Psyllid ID: psy15923


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------
MDNQNGVLMIIANYTGDVLNFGIACEKVKAQGHAIEMVTVGEDCALLNTGRISLAGRRGMCGIVFVIK
cccccEEEEEEcccHHHHHcHHHHHHHHHHccccEEEEEEcccccccccccccccccccccEEEEEEc
cccccEEEEEEEccccccccHHHHHHHHHHccccEEEEEEcccEEEccccccEEccccEEEEEEEEEc
MDNQNGVLMIIANYTGDVLNFGIACEKVKAQGHAIEMVTVGEDcallntgrislagrrgmcGIVFVIK
MDNQNGVLMIIANYTGDVLNFGIACEKVKAQGHAIEMVTVGEDCALLNTgrislagrrgmcGIVFVIK
MDNQNGVLMIIANYTGDVLNFGIACEKVKAQGHAIEMVTVGEDCALLNTGRISLAGRRGMCGIVFVIK
*****GVLMIIANYTGDVLNFGIACEKVKAQGHAIEMVTVGEDCALLNTGRISLAGRRGMCGIVFVI*
**NQNGVLMIIANYTGDVLNFGIACEKVKAQGHAIEMVTVGEDCALLNTG***LAGRRGMCGIVFVIK
MDNQNGVLMIIANYTGDVLNFGIACEKVKAQGHAIEMVTVGEDCALLNTGRISLAGRRGMCGIVFVIK
***QNGVLMIIANYTGDVLNFGIACEKVKAQGHAIEMVTVGEDCALLNTGRISLAGRRGMCGIVFVIK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDNQNGVLMIIANYTGDVLNFGIACEKVKAQGHAIEMVTVGEDCALLNTGRISLAGRRGMCGIVFVIK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query68 2.2.26 [Sep-21-2011]
O04059 594 Putative 3,4-dihydroxy-2- N/A N/A 0.897 0.102 0.539 8e-12
Q58DK4 578 Bifunctional ATP-dependen yes N/A 0.882 0.103 0.507 1e-10
Q3LXA3 575 Bifunctional ATP-dependen yes N/A 0.882 0.104 0.492 2e-10
F1RKQ4 579 Bifunctional ATP-dependen yes N/A 0.882 0.103 0.507 3e-10
Q8VC30 578 Bifunctional ATP-dependen yes N/A 0.882 0.103 0.507 3e-10
Q4KLZ6 578 Bifunctional ATP-dependen yes N/A 0.882 0.103 0.476 8e-10
P43550 591 Dihydroxyacetone kinase 2 yes N/A 0.985 0.113 0.426 1e-09
O74215 591 Dihydroxyacetone kinase 2 yes N/A 0.911 0.104 0.460 2e-09
O74192 608 Dihydroxyacetone kinase O yes N/A 0.955 0.106 0.424 9e-09
O60017 609 Dihydroxyacetone kinase O N/A N/A 0.955 0.106 0.393 2e-08
>sp|O04059|DHBK_SOLLC Putative 3,4-dihydroxy-2-butanone kinase OS=Solanum lycopersicum GN=DHBK PE=2 SV=1 Back     alignment and function desciption
 Score = 68.9 bits (167), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 34/63 (53%), Positives = 45/63 (71%), Gaps = 2/63 (3%)

Query: 6   GVLMIIANYTGDVLNFGIACEKVKAQGHAIEMVTVGEDCALLNTGRISLAGRRGMCGIVF 65
           G L+I+ NYTGD LNFG+A E+ K++G+ +EMV VG+DCAL     I  AGRRG+ G + 
Sbjct: 107 GCLLIVKNYTGDRLNFGLAAEQAKSEGYKVEMVIVGDDCALPPPRGI--AGRRGLAGTLL 164

Query: 66  VIK 68
           V K
Sbjct: 165 VHK 167





Solanum lycopersicum (taxid: 4081)
EC: 2EC: .EC: 7EC: .EC: 1EC: .EC: -
>sp|Q58DK4|DHAK_BOVIN Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing) OS=Bos taurus GN=DAK PE=2 SV=1 Back     alignment and function description
>sp|Q3LXA3|DHAK_HUMAN Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing) OS=Homo sapiens GN=DAK PE=1 SV=2 Back     alignment and function description
>sp|F1RKQ4|DHAK_PIG Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing) OS=Sus scrofa GN=DAK PE=1 SV=2 Back     alignment and function description
>sp|Q8VC30|DHAK_MOUSE Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing) OS=Mus musculus GN=Dak PE=2 SV=1 Back     alignment and function description
>sp|Q4KLZ6|DHAK_RAT Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing) OS=Rattus norvegicus GN=Dak PE=1 SV=1 Back     alignment and function description
>sp|P43550|DAK2_YEAST Dihydroxyacetone kinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAK2 PE=1 SV=1 Back     alignment and function description
>sp|O74215|DAK2_SCHPO Dihydroxyacetone kinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dak2 PE=3 SV=2 Back     alignment and function description
>sp|O74192|DAK_PICPA Dihydroxyacetone kinase OS=Komagataella pastoris GN=DAK PE=3 SV=1 Back     alignment and function description
>sp|O60017|DAK_PICAN Dihydroxyacetone kinase OS=Pichia angusta GN=DAK PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query68
198427460 584 PREDICTED: similar to Dak protein [Ciona 0.897 0.104 0.603 3e-12
384252268 580 Dak1-domain-containing protein [Coccomyx 0.882 0.103 0.555 5e-12
348539830 580 PREDICTED: bifunctional ATP-dependent di 0.897 0.105 0.562 1e-11
405950913 588 Bifunctional ATP-dependent dihydroxyacet 0.897 0.103 0.555 2e-11
308809325 843 putative DAK2 domain containing protein 0.941 0.075 0.492 2e-11
302812050 591 hypothetical protein SELMODRAFT_158935 [ 0.897 0.103 0.571 4e-11
302802845 591 hypothetical protein SELMODRAFT_271610 [ 0.897 0.103 0.571 4e-11
328783570 598 PREDICTED: bifunctional ATP-dependent di 0.955 0.108 0.545 5e-11
340379191 551 PREDICTED: bifunctional ATP-dependent di 0.897 0.110 0.578 6e-11
115497494 576 bifunctional ATP-dependent dihydroxyacet 0.897 0.105 0.531 1e-10
>gi|198427460|ref|XP_002131279.1| PREDICTED: similar to Dak protein [Ciona intestinalis] Back     alignment and taxonomy information
 Score = 75.9 bits (185), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 46/63 (73%), Gaps = 2/63 (3%)

Query: 6   GVLMIIANYTGDVLNFGIACEKVKAQGHAIEMVTVGEDCALLNTGRISLAGRRGMCGIVF 65
           G L+I+ANYTGD LNFGIA E+ KA G  + MV VGEDCAL +  +   AGRRG+ GIV 
Sbjct: 105 GTLLIVANYTGDRLNFGIALERAKAAGKKVNMVVVGEDCALESQDKT--AGRRGLVGIVI 162

Query: 66  VIK 68
           V+K
Sbjct: 163 VMK 165




Source: Ciona intestinalis

Species: Ciona intestinalis

Genus: Ciona

Family: Cionidae

Order: Enterogona

Class: Ascidiacea

Phylum: Chordata

Superkingdom: Eukaryota

>gi|384252268|gb|EIE25744.1| Dak1-domain-containing protein [Coccomyxa subellipsoidea C-169] Back     alignment and taxonomy information
>gi|348539830|ref|XP_003457392.1| PREDICTED: bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing)-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|405950913|gb|EKC18869.1| Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing) [Crassostrea gigas] Back     alignment and taxonomy information
>gi|308809325|ref|XP_003081972.1| putative DAK2 domain containing protein (ISS) [Ostreococcus tauri] gi|116060439|emb|CAL55775.1| putative DAK2 domain containing protein (ISS), partial [Ostreococcus tauri] Back     alignment and taxonomy information
>gi|302812050|ref|XP_002987713.1| hypothetical protein SELMODRAFT_158935 [Selaginella moellendorffii] gi|300144605|gb|EFJ11288.1| hypothetical protein SELMODRAFT_158935 [Selaginella moellendorffii] Back     alignment and taxonomy information
>gi|302802845|ref|XP_002983176.1| hypothetical protein SELMODRAFT_271610 [Selaginella moellendorffii] gi|300148861|gb|EFJ15518.1| hypothetical protein SELMODRAFT_271610 [Selaginella moellendorffii] Back     alignment and taxonomy information
>gi|328783570|ref|XP_397138.4| PREDICTED: bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing)-like [Apis mellifera] Back     alignment and taxonomy information
>gi|340379191|ref|XP_003388110.1| PREDICTED: bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing)-like, partial [Amphimedon queenslandica] Back     alignment and taxonomy information
>gi|115497494|ref|NP_001070098.1| bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing) [Danio rerio] gi|115313277|gb|AAI24307.1| Zgc:153296 [Danio rerio] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query68
ZFIN|ZDB-GENE-060929-652 576 dak "dihydroxyacetone kinase 2 0.897 0.105 0.515 3.5e-12
TAIR|locus:2089784 595 AT3G17770 [Arabidopsis thalian 0.897 0.102 0.555 1.3e-11
UNIPROTKB|E9PJG8162 DAK "FAD-AMP lyase (cyclizing) 0.882 0.370 0.492 1.7e-11
TAIR|locus:2007680 593 AT1G48430 [Arabidopsis thalian 0.897 0.102 0.539 9.2e-11
UNIPROTKB|A0JN77 578 DAK "Dihydroxyacetone kinase 2 0.882 0.103 0.507 1.5e-10
UNIPROTKB|Q58DK4 578 DAK "Bifunctional ATP-dependen 0.882 0.103 0.507 1.5e-10
UNIPROTKB|F1RKQ4 579 DAK "Bifunctional ATP-dependen 0.882 0.103 0.507 1.5e-10
UNIPROTKB|H0YCY6 533 DAK "FAD-AMP lyase (cyclizing) 0.882 0.112 0.492 1.6e-10
UNIPROTKB|Q3LXA3 575 DAK "Bifunctional ATP-dependen 0.882 0.104 0.492 1.8e-10
UNIPROTKB|F1Q0K5 578 DAK "Uncharacterized protein" 0.882 0.103 0.492 2.4e-10
ZFIN|ZDB-GENE-060929-652 dak "dihydroxyacetone kinase 2 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 173 (66.0 bits), Expect = 3.5e-12, P = 3.5e-12
 Identities = 33/64 (51%), Positives = 46/64 (71%)

Query:     5 NGVLMIIANYTGDVLNFGIACEKVKAQGHAIEMVTVGEDCALLNTGRISLAGRRGMCGIV 64
             +GVL+I+ NYTGD LNFGIA E+ ++QG  +++V V +DCA     +   AGRRG+CG V
Sbjct:   103 SGVLLIVKNYTGDRLNFGIAVEQARSQGVPVDIVIVADDCAFAQPSK---AGRRGLCGTV 159

Query:    65 FVIK 68
             F+ K
Sbjct:   160 FIHK 163




GO:0004371 "glycerone kinase activity" evidence=IEA
GO:0006071 "glycerol metabolic process" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
TAIR|locus:2089784 AT3G17770 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E9PJG8 DAK "FAD-AMP lyase (cyclizing)" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2007680 AT1G48430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|A0JN77 DAK "Dihydroxyacetone kinase 2 homolog (S. cerevisiae)" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q58DK4 DAK "Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing)" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RKQ4 DAK "Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing)" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|H0YCY6 DAK "FAD-AMP lyase (cyclizing)" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q3LXA3 DAK "Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing)" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q0K5 DAK "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
F1RKQ4DHAK_PIG4, ., 6, ., 1, ., 1, 50.50790.88230.1036yesN/A
Q8VC30DHAK_MOUSE4, ., 6, ., 1, ., 1, 50.50790.88230.1038yesN/A
Q58DK4DHAK_BOVIN4, ., 6, ., 1, ., 1, 50.50790.88230.1038yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query68
TIGR02361 574 TIGR02361, dak_ATP, dihydroxyacetone kinase, ATP-d 1e-19
pfam02733 326 pfam02733, Dak1, Dak1 domain 8e-17
PRK14479 568 PRK14479, PRK14479, dihydroxyacetone kinase; Provi 5e-15
PRK14481 331 PRK14481, PRK14481, dihydroxyacetone kinase subuni 3e-14
PTZ00375 584 PTZ00375, PTZ00375, dihydroxyacetone kinase-like p 4e-14
TIGR02363 329 TIGR02363, dhaK1, dihydroxyacetone kinase, DhaK su 5e-12
PRK11468 356 PRK11468, PRK11468, dihydroxyacetone kinase subuni 8e-11
COG2376 323 COG2376, DAK1, Dihydroxyacetone kinase [Carbohydra 4e-07
PRK14483 329 PRK14483, PRK14483, DhaKLM operon coactivator DhaQ 1e-05
TIGR02362 326 TIGR02362, dhaK1b, probable dihydroxyacetone kinas 7e-04
>gnl|CDD|233835 TIGR02361, dak_ATP, dihydroxyacetone kinase, ATP-dependent Back     alignment and domain information
 Score = 80.1 bits (198), Expect = 1e-19
 Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 1/63 (1%)

Query: 6   GVLMIIANYTGDVLNFGIACEKVKAQGHAIEMVTVGEDCALLNTGRISLAGRRGMCGIVF 65
           G L+I+ NYTGD LNFG+A EK KA+G+ +EMV VG+D ++       L GRRG+ G V 
Sbjct: 97  GTLLIVKNYTGDRLNFGLAAEKAKAEGYNVEMVIVGDDVSVGRKKG-GLVGRRGLAGTVL 155

Query: 66  VIK 68
           V K
Sbjct: 156 VHK 158


This family consists of examples of the form of dihydroxyacetone kinase (also called glycerone kinase) that uses ATP (2.7.1.29) as the phosphate donor, rather than a phosphoprotein as in E. coli. This form is composed of a single chain with separable domains homologous to the K and L subunits of the E. coli enzyme, and is found in yeasts and other eukaryotes and in some bacteria, including Citrobacter freundii. The member from tomato has been shown to phosphorylate dihydroxyacetone, 3,4-dihydroxy-2-butanone, and some other aldoses and ketoses (PMID:11985845). Length = 574

>gnl|CDD|202365 pfam02733, Dak1, Dak1 domain Back     alignment and domain information
>gnl|CDD|237723 PRK14479, PRK14479, dihydroxyacetone kinase; Provisional Back     alignment and domain information
>gnl|CDD|237724 PRK14481, PRK14481, dihydroxyacetone kinase subunit DhaK; Provisional Back     alignment and domain information
>gnl|CDD|185583 PTZ00375, PTZ00375, dihydroxyacetone kinase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|233836 TIGR02363, dhaK1, dihydroxyacetone kinase, DhaK subunit Back     alignment and domain information
>gnl|CDD|183150 PRK11468, PRK11468, dihydroxyacetone kinase subunit DhaK; Provisional Back     alignment and domain information
>gnl|CDD|225251 COG2376, DAK1, Dihydroxyacetone kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|172956 PRK14483, PRK14483, DhaKLM operon coactivator DhaQ; Provisional Back     alignment and domain information
>gnl|CDD|213706 TIGR02362, dhaK1b, probable dihydroxyacetone kinase DhaK1b subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 68
TIGR02363 329 dhaK1 dihydroxyacetone kinase, DhaK subunit. Two t 99.97
TIGR02362 326 dhaK1b probable dihydroxyacetone kinase DhaK1b sub 99.97
PRK14481 331 dihydroxyacetone kinase subunit DhaK; Provisional 99.97
PRK11468 356 dihydroxyacetone kinase subunit DhaK; Provisional 99.96
PF02733 325 Dak1: Dak1 domain; InterPro: IPR004006 Dihydroxyac 99.96
PRK14483 329 DhaKLM operon coactivator DhaQ; Provisional 99.96
PRK14479 568 dihydroxyacetone kinase; Provisional 99.96
TIGR02361 574 dak_ATP dihydroxyacetone kinase, ATP-dependent. Th 99.95
PTZ00375 584 dihydroxyacetone kinase-like protein; Provisional 99.95
KOG2426|consensus 582 99.93
COG2376 323 DAK1 Dihydroxyacetone kinase [Carbohydrate transpo 99.77
TIGR03837 371 efp_adjacent_2 conserved hypothetical protein, PP_ 86.4
PF0379363 PASTA: PASTA domain; InterPro: IPR005543 The PASTA 82.72
PF10093 374 DUF2331: Uncharacterized protein conserved in bact 82.22
>TIGR02363 dhaK1 dihydroxyacetone kinase, DhaK subunit Back     alignment and domain information
Probab=99.97  E-value=8.1e-32  Score=200.19  Aligned_cols=66  Identities=45%  Similarity=0.763  Sum_probs=62.3

Q ss_pred             CCCCCeEEEEEccchhhhhcHHHHHHHHHhcCCcEEEEEecccccccCCCCCCCCCCeeeceEEEEEC
Q psy15923          1 MDNQNGVLMIIANYTGDVLNFGIACEKVKAQGHAIEMVTVGEDCALLNTGRISLAGRRGMCGIVFVIK   68 (68)
Q Consensus         1 ~~~~~GVL~iv~NYtGDvlnF~~A~e~a~~~Gi~v~~v~v~DDva~~~~~~~~~~~RRGvAG~vlv~K   68 (68)
                      +++++|||+||+|||||+|||+||+|+|+++||+|++|+|+||||+++  +++..+|||+||++||||
T Consensus        94 v~~~~GvL~iv~NYtGD~lnF~mA~E~a~~eGi~v~~V~V~DDva~~~--~~~~~~RRGlAGtv~v~K  159 (329)
T TIGR02363        94 VDQGAGVLLIVKNYTGDVMNFEMAAELAEDEGIKVATVVVDDDIAVED--SLYTAGRRGVAGTVFVHK  159 (329)
T ss_pred             ccCCCCEEEEeCCcHHHhccHHHHHHHHHHcCCcEEEEEECCcccCCC--CccCCCCcchhHHHHHHH
Confidence            468999999999999999999999999999999999999999999987  556789999999999998



Two types of dihydroxyacetone kinase (glycerone kinase) are described. In yeast and a few bacteria, e.g. Citrobacter freundii, the enzyme is a single chain that uses ATP as phosphoryl donor and is designated EC 2.7.1.29. By contract, E. coli and many other bacterial species have a multisubunit form (EC 2.7.1.-) with a phosphoprotein donor related to PTS transport proteins. This family represents the DhaK subunit of the latter type of dihydroxyacetone kinase, but it specifically excludes the DhaK paralog DhaK2 (TIGR02362) found in the same operon as DhaK and DhaK in the Firmicutes.

>TIGR02362 dhaK1b probable dihydroxyacetone kinase DhaK1b subunit Back     alignment and domain information
>PRK14481 dihydroxyacetone kinase subunit DhaK; Provisional Back     alignment and domain information
>PRK11468 dihydroxyacetone kinase subunit DhaK; Provisional Back     alignment and domain information
>PF02733 Dak1: Dak1 domain; InterPro: IPR004006 Dihydroxyacetone kinase (glycerone kinase) 2 Back     alignment and domain information
>PRK14483 DhaKLM operon coactivator DhaQ; Provisional Back     alignment and domain information
>PRK14479 dihydroxyacetone kinase; Provisional Back     alignment and domain information
>TIGR02361 dak_ATP dihydroxyacetone kinase, ATP-dependent Back     alignment and domain information
>PTZ00375 dihydroxyacetone kinase-like protein; Provisional Back     alignment and domain information
>KOG2426|consensus Back     alignment and domain information
>COG2376 DAK1 Dihydroxyacetone kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03837 efp_adjacent_2 conserved hypothetical protein, PP_1857 family Back     alignment and domain information
>PF03793 PASTA: PASTA domain; InterPro: IPR005543 The PASTA domain is found at the C-termini of several Penicillin-binding proteins (PBP) and bacterial serine/threonine kinases Back     alignment and domain information
>PF10093 DUF2331: Uncharacterized protein conserved in bacteria (DUF2331); InterPro: IPR016633 This entry describes a conserved hypothetical protein that typically is encoded next to the gene efp for translation elongation factor P Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query68
1un9_A 552 Crystal Structure Of The Dihydroxyacetone Kinase Fr 4e-08
1un8_A 552 Crystal Structure Of The Dihydroxyacetone Kinase Of 4e-08
1uoe_A 366 Crystal Structure Of The Dihydroxyacetone Kinase Fr 2e-07
1oi2_A 366 X-Ray Structure Of The Dihydroxyacetone Kinase From 2e-07
3pnk_A 357 Crystal Structure Of E.Coli Dha Kinase Dhak Length 2e-07
3pnm_A 357 Crystal Structure Of E.Coli Dha Kinase Dhak (H56a) 2e-07
3pno_A 357 Crystal Structure Of E.Coli Dha Kinase Dhak (H56n) 2e-07
3ct4_A 332 Structure Of Dha-Kinase Subunit Dhak From L. Lactis 4e-07
>pdb|1UN9|A Chain A, Crystal Structure Of The Dihydroxyacetone Kinase From C. Freundii In Complex With Amp-Pnp And Mg2+ Length = 552 Back     alignment and structure

Iteration: 1

Score = 53.1 bits (126), Expect = 4e-08, Method: Composition-based stats. Identities = 27/65 (41%), Positives = 40/65 (61%), Gaps = 5/65 (7%) Query: 4 QNGVLMIIANYTGDVLNFGIACEKVKAQGHAIEMVTVGEDCALLNTGRISLAGRRGMCGI 63 + G L+I+ NYTGD LNFG+A EK + G+ +EM+ VG+D +L + RG+ G Sbjct: 101 EAGCLLIVKNYTGDRLNFGLAAEKARRLGYNVEMLIVGDDISLPDNKH-----PRGIAGT 155 Query: 64 VFVIK 68 + V K Sbjct: 156 ILVHK 160
>pdb|1UN8|A Chain A, Crystal Structure Of The Dihydroxyacetone Kinase Of C. Freundii (Native Form) Length = 552 Back     alignment and structure
>pdb|1UOE|A Chain A, Crystal Structure Of The Dihydroxyacetone Kinase From E. Coli In Complex With Glyceraldehyde Length = 366 Back     alignment and structure
>pdb|1OI2|A Chain A, X-Ray Structure Of The Dihydroxyacetone Kinase From Escherichia Coli Length = 366 Back     alignment and structure
>pdb|3PNK|A Chain A, Crystal Structure Of E.Coli Dha Kinase Dhak Length = 357 Back     alignment and structure
>pdb|3PNM|A Chain A, Crystal Structure Of E.Coli Dha Kinase Dhak (H56a) Length = 357 Back     alignment and structure
>pdb|3PNO|A Chain A, Crystal Structure Of E.Coli Dha Kinase Dhak (H56n) Length = 357 Back     alignment and structure
>pdb|3CT4|A Chain A, Structure Of Dha-Kinase Subunit Dhak From L. Lactis Length = 332 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query68
1oi2_A 366 Hypothetical protein YCGT; kinase, dihydroxyaceton 8e-23
2iu4_A 336 DHA-DHAQ, dihydroxyacetone kinase; transferase, CO 1e-22
3ct4_A 332 PTS-dependent dihydroxyacetone kinase, dihydroxyac 1e-22
1un8_A 552 Dihydroxyacetone kinase; transferase; HET: MYY; 2. 2e-22
>1oi2_A Hypothetical protein YCGT; kinase, dihydroxyacetone kinase; 1.75A {Escherichia coli} SCOP: c.119.1.2 PDB: 1oi3_A 1uod_A* 1uoe_A 3pnl_A* 3pnk_A* 3pno_A 3pnq_A 3pnm_A Length = 366 Back     alignment and structure
 Score = 87.8 bits (218), Expect = 8e-23
 Identities = 27/67 (40%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 2   DNQNGVLMIIANYTGDVLNFGIACEKVKAQGHAIEMVTVGEDCALLNTGRISLAGRRGMC 61
           D   GVL+II NYTGD+LNF  A E +   G  +  V + +D A+ ++     AGRRG+ 
Sbjct: 104 DGGEGVLLIIKNYTGDILNFETATELLHDSGVKVTTVVIDDDVAVKDSLYT--AGRRGVA 161

Query: 62  GIVFVIK 68
             V + K
Sbjct: 162 NTVLIEK 168


>2iu4_A DHA-DHAQ, dihydroxyacetone kinase; transferase, CO-activa kinase; HET: HIQ; 1.96A {Lactococcus lactis} PDB: 2iu6_A Length = 336 Back     alignment and structure
>3ct4_A PTS-dependent dihydroxyacetone kinase, dihydroxyacetone-binding subunit DHAK; dihydroxyacetone kinase subunit, tranferase; 2.50A {Lactococcus lactis subsp} Length = 332 Back     alignment and structure
>1un8_A Dihydroxyacetone kinase; transferase; HET: MYY; 2.5A {Citrobacter freundii} SCOP: a.208.1.1 c.119.1.2 PDB: 1un9_A* Length = 552 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query68
3ct4_A 332 PTS-dependent dihydroxyacetone kinase, dihydroxyac 99.97
2iu4_A 336 DHA-DHAQ, dihydroxyacetone kinase; transferase, CO 99.97
1oi2_A 366 Hypothetical protein YCGT; kinase, dihydroxyaceton 99.96
1un8_A 552 Dihydroxyacetone kinase; transferase; HET: MYY; 2. 99.95
>3ct4_A PTS-dependent dihydroxyacetone kinase, dihydroxyacetone-binding subunit DHAK; dihydroxyacetone kinase subunit, tranferase; 2.50A {Lactococcus lactis subsp} Back     alignment and structure
Probab=99.97  E-value=4.1e-32  Score=200.98  Aligned_cols=66  Identities=42%  Similarity=0.669  Sum_probs=62.4

Q ss_pred             CCCCCeEEEEEccchhhhhcHHHHHHHHHhcCCcEEEEEecccccccCCCCCCCCCCeeeceEEEEEC
Q psy15923          1 MDNQNGVLMIIANYTGDVLNFGIACEKVKAQGHAIEMVTVGEDCALLNTGRISLAGRRGMCGIVFVIK   68 (68)
Q Consensus         1 ~~~~~GVL~iv~NYtGDvlnF~~A~e~a~~~Gi~v~~v~v~DDva~~~~~~~~~~~RRGvAG~vlv~K   68 (68)
                      +++++|||+||||||||+|||+||+|+|+++||+|++|+|+||||+++  +....+|||+||+|||||
T Consensus        95 v~~g~GvL~ivkNYtGDvlNF~mAaE~a~~eGi~v~~VvV~DDvA~~~--~~~~~gRRGvAGtvlv~K  160 (332)
T 3ct4_A           95 ADEGAGVLLIIKNYLGDVMNFEMAREMAEMEEIKVEQIIVDDDIAVEN--SLYTQGRRGVAGTVLVHK  160 (332)
T ss_dssp             HCCSSCEEEEEESCHHHHHHHHHHHHHHHHTTCCEEEEEECCBCSSSS--CTTCSSSCCCTTHHHHHH
T ss_pred             hcCCCCEEEEeCCcHHHhhcHHHHHHHHHhcCCcEEEEEeCCcccCCC--cCCCCCCCchhHHHHHHH
Confidence            378999999999999999999999999999999999999999999987  556799999999999998



>2iu4_A DHA-DHAQ, dihydroxyacetone kinase; transferase, CO-activa kinase; HET: HIQ; 1.96A {Lactococcus lactis} PDB: 2iu6_A Back     alignment and structure
>1oi2_A Hypothetical protein YCGT; kinase, dihydroxyacetone kinase; 1.75A {Escherichia coli} SCOP: c.119.1.2 PDB: 1oi3_A 1uod_A* 1uoe_A 3pnl_A* 3pnk_A* 3pno_A 3pnq_A 3pnm_A Back     alignment and structure
>1un8_A Dihydroxyacetone kinase; transferase; HET: MYY; 2.5A {Citrobacter freundii} SCOP: a.208.1.1 c.119.1.2 PDB: 1un9_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 68
d1oi2a_ 347 c.119.1.2 (A:) Dihydroxyacetone kinase subunit K, 1e-19
d1un8a4 335 c.119.1.2 (A:1-335) Dihydroxyacetone kinase {Citro 5e-14
>d1oi2a_ c.119.1.2 (A:) Dihydroxyacetone kinase subunit K, DhaK {Escherichia coli [TaxId: 562]} Length = 347 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: DAK1/DegV-like
superfamily: DAK1/DegV-like
family: DAK1
domain: Dihydroxyacetone kinase subunit K, DhaK
species: Escherichia coli [TaxId: 562]
 Score = 77.6 bits (191), Expect = 1e-19
 Identities = 27/67 (40%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 2   DNQNGVLMIIANYTGDVLNFGIACEKVKAQGHAIEMVTVGEDCALLNTGRISLAGRRGMC 61
           D   GVL+II NYTGD+LNF  A E +   G  +  V + +D A+ ++     AGRRG+ 
Sbjct: 85  DGGEGVLLIIKNYTGDILNFETATELLHDSGVKVTTVVIDDDVAVKDSLYT--AGRRGVA 142

Query: 62  GIVFVIK 68
             V + K
Sbjct: 143 NTVLIEK 149


>d1un8a4 c.119.1.2 (A:1-335) Dihydroxyacetone kinase {Citrobacter freundii [TaxId: 546]} Length = 335 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query68
d1oi2a_ 347 Dihydroxyacetone kinase subunit K, DhaK {Escherich 99.96
d1un8a4 335 Dihydroxyacetone kinase {Citrobacter freundii [Tax 99.95
>d1oi2a_ c.119.1.2 (A:) Dihydroxyacetone kinase subunit K, DhaK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: DAK1/DegV-like
superfamily: DAK1/DegV-like
family: DAK1
domain: Dihydroxyacetone kinase subunit K, DhaK
species: Escherichia coli [TaxId: 562]
Probab=99.96  E-value=3.1e-31  Score=195.29  Aligned_cols=66  Identities=41%  Similarity=0.701  Sum_probs=62.8

Q ss_pred             CCCCCeEEEEEccchhhhhcHHHHHHHHHhcCCcEEEEEecccccccCCCCCCCCCCeeeceEEEEEC
Q psy15923          1 MDNQNGVLMIIANYTGDVLNFGIACEKVKAQGHAIEMVTVGEDCALLNTGRISLAGRRGMCGIVFVIK   68 (68)
Q Consensus         1 ~~~~~GVL~iv~NYtGDvlnF~~A~e~a~~~Gi~v~~v~v~DDva~~~~~~~~~~~RRGvAG~vlv~K   68 (68)
                      +++++|||+||+|||||+|||+||+|+|+++||+|++|+|+||||+++  +....+|||+||+|||||
T Consensus        84 v~~~~GvLliv~NYtGDvlNF~mA~E~a~~egi~v~~vvv~DDva~~~--~~~~~gRRG~AGtvlv~K  149 (347)
T d1oi2a_          84 VDGGEGVLLIIKNYTGDILNFETATELLHDSGVKVTTVVIDDDVAVKD--SLYTAGRRGVANTVLIEK  149 (347)
T ss_dssp             HCCSSCEEEEEESSHHHHHHHHHHHHHHHHTTCCEEEEEECCBCSCBS--CTTCSSBCCCTHHHHHHH
T ss_pred             hcCCCCEEEEeccchhhhccHHHHHHHHHhcCCceEEEEeCCccccCC--ccccccCCccchHHHHHH
Confidence            368999999999999999999999999999999999999999999987  677899999999999987



>d1un8a4 c.119.1.2 (A:1-335) Dihydroxyacetone kinase {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure