leng 3e-13
3s8a_A 888 Structure Of Yeast Ribonucleotide Reductase R293a W 3e-13
3hnc_A 792 Crystal Structure Of Human Ribonucleotide Reductase 6e-11
2wgh_A 676 Human Ribonucleotide Reductase R1 Subunit (Rrm1) In 6e-11
>pdb|3TB9|A Chain A, Structure Of Yeast Ribonucleotide Reductase 1 Q288a With Amppnp And Cdp Length = 888 Back     alignment and structure 
Iteration: 1

 Score = 70.5 bits (171), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 38/44 (86%)
Query: 20  NCFLLAMQEDSIEGILATFTQCGLISKAAGGIGLNVHNIRATGN 63
           +CFL+AM+EDSIEGI  T  +C LISK AGGIGL++HNIR+TG+
Sbjct: 217 SCFLVAMKEDSIEGIYDTLKECALISKTAGGIGLHIHNIRSTGS 260
>pdb|1ZYZ|A Chain A, Structures Of Yeast Ribonucloetide Reductase I Length = 888 Back     alignment and structure
>pdb|3S8A|A Chain A, Structure Of Yeast Ribonucleotide Reductase R293a With Dgtp Length = 888 Back     alignment and structure
>pdb|3HNC|A Chain A, Crystal Structure Of Human Ribonucleotide Reductase 1 Bound To The Effector Ttp Length = 792 Back     alignment and structure
>pdb|2WGH|A Chain A, Human Ribonucleotide Reductase R1 Subunit (Rrm1) In Complex With Datp And Mg. Length = 676 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
3k8t_A 888 Ribonucleoside-diphosphate reductase large chain; 3e-18
3hnc_A 792 Ribonucleoside-diphosphate reductase large subuni; 1e-17
3o0q_A 644 Ribonucleoside-diphosphate reductase; alpha/beta b 1e-16
2wgh_A 676 Ribonucleoside-diphosphate reductase large subunit 3e-16
1peq_A 714 Ribonucleoside-diphosphate reductase 2 alpha chain 1e-15
2xap_A 761 Ribonucleoside-diphosphate reductase 1 subunit alp 6e-15
>3k8t_A Ribonucleoside-diphosphate reductase large chain; eukaryotic ribonucleotide reductase, nucleotide analogs, all enzyme ATP-binding; HET: DGT 2A5; 2.10A {Saccharomyces cerevisiae} PDB: 1zyz_A 2cvs_A 2cvt_A* 2cvu_A* 2cvv_A* 1zzd_A* 2cvw_A* 2cvy_A* 2eud_A* 2zlf_A 2zlg_A* 2cvx_A* 3paw_A 3s87_A* 3s8b_A* 3s8c_A* 3s8a_A* 3tb9_A* 3tba_A* Length = 888 Back     alignment and structure
 Score = 79.2 bits (195), Expect = 3e-18
 Identities = 30/46 (65%), Positives = 38/46 (82%)

Query: 21  CFLLAMQEDSIEGILATFTQCGLISKAAGGIGLNVHNIRATGNDLK 66
           CFL+AM+EDSIEGI  T  +C LISK AGGIGL++HNIR+TG+ + 
Sbjct: 218 CFLVAMKEDSIEGIYDTLKECALISKTAGGIGLHIHNIRSTGSYIA 263
>3hnc_A Ribonucleoside-diphosphate reductase large subuni; oxidoreductase, ribonucleotide reductase, allosteric enzyme, binding, DNA replication; HET: TTP; 2.41A {Homo sapiens} PDB: 3hnd_A* 3hne_A* 3hnf_A* Length = 792 Back     alignment and structure
>3o0q_A Ribonucleoside-diphosphate reductase; alpha/beta barrel, adenosylcobalamin dependent, ribonucle reductase; HET: TTP GDP ADN; 1.80A {Thermotoga maritima} PDB: 1xjf_A* 1xjg_A* 1xje_A* 1xjk_A* 1xjm_A* 1xjn_A* 3o0n_A* 3o0o_A* 1xjj_A* Length = 644 Back     alignment and structure
>2wgh_A Ribonucleoside-diphosphate reductase large subunit; DNA replication, allosteric enzyme, nucleotide-binding, cytoplasm, ATP-binding, polymorphism; HET: DTP; 2.30A {Homo sapiens} Length = 676 Back     alignment and structure
>1peq_A Ribonucleoside-diphosphate reductase 2 alpha chain; stranded alpha/beta barrel, protein-specificity-effector complex, DTTP; HET: TTP; 2.80A {Salmonella typhimurium} SCOP: a.98.1.1 c.7.1.2 PDB: 1peo_A* 1pem_A* 1peu_A* 2bq1_E* Length = 714 Back     alignment and structure
>2xap_A Ribonucleoside-diphosphate reductase 1 subunit alpha; oxidoreductase, DNA replication, allosteric enzyme, nucleotide-binding; HET: NIY; 2.10A {Escherichia coli} PDB: 2xo5_A* 2x0x_A 2r1r_A 3r1r_A* 3uus_A* 1r1r_A 2xav_A* 7r1r_A 2xax_A* 6r1r_A 2xaw_A* 5r1r_A 2xo4_A* 2xak_A* 4r1r_A* 2xaz_A* 2xay_A* 1rlr_A 1qfn_B Length = 761 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query150
3hnc_A 792 Ribonucleoside-diphosphate reductase large subuni; 99.96
3k8t_A 888 Ribonucleoside-diphosphate reductase large chain; 99.95
2wgh_A 676 Ribonucleoside-diphosphate reductase large subunit 99.95
3o0q_A 644 Ribonucleoside-diphosphate reductase; alpha/beta b 99.95
1peq_A 714 Ribonucleoside-diphosphate reductase 2 alpha chain 99.94
2xap_A 761 Ribonucleoside-diphosphate reductase 1 subunit alp 99.94
1l1l_A 739 Ribonucleoside triphosphate reductase; 10-stranded 99.74
>3hnc_A Ribonucleoside-diphosphate reductase large subuni; oxidoreductase, ribonucleotide reductase, allosteric enzyme, binding, DNA replication; HET: TTP; 2.41A {Homo sapiens} PDB: 3hnd_A* 3hne_A* 3hnf_A* Back     alignment and structure
Probab=99.96  E-value=8.8e-30  Score=238.08  Aligned_cols=114  Identities=35%  Similarity=0.515  Sum_probs=101.9

Q ss_pred             ccccCCCCCCCccceEeeecCcCCHHHHHHHHHHHHHHhhhcCeeeeecCCccCCCCccccCCCCCCCCCCCCCcchHHH
Q psy15805          7 STCPPGLQVLFYFNCFLLAMQEDSIEGILATFTQCGLISKAAGGIGLNVHNIRATGNDLKKISKFEEPSKKDPSLNPFIR   86 (150)
Q Consensus         7 ~l~NAGT~~~qLSSCFll~v~dDSLegI~dtl~e~A~IsK~GGGVGid~S~IRpkGS~Irgt~G~Ss~~g~~~G~VpFlk   86 (150)
                      -|+||||+++|||||||+++++||++|||++++++|+++|+|||||+|||+|||+|++|+|++|+|+      |+|||||
T Consensus       204 tl~NaGt~~~qlsSCFl~~v~~Dsl~~I~~~~~~~a~isk~GGGiG~~~s~iR~~Gs~I~g~~g~ss------G~vpfmk  277 (792)
T 3hnc_A          204 TLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRATGSYIAGTNGNSN------GLVPMLR  277 (792)
T ss_dssp             HHHHTTSSSCCCCCEEEEECCCSSHHHHHHHHHHHHHHHHTTCEEEEECTTSCCTTCEETTTTEECC------CSHHHHH
T ss_pred             hhhcCCCCCCCCCceeccCCCCccHHHHHHHHHHHHHHHHhCCCceEeeeccCCCCCcccCCCCCCC------CchhHHH
Confidence            4899999999999999999988999999999999999999999999999999999999999999999      9999999


Q ss_pred             Hhhhhhhcc----------eeeecccceEEEeecCCCCCcCCC---ccceeecccc
Q psy15805         87 ECGIYVSAP----------VSTYLLNPILFLITPCPPLTLRPR---SILRTHSVQW  129 (150)
Q Consensus        87 ~~d~~vsa~----------~s~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~  129 (150)
                      +||+++.++          ..+| |++||-.|+.|  |++|.+   .-.|+|.++-
T Consensus       278 ~~d~~~~~v~QgG~~R~GA~~vy-L~~wHpDI~eF--l~~K~~~g~e~~r~~~l~~  330 (792)
T 3hnc_A          278 VYNNTARYVDQGGNKRPGAFAIY-LEPWHLDIFEF--LDLKKNTGKEEQRARDLFF  330 (792)
T ss_dssp             HHHHHHHHCCCC------CEEEE-ECTTBTTHHHH--TTSCC---------CCEEE
T ss_pred             HHHHHHHHHHhCCCccccceEEE-ecCCCccHHHH--HHHhhccCcHhHhHhhCch
Confidence            999999998          5578 99999999999  999986   3356665443
>3k8t_A Ribonucleoside-diphosphate reductase large chain; eukaryotic ribonucleotide reductase, nucleotide analogs, all enzyme ATP-binding; HET: DGT 2A5; 2.10A {Saccharomyces cerevisiae} PDB: 1zyz_A 2cvs_A 2cvt_A* 2cvu_A* 2cvv_A* 1zzd_A* 2cvw_A* 2cvy_A* 2eud_A* 2zlf_A 2zlg_A* 2cvx_A* 3paw_A 3rsr_A* 3s87_A* 3s8b_A* 3s8c_A* 3s8a_A* 3tb9_A* 3tba_A* Back     alignment and structure
>2wgh_A Ribonucleoside-diphosphate reductase large subunit; DNA replication, allosteric enzyme, nucleotide-binding, cytoplasm, ATP-binding, polymorphism; HET: DTP; 2.30A {Homo sapiens} Back     alignment and structure
>3o0q_A Ribonucleoside-diphosphate reductase; alpha/beta barrel, adenosylcobalamin dependent, ribonucle reductase; HET: TTP GDP ADN; 1.80A {Thermotoga maritima} PDB: 1xjf_A* 1xjg_A* 1xje_A* 1xjm_A* 1xjn_A* 3o0n_A* 3o0o_A* 1xjj_A* 1xjk_A* Back     alignment and structure
>1peq_A Ribonucleoside-diphosphate reductase 2 alpha chain; stranded alpha/beta barrel, protein-specificity-effector complex, DTTP; HET: TTP; 2.80A {Salmonella typhimurium} SCOP: a.98.1.1 c.7.1.2 PDB: 1peo_A* 1pem_A* 1peu_A* 2bq1_E* Back     alignment and structure
>2xap_A Ribonucleoside-diphosphate reductase 1 subunit alpha; oxidoreductase, DNA replication, allosteric enzyme, nucleotide-binding; HET: NIY; 2.10A {Escherichia coli} PDB: 2xo5_A* 2x0x_A 2r1r_A 3r1r_A* 3uus_A* 1r1r_A 2xav_A* 7r1r_A 2xax_A* 6r1r_A 2xaw_A* 5r1r_A 2xo4_A* 2xak_A* 4r1r_A* 2xaz_A* 2xay_A* 1rlr_A 1qfn_B Back     alignment and structure
>1l1l_A Ribonucleoside triphosphate reductase; 10-stranded alpha-beta barrel, central finger loop, oxidoreductase; 1.75A {Lactobacillus leichmannii} SCOP: c.7.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 150
d1rlra2 525 c.7.1.2 (A:222-748) R1 subunit of ribonucleotide r 4e-14
d1peqa2 525 c.7.1.2 (A:175-699) R1 subunit of ribonucleotide r 8e-14
>d1rlra2 c.7.1.2 (A:222-748) R1 subunit of ribonucleotide reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 525 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PFL-like glycyl radical enzymes
superfamily: PFL-like glycyl radical enzymes
family: R1 subunit of ribonucleotide reductase, C-terminal domain
domain: R1 subunit of ribonucleotide reductase, C-terminal domain
species: Escherichia coli [TaxId: 562]

 Score = 66.1 bits (160), Expect = 4e-14
 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 18 YFNCFLLAMQEDSIEGILATFTQCGLISKAAGGIGLNVHNIRATGNDLK 66
          + +C L+    DS++ I AT +          GIG+N   IRA G+ ++
Sbjct: 1  FSSCVLIEC-GDSLDSINATSSAIVKYVSQRAGIGINAGRIRALGSPIR 48
>d1peqa2 c.7.1.2 (A:175-699) R1 subunit of ribonucleotide reductase, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 525 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query150
d1peqa2 525 R1 subunit of ribonucleotide reductase, C-terminal 99.91
d1rlra2 525 R1 subunit of ribonucleotide reductase, C-terminal 99.9
d1l1la_ 721 B12-dependent (class II) ribonucleotide reductase 99.25
>d1peqa2 c.7.1.2 (A:175-699) R1 subunit of ribonucleotide reductase, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PFL-like glycyl radical enzymes
superfamily: PFL-like glycyl radical enzymes
family: R1 subunit of ribonucleotide reductase, C-terminal domain
domain: R1 subunit of ribonucleotide reductase, C-terminal domain
species: Salmonella typhimurium [TaxId: 90371]

Probab=99.91  E-value=9.2e-26  Score=194.96  Aligned_cols=92  Identities=25%  Similarity=0.371  Sum_probs=87.7

Q ss_pred             ccceEeeecCcCCHHHHHHHHHHHHHHhhhcCeeeeecCCccCCCCccccCCCCCCCCCCCCCcchHHHHhhhhhhcc--
Q psy15805         18 YFNCFLLAMQEDSIEGILATFTQCGLISKAAGGIGLNVHNIRATGNDLKKISKFEEPSKKDPSLNPFIRECGIYVSAP--   95 (150)
Q Consensus        18 LSSCFll~v~dDSLegI~dtl~e~A~IsK~GGGVGid~S~IRpkGS~Irgt~G~Ss~~g~~~G~VpFlk~~d~~vsa~--   95 (150)
                      |+||||+++ +||+++|+++++++|+++|+|||||+|||+|||+|++|++++|+|+      |+|||||+||+++.++  
T Consensus         1 L~sCfv~~v-~Ds~~~I~~~~~~~a~~~k~ggGiG~~~s~lR~~G~~i~~~~g~ss------G~v~f~~~~d~~~~~v~q   73 (525)
T d1peqa2           1 LVSCFLLRI-EDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSS------GVIPVMKMLEDAFSYANQ   73 (525)
T ss_dssp             SCCCEEECC-CSSHHHHHHHHHHHHHHHTTTCEEEEECTTSCCTTCCBTTBSSCCC------CSHHHHHHHHHHHHHC--
T ss_pred             CceeecCCC-CCCHHHHHHHHHHHHHHHhcCCeEEeeccCcCCCCCccCCCCCccC------ChhhHHHHHHHHHHHHhc
Confidence            789999999 9999999999999999999999999999999999999999999999      9999999999999998  


Q ss_pred             -------eeeecccceEEEeecCCCCCcCCC
Q psy15805         96 -------VSTYLLNPILFLITPCPPLTLRPR  119 (150)
Q Consensus        96 -------~s~~~~~~~~~~~~~~~~~~~~~~  119 (150)
                             ...| |++||-.|+.|  |++|.+
T Consensus        74 gg~Rrga~~~~-l~~~HpDI~~F--i~~K~~  101 (525)
T d1peqa2          74 LGARQGAGAVY-LHAHHPDILRF--LDTKRE  101 (525)
T ss_dssp             ----CCEEEEE-EETTSTTHHHH--HGGGC-
T ss_pred             CCcccccEEEE-EcCCcccHHHH--HHhCcc
Confidence                   5667 89999999999  999876
>d1rlra2 c.7.1.2 (A:222-748) R1 subunit of ribonucleotide reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l1la_ c.7.1.4 (A:) B12-dependent (class II) ribonucleotide reductase {Lactobacillus leichmannii [TaxId: 28039]} Back     information, alignment and structure