Psyllid ID: psy16059

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60-------
MGVDVETLSPGDGQTYPKPGQVVVVHYTGTLTDGTKFDSSRDRGVPFKFRLGKGDVIKGWDHGIAQE
cccEEEEEEccccccccccccEEEEEEEEEcccccEEEccccccccEEEEcccccEEcccccccccc
ccEEEEEEEccccccccccccEEEEEEEEEEccccEEEEHHHccccEEEEcccccccHHHHHHHHcc
mgvdvetlspgdgqtypkpgqVVVVHYtgtltdgtkfdssrdrgvpfkfrlgkgdvikgwdhgiaqe
mgvdvetlspgdgqtypkpgqVVVVHYTGtltdgtkfdssrdrgvpfkfrlgkgdvikgwdhgiaqe
MGVDVETLSPGDGQTYPKPGQVVVVHYTGTLTDGTKFDSSRDRGVPFKFRLGKGDVIKGWDHGIAQE
*******************GQVVVVHYTGTLTDGTKFDSSRDRGVPFKFRLGKGDVIKGWDHG****
MGVDVETLSPGDGQTYPKPGQVVVVHYTGTLTDGTKFDSSRDRGVPFKFRLGKGDVIKGWDHGIAQ*
*********PGDGQTYPKPGQVVVVHYTGTLTDGTKFDSSRDRGVPFKFRLGKGDVIKGWDHGIAQE
*GVDVETLSPGDGQTYPKPGQVVVVHYTGTLTDGTKFDSSRDRGVPFKFRLGKGDVIKGWDHGIAQ*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVDVETLSPGDGQTYPKPGQVVVVHYTGTLTDGTKFDSSRDRGVPFKFRLGKGDVIKGWDHGIAQE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query67 2.2.26 [Sep-21-2011]
P26883108 Peptidyl-prolyl cis-trans yes N/A 0.985 0.611 0.712 9e-22
P62943108 Peptidyl-prolyl cis-trans yes N/A 0.985 0.611 0.712 9e-22
P62942108 Peptidyl-prolyl cis-trans yes N/A 0.985 0.611 0.712 9e-22
P97534108 Peptidyl-prolyl cis-trans yes N/A 0.985 0.611 0.681 9e-22
Q9Z2I2108 Peptidyl-prolyl cis-trans no N/A 0.985 0.611 0.681 1e-21
P18203108 Peptidyl-prolyl cis-trans no N/A 0.985 0.611 0.712 1e-21
P48375108 12 kDa FK506-binding prot yes N/A 0.985 0.611 0.727 1e-21
P68106108 Peptidyl-prolyl cis-trans no N/A 0.985 0.611 0.681 2e-21
P68107108 Peptidyl-prolyl cis-trans no N/A 0.985 0.611 0.681 2e-21
Q8HYX6108 Peptidyl-prolyl cis-trans no N/A 0.985 0.611 0.681 2e-21
>sp|P26883|FKB1A_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Mus musculus GN=Fkbp1a PE=1 SV=2 Back     alignment and function desciption
 Score =  102 bits (253), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 54/66 (81%)

Query: 1  MGVDVETLSPGDGQTYPKPGQVVVVHYTGTLTDGTKFDSSRDRGVPFKFRLGKGDVIKGW 60
          MGV VET+SPGDG+T+PK GQ  VVHYTG L DG KFDSSRDR  PFKF LGK +VI+GW
Sbjct: 1  MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFTLGKQEVIRGW 60

Query: 61 DHGIAQ 66
          + G+AQ
Sbjct: 61 EEGVAQ 66
Keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand. Recruites SMAD7 to ACVR1B which prevents the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. May modulate the RYR1 calcium channel activity. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Mus musculus (taxid: 10090)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|P62943|FKB1A_RABIT Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Oryctolagus cuniculus GN=FKBP1A PE=1 SV=2 Back     alignment and function description
>sp|P62942|FKB1A_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens GN=FKBP1A PE=1 SV=2 Back     alignment and function description
>sp|P97534|FKB1B_RAT Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Rattus norvegicus GN=Fkbp1b PE=1 SV=3 Back     alignment and function description
>sp|Q9Z2I2|FKB1B_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Mus musculus GN=Fkbp1b PE=1 SV=3 Back     alignment and function description
>sp|P18203|FKB1A_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Bos taurus GN=FKBP1A PE=1 SV=2 Back     alignment and function description
>sp|P48375|FKB12_DROME 12 kDa FK506-binding protein OS=Drosophila melanogaster GN=FK506-bp2 PE=3 SV=2 Back     alignment and function description
>sp|P68106|FKB1B_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Homo sapiens GN=FKBP1B PE=1 SV=2 Back     alignment and function description
>sp|P68107|FKB1B_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Bos taurus GN=FKBP1B PE=1 SV=2 Back     alignment and function description
>sp|Q8HYX6|FKB1B_RABIT Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Oryctolagus cuniculus GN=FKBP1B PE=3 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query67
110671506109 putative FK506-binding protein [Diaphori 0.985 0.605 1.0 3e-30
340728889105 PREDICTED: peptidyl-prolyl cis-trans iso 0.985 0.628 0.833 8e-25
307187120111 12 kDa FK506-binding protein [Camponotus 0.985 0.594 0.833 9e-25
350420195105 PREDICTED: peptidyl-prolyl cis-trans iso 0.985 0.628 0.818 1e-24
156555217108 PREDICTED: peptidyl-prolyl cis-trans iso 0.985 0.611 0.818 2e-24
38001136796 PREDICTED: 12 kDa FK506-binding protein- 0.985 0.687 0.833 2e-24
91086693108 PREDICTED: similar to FK506-binding prot 0.985 0.611 0.818 2e-24
32879290688 PREDICTED: peptidyl-prolyl cis-trans iso 0.985 0.75 0.818 3e-24
332020342111 12 kDa FK506-binding protein [Acromyrmex 0.985 0.594 0.803 5e-24
114052971108 FK506-binding protein [Bombyx mori] gi|9 0.985 0.611 0.818 5e-24
>gi|110671506|gb|ABG82004.1| putative FK506-binding protein [Diaphorina citri] Back     alignment and taxonomy information
 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 66/66 (100%), Positives = 66/66 (100%)

Query: 1  MGVDVETLSPGDGQTYPKPGQVVVVHYTGTLTDGTKFDSSRDRGVPFKFRLGKGDVIKGW 60
          MGVDVETLSPGDGQTYPKPGQVVVVHYTGTLTDGTKFDSSRDRGVPFKFRLGKGDVIKGW
Sbjct: 1  MGVDVETLSPGDGQTYPKPGQVVVVHYTGTLTDGTKFDSSRDRGVPFKFRLGKGDVIKGW 60

Query: 61 DHGIAQ 66
          DHGIAQ
Sbjct: 61 DHGIAQ 66

Source: Diaphorina citri

Species: Diaphorina citri

Genus: Diaphorina

Family: Psyllidae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|340728889|ref|XP_003402745.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP1A-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307187120|gb|EFN72364.1| 12 kDa FK506-binding protein [Camponotus floridanus] Back     alignment and taxonomy information
>gi|350420195|ref|XP_003492430.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP1A-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|156555217|ref|XP_001599935.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP1B-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|380011367|ref|XP_003689779.1| PREDICTED: 12 kDa FK506-binding protein-like [Apis florea] Back     alignment and taxonomy information
>gi|91086693|ref|XP_969563.1| PREDICTED: similar to FK506-binding protein-like protein [Tribolium castaneum] gi|270010405|gb|EFA06853.1| hypothetical protein TcasGA2_TC009796 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328792906|ref|XP_624498.2| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP1A [Apis mellifera] Back     alignment and taxonomy information
>gi|332020342|gb|EGI60764.1| 12 kDa FK506-binding protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|114052971|ref|NP_001040498.1| FK506-binding protein [Bombyx mori] gi|95103142|gb|ABF51512.1| FK506-binding protein [Bombyx mori] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query67
UNIPROTKB|A8HUK0108 FKB12 "Peptidyl-prolyl cis-tra 0.985 0.611 0.757 6.8e-24
ZFIN|ZDB-GENE-030131-7275108 fkbp1aa "FK506 binding protein 0.985 0.611 0.712 8.7e-24
FB|FBgn0013954108 FK506-bp2 "FK506-binding prote 0.985 0.611 0.727 2.9e-23
UNIPROTKB|Q2NKS8108 LOC526524 "Peptidyl-prolyl cis 0.985 0.611 0.742 1e-22
UNIPROTKB|P62942108 FKBP1A "Peptidyl-prolyl cis-tr 0.985 0.611 0.712 2.1e-22
UNIPROTKB|P62943108 FKBP1A "Peptidyl-prolyl cis-tr 0.985 0.611 0.712 2.1e-22
MGI|MGI:95541108 Fkbp1a "FK506 binding protein 0.985 0.611 0.712 2.1e-22
UNIPROTKB|P18203108 FKBP1A "Peptidyl-prolyl cis-tr 0.985 0.611 0.712 3.4e-22
UNIPROTKB|Q2VTP6108 LOC654323 "Peptidyl-prolyl cis 0.985 0.611 0.712 3.4e-22
ZFIN|ZDB-GENE-040927-9108 fkbp1ab "FK506 binding protein 0.985 0.611 0.651 3.4e-22
UNIPROTKB|A8HUK0 FKB12 "Peptidyl-prolyl cis-trans isomerase" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
 Score = 274 (101.5 bits), Expect = 6.8e-24, P = 6.8e-24
 Identities = 50/66 (75%), Positives = 54/66 (81%)

Query:     1 MGVDVETLSPGDGQTYPKPGQVVVVHYTGTLTDGTKFDSSRDRGVPFKFRLGKGDVIKGW 60
             MGVDV T  PGDG ++PK GQ V VHYTGTLTDG KFDSSRDRG PF FRLG G+VIKGW
Sbjct:     1 MGVDVATTRPGDGVSFPKTGQTVFVHYTGTLTDGKKFDSSRDRGEPFSFRLGMGEVIKGW 60

Query:    61 DHGIAQ 66
             D G+AQ
Sbjct:    61 DEGVAQ 66
GO:0000413 "protein peptidyl-prolyl isomerization" evidence=ISS
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS
GO:0005528 "FK506 binding" evidence=ISS
GO:0016020 "membrane" evidence=ISS
GO:0018208 "peptidyl-proline modification" evidence=ISS
ZFIN|ZDB-GENE-030131-7275 fkbp1aa "FK506 binding protein 1Aa" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0013954 FK506-bp2 "FK506-binding protein 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q2NKS8 LOC526524 "Peptidyl-prolyl cis-trans isomerase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P62942 FKBP1A "Peptidyl-prolyl cis-trans isomerase FKBP1A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P62943 FKBP1A "Peptidyl-prolyl cis-trans isomerase FKBP1A" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
MGI|MGI:95541 Fkbp1a "FK506 binding protein 1a" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P18203 FKBP1A "Peptidyl-prolyl cis-trans isomerase FKBP1A" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q2VTP6 LOC654323 "Peptidyl-prolyl cis-trans isomerase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040927-9 fkbp1ab "FK506 binding protein 1Ab" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6CF41FKBP_YARLI5, ., 2, ., 1, ., 80.63630.98500.6111yesN/A
P97534FKB1B_RAT5, ., 2, ., 1, ., 80.68180.98500.6111yesN/A
O42993FKBP_SCHPO5, ., 2, ., 1, ., 80.54540.98500.5892yesN/A
P48375FKB12_DROME5, ., 2, ., 1, ., 80.72720.98500.6111yesN/A
Q6CX30FKBP_KLULA5, ., 2, ., 1, ., 80.57810.95520.5614yesN/A
P26883FKB1A_MOUSE5, ., 2, ., 1, ., 80.71210.98500.6111yesN/A
P62943FKB1A_RABIT5, ., 2, ., 1, ., 80.71210.98500.6111yesN/A
P62942FKB1A_HUMAN5, ., 2, ., 1, ., 80.71210.98500.6111yesN/A
P20081FKBP_YEAST5, ., 2, ., 1, ., 80.59370.95520.5614yesN/A
P18203FKB1A_BOVIN5, ., 2, ., 1, ., 80.71210.98500.6111noN/A
Q754K8FKBP_ASHGO5, ., 2, ., 1, ., 80.57810.95520.5614yesN/A
Q554J3FKBP1_DICDI5, ., 2, ., 1, ., 80.56060.97010.6074yesN/A
Q4WLV6FKB1A_ASPFU5, ., 2, ., 1, ., 80.59090.98500.5892yesN/A
Q38931FKB62_ARATH5, ., 2, ., 1, ., 80.63490.91040.1107yesN/A
Q6FMA3FKBP_CANGA5, ., 2, ., 1, ., 80.61530.97010.5701yesN/A
Q6KBA8FKB1A_EMENI5, ., 2, ., 1, ., 80.62120.98500.6111yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.921
4th Layer5.2.1.80.914

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query67
COG0545205 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans 9e-22
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 8e-21
PRK10902269 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis- 3e-12
PRK11570206 PRK11570, PRK11570, peptidyl-prolyl cis-trans isom 2e-08
COG1047 174 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans 4e-07
PRK15095 156 PRK15095, PRK15095, FKBP-type peptidyl-prolyl cis- 2e-05
>gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score = 82.8 bits (205), Expect = 9e-22
 Identities = 36/65 (55%), Positives = 40/65 (61%), Gaps = 3/65 (4%)

Query: 2   GVDVETLSPGDGQTYPKPGQVVVVHYTGTLTDGTKFDSSRDRGVPFKFRLGKGDVIKGWD 61
           G+  + L  GDG   PK G  V VHYTGTL DGT FDSS DRG P +F LG   VI GWD
Sbjct: 102 GLQYKVLKAGDGAA-PKKGDTVTVHYTGTLIDGTVFDSSYDRGQPAEFPLGG--VIPGWD 158

Query: 62  HGIAQ 66
            G+  
Sbjct: 159 EGLQG 163

Length = 205
>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information
>gnl|CDD|236791 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|183207 PRK11570, PRK11570, peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|223976 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237908 PRK15095, PRK15095, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 67
KOG0544|consensus108 99.87
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.79
KOG0549|consensus188 99.72
PRK11570206 peptidyl-prolyl cis-trans isomerase; Provisional 99.71
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.64
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding mot 99.6
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 99.54
KOG0552|consensus226 99.49
PRK15095 156 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.47
COG1047 174 SlpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.35
PRK10737 196 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.28
KOG0543|consensus 397 99.18
KOG0543|consensus 397 98.55
COG0544 441 Tig FKBP-type peptidyl-prolyl cis-trans isomerase 98.44
TIGR00115 408 tig trigger factor. Trigger factor is a ribosome-a 98.31
PRK01490 435 tig trigger factor; Provisional 98.3
KOG0545|consensus 329 98.18
PHA0212265 hypothetical protein 81.98
>KOG0544|consensus Back     alignment and domain information 
Probab=99.87  E-value=1e-21  Score=102.75  Aligned_cols=66  Identities=73%  Similarity=1.325  Sum_probs=63.4

Q ss_pred             CCeEEEEEecCCCccCCCCCCEEEEEEEEEeCCCCEEeccCCCCccEEEEeCCCCccHHHHHhhcC
Q psy16059          1 MGVDVETLSPGDGQTYPKPGQVVVVHYTGTLTDGTKFDSSRDRGVPFKFRLGKGDVIKGWDHGIAQ   66 (67)
Q Consensus         1 ~Gv~~~~~~~g~g~~~~~~gd~V~v~y~~~~~dg~~~~~s~~~~~p~~~~lG~~~~~~g~e~~l~~   66 (67)
                      ||+.++++.+|+|...|..|++|++||++.+.||+.||||.+++.|+.|.+|.+++|+||+|++.+
T Consensus         1 mGv~~~~i~~Gdg~tfpK~Gqtvt~hYtg~L~dG~kfDSs~dr~kPfkf~IGkgeVIkGwdegv~q   66 (108)
T KOG0544|consen    1 MGVEKQVISPGDGRTFPKKGQTVTVHYTGTLQDGKKFDSSRDRGKPFKFKIGKGEVIKGWDEGVAQ   66 (108)
T ss_pred             CCceeEEeeCCCCcccCCCCCEEEEEEEeEecCCcEeecccccCCCeeEEecCcceeechhhcchh
Confidence            899999999999988899999999999999999999999999999999999999999999999864

>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0549|consensus Back     alignment and domain information
>PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>KOG0552|consensus Back     alignment and domain information
>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00115 tig trigger factor Back     alignment and domain information
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information
>KOG0545|consensus Back     alignment and domain information
>PHA02122 hypothetical protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query67
3h9r_B109 Crystal Structure Of The Kinase Domain Of Type I Ac 7e-23
1tco_C107 Ternary Complex Of A Calcineurin A Fragment, Calcin 2e-22
2fap_A107 The Structure Of The Immunophilin-Immunosuppressant 3e-22
1fkk_A107 Atomic Structure Of Fkbp12, An Immunophilin Binding 5e-22
2ppp_A107 Crystal Structure Of E60q Mutant Of Fkbp12 Length = 6e-22
2ppo_A107 Crystal Structure Of E60a Mutant Of Fkbp12 Length = 8e-22
1bkf_A107 Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX 8e-22
1c9h_A107 Crystal Structure Of Fkbp12.6 In Complex With Rapam 9e-22
1fkb_A107 Atomic Structure Of The Rapamycin Human Immunophili 1e-21
1eym_A107 Fk506 Binding Protein Mutant, Homodimeric Complex L 1e-21
1bl4_A107 Fkbp Mutant F36v Complexed With Remodeled Synthetic 2e-21
2dg4_A107 Fk506-Binding Protein Mutant Wf59 Complexed With Ra 3e-21
3uqi_A108 Crystallographic Structure Of Fkbp12 From Aedes Aeg 3e-21
2dg9_A107 Fk506-Binding Protein Mutant Wl59 Complexed With Ra 5e-21
1yat_A113 Improved Calcineurin Inhibition By Yeast Fkbp12-Dru 6e-17
2lgo_A130 Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prol 4e-16
1r9h_A135 Structural Genomics Of C.Elegans: Fkbp-Type Peptidy 9e-14
3uqa_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 2e-13
3jym_A 377 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 2e-13
3jxv_A 356 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 2e-13
3uf8_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 2e-13
4dz3_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 3e-13
3vaw_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 3e-13
4ggq_C209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 3e-13
4dz2_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 4e-13
2y78_A133 Crystal Structure Of Bpss1823, A Mip-Like Chaperone 5e-13
2ke0_A117 Solution Structure Of Peptidyl-Prolyl Cis-Trans Iso 5e-13
1kt0_A 457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 6e-13
3o5e_A144 Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 1e-12
4drh_A144 Co-crystal Structure Of The Ppiase Domain Of Fkbp51 1e-12
3o5g_A128 Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 2e-12
3o5l_A128 Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Le 2e-12
3uqb_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 2e-12
2ki3_A126 Structural And Biochemical Characterization Of Fk50 2e-12
1kt1_A 457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 2e-12
3o5d_A 264 Crystal Structure Of A Fragment Of Fkbp51 Comprisin 4e-12
1n1a_A140 Crystal Structure Of The N-Terminal Domain Of Human 1e-11
4drj_A144 O-crystal Structure Of The Ppiase Domain Of Fkbp52, 1e-11
1q1c_A 280 Crystal Structure Of N(1-260) Of Human Fkbp52 Lengt 1e-11
1rot_A149 Structure Of Fkbp59-I, The N-Terminal Domain Of A 5 3e-11
2vn1_A129 Crystal Structure Of The Fk506-Binding Domain Of Pl 3e-10
2ofn_A135 Solution Structure Of Fk506-Binding Domain (Fkbd)of 3e-10
1u79_A129 Crystal Structure Of Atfkbp13 Length = 129 4e-10
2pbc_A102 Fk506-Binding Protein 2 Length = 102 1e-09
1pbk_A116 Homologous Domain Of Human Fkbp25 Length = 116 4e-08
1jvw_A167 Trypanosoma Cruzi Macrophage Infectivity Potentiato 4e-08
3kz7_A119 C-Terminal Domain Of Murine Fkbp25 Rapamycin Comple 6e-08
1q6u_A245 Crystal Structure Of Fkpa From Escherichia Coli Len 8e-07
1q6h_A224 Crystal Structure Of A Truncated Form Of Fkpa From 8e-07
1fd9_A213 Crystal Structure Of The Macrophage Infectivity Pot 2e-04
2uz5_A137 Solution Structure Of The Fkbp-Domain Of Legionella 3e-04
4dt4_A169 Crystal Structure Of The Ppiase-Chaperone Slpa With 9e-04
>pdb|3H9R|B Chain B, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 109 Back     alignment and structure 
Iteration: 1

 Score =  102 bits (253), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 54/66 (81%)
Query: 1  MGVDVETLSPGDGQTYPKPGQVVVVHYTGTLTDGTKFDSSRDRGVPFKFRLGKGDVIKGW 60
          MGV VET+SPGDG+T+PK GQ  VVHYTG L DG KFDSSRDR  PFKF LGK +VI+GW
Sbjct: 2  MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW 61
Query: 61 DHGIAQ 66
          + G+AQ
Sbjct: 62 EEGVAQ 67
>pdb|1TCO|C Chain C, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 107 Back     alignment and structure
>pdb|2FAP|A Chain A, The Structure Of The Immunophilin-Immunosuppressant Fkbp12- (C16)-Ethoxy Rapamycin Complex Interacting With Huma Length = 107 Back     alignment and structure
>pdb|1FKK|A Chain A, Atomic Structure Of Fkbp12, An Immunophilin Binding Protein Length = 107 Back     alignment and structure
>pdb|2PPP|A Chain A, Crystal Structure Of E60q Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|2PPO|A Chain A, Crystal Structure Of E60a Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|1BKF|A Chain A, Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX WITH Immunosuppressant Fk506 Length = 107 Back     alignment and structure
>pdb|1C9H|A Chain A, Crystal Structure Of Fkbp12.6 In Complex With Rapamycin Length = 107 Back     alignment and structure
>pdb|1FKB|A Chain A, Atomic Structure Of The Rapamycin Human Immunophilin Fkbp- 12 Complex Length = 107 Back     alignment and structure
>pdb|1EYM|A Chain A, Fk506 Binding Protein Mutant, Homodimeric Complex Length = 107 Back     alignment and structure
>pdb|1BL4|A Chain A, Fkbp Mutant F36v Complexed With Remodeled Synthetic Ligand Length = 107 Back     alignment and structure
>pdb|2DG4|A Chain A, Fk506-Binding Protein Mutant Wf59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|3UQI|A Chain A, Crystallographic Structure Of Fkbp12 From Aedes Aegypti Length = 108 Back     alignment and structure
>pdb|2DG9|A Chain A, Fk506-Binding Protein Mutant Wl59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|1YAT|A Chain A, Improved Calcineurin Inhibition By Yeast Fkbp12-Drug Complexes. Crystallographic And Functional Analysis Length = 113 Back     alignment and structure
>pdb|2LGO|A Chain A, Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prolyl Cis-Trans Isomerase From Giardia Lamblia, Seattle Structural Genomics Center For Infectious Disease Target Gilaa.00840.A Length = 130 Back     alignment and structure
>pdb|1R9H|A Chain A, Structural Genomics Of C.Elegans: Fkbp-Type Peptidylprolyl Isomerase Length = 135 Back     alignment and structure
>pdb|3UQA|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation A54e From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|3JYM|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 377 Back     alignment and structure
>pdb|3JXV|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 356 Back     alignment and structure
>pdb|3UF8|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With A G95a Surface Mutation From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|4DZ3|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation M61h From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|3VAW|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation V3i From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|4GGQ|C Chain C, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Complexed With Cj40 Length = 209 Back     alignment and structure
>pdb|4DZ2|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation R92g From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|2Y78|A Chain A, Crystal Structure Of Bpss1823, A Mip-Like Chaperone From Burkholderia Pseudomallei Length = 133 Back     alignment and structure
>pdb|2KE0|A Chain A, Solution Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 117 Back     alignment and structure
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|3O5E|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 Back     alignment and structure
>pdb|4DRH|A Chain A, Co-crystal Structure Of The Ppiase Domain Of Fkbp51, Rapamycin And The Frb Fragment Of Mtor At Low Ph Length = 144 Back     alignment and structure
>pdb|3O5G|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|3O5L|A Chain A, Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|3UQB|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation D44g From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|2KI3|A Chain A, Structural And Biochemical Characterization Of Fk506 Binding Domain From Plasmodium Vivax Length = 126 Back     alignment and structure
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|3O5D|A Chain A, Crystal Structure Of A Fragment Of Fkbp51 Comprising The Fk1 And Fk2 Domains Length = 264 Back     alignment and structure
>pdb|1N1A|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Fkbp52 Length = 140 Back     alignment and structure
>pdb|4DRJ|A Chain A, O-crystal Structure Of The Ppiase Domain Of Fkbp52, Rapamycin And The Frb Fragment Of Mtor Length = 144 Back     alignment and structure
>pdb|1Q1C|A Chain A, Crystal Structure Of N(1-260) Of Human Fkbp52 Length = 280 Back     alignment and structure
>pdb|1ROT|A Chain A, Structure Of Fkbp59-I, The N-Terminal Domain Of A 59 Kda Fk506-Binding Protein, Nmr, Minimized Average Structure Length = 149 Back     alignment and structure
>pdb|2VN1|A Chain A, Crystal Structure Of The Fk506-Binding Domain Of Plasmodium Falciparum Fkbp35 In Complex With Fk506 Length = 129 Back     alignment and structure
>pdb|2OFN|A Chain A, Solution Structure Of Fk506-Binding Domain (Fkbd)of Fkbp35 From Plasmodium Falciparum Length = 135 Back     alignment and structure
>pdb|1U79|A Chain A, Crystal Structure Of Atfkbp13 Length = 129 Back     alignment and structure
>pdb|2PBC|A Chain A, Fk506-Binding Protein 2 Length = 102 Back     alignment and structure
>pdb|1PBK|A Chain A, Homologous Domain Of Human Fkbp25 Length = 116 Back     alignment and structure
>pdb|1JVW|A Chain A, Trypanosoma Cruzi Macrophage Infectivity Potentiator (Tcmip) Length = 167 Back     alignment and structure
>pdb|3KZ7|A Chain A, C-Terminal Domain Of Murine Fkbp25 Rapamycin Complex Length = 119 Back     alignment and structure
>pdb|1Q6U|A Chain A, Crystal Structure Of Fkpa From Escherichia Coli Length = 245 Back     alignment and structure
>pdb|1Q6H|A Chain A, Crystal Structure Of A Truncated Form Of Fkpa From Escherichia Coli Length = 224 Back     alignment and structure
>pdb|1FD9|A Chain A, Crystal Structure Of The Macrophage Infectivity Potentiator Protein (Mip) A Major Virulence Factor From Legionella Pneumophila Length = 213 Back     alignment and structure
>pdb|2UZ5|A Chain A, Solution Structure Of The Fkbp-Domain Of Legionella Pneumophila Mip Length = 137 Back     alignment and structure
>pdb|4DT4|A Chain A, Crystal Structure Of The Ppiase-Chaperone Slpa With The Chaperone Binding Site Occupied By The Linker Of The Purification Tag Length = 169 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query67
2ppn_A107 FK506-binding protein 1A; high resolution protein 9e-36
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 2e-35
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 2e-35
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 4e-35
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 9e-35
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 1e-34
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 2e-31
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 3e-31
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 8e-12
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 3e-31
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 6e-31
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 2e-21
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 2e-17
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-30
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 7e-13
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 2e-30
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 5e-30
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 9e-30
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 1e-29
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 3e-29
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 6e-28
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 2e-26
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 1e-25
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 3e-25
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 4e-25
1jvw_A167 Macrophage infectivity potentiator; chagas disease 1e-24
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 5e-20
1fd9_A213 Protein (macrophage infectivity potentiator prote; 6e-20
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 6e-20
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 4e-17
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 7e-12
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 9e-12
2k8i_A 171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 4e-09
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 1e-08
2kfw_A 196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 1e-08
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 3e-08
3prb_A 231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 5e-06
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 8e-06
3cgm_A 158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 1e-05
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
 Score =  114 bits (289), Expect = 9e-36
 Identities = 46/65 (70%), Positives = 53/65 (81%)

Query: 2  GVDVETLSPGDGQTYPKPGQVVVVHYTGTLTDGTKFDSSRDRGVPFKFRLGKGDVIKGWD 61
          GV VET+SPGDG+T+PK GQ  VVHYTG L DG KFDSSRDR  PFKF LGK +VI+GW+
Sbjct: 1  GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWE 60

Query: 62 HGIAQ 66
           G+AQ
Sbjct: 61 EGVAQ 65
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Length = 169 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Length = 171 Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Length = 151 Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196 Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Length = 151 Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Length = 231 Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} PDB: 3pra_A Length = 157 Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Length = 158 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query67
2lkn_A165 AH receptor-interacting protein; FKBP-type domain, 99.82
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 99.8
2ppn_A107 FK506-binding protein 1A; high resolution protein 99.8
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 99.8
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.79
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.79
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 99.77
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 99.76
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 99.76
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 99.75
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 99.73
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 99.72
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 99.72
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 99.72
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.7
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 99.7
1jvw_A167 Macrophage infectivity potentiator; chagas disease 99.68
1fd9_A213 Protein (macrophage infectivity potentiator prote; 99.67
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 99.67
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 99.66
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.65
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 99.64
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 99.63
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.62
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.61
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.61
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 99.6
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 99.58
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 99.47
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 99.42
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 99.42
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.4
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 99.4
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 99.37
2kfw_A 196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 99.37
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.36
2k8i_A 171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 99.36
3prb_A 231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 99.35
3cgm_A 158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 99.11
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.89
1w26_A 432 Trigger factor, TF; chaperone, protein folding, ri 98.83
1t11_A 392 Trigger factor, TF; helix-turn-helix, four-helix-b 98.8
3gty_X 433 Trigger factor, TF; chaperone-client complex, cell 97.18
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
Probab=99.82  E-value=2e-20  Score=106.26  Aligned_cols=66  Identities=26%  Similarity=0.482  Sum_probs=59.4

Q ss_pred             CCeEEEEEecCCCccC-CCCCCEEEEEEEEEeC--CCCEEeccCCCCccEEEEeCCCCccHHHHHhhcC
Q psy16059          1 MGVDVETLSPGDGQTY-PKPGQVVVVHYTGTLT--DGTKFDSSRDRGVPFKFRLGKGDVIKGWDHGIAQ   66 (67)
Q Consensus         1 ~Gv~~~~~~~g~g~~~-~~~gd~V~v~y~~~~~--dg~~~~~s~~~~~p~~~~lG~~~~~~g~e~~l~~   66 (67)
                      .||+|+++++|+|... +..||.|++||++++.  ||++||||+.+++|+.|.+|.+++|+||+++|..
T Consensus        10 ~Gv~~~vl~~G~G~~p~~~~G~~V~vhY~g~l~d~~G~~FDsS~~rg~P~~f~lG~g~vI~Gwd~gl~~   78 (165)
T 2lkn_A           10 DGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDDEGTVLDDSRARGKPMELIIGKKFKLPVWETIVCT   78 (165)
T ss_dssp             TSCCCCEEECCSSCCCCCCTTCEEEEECEEECSSSSCCEEEESTTTTCCEEEESSSSCSCSHHHHHHTT
T ss_pred             CCeEEEEEECCcCCCCCCCCCCEEEEEEEEEEeCCCccEEEecccCCCCEEEEecCCCccHHHHHHHhc
Confidence            4899999999999742 3579999999999986  4999999999889999999999999999999964
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Back     alignment and structure
>3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 67
d1yata_113 d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas 5e-13
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 2e-12
d2ppna1107 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) 1e-11
d1pbka_116 d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 2e-11
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 4e-11
d1q1ca1120 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu 6e-11
d1ix5a_151 d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcu 3e-10
d1kt1a3115 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M 5e-10
d1q6ha_210 d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 5e-09
d1hxva_85 d.26.1.1 (A:) Trigger factor PPIase domain {Mycopl 2e-07
d1q1ca2117 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H 3e-07
d1fd9a_204 d.26.1.1 (A:) Macrophage infectivity potentiator p 8e-06
d1jvwa_160 d.26.1.1 (A:) Macrophage infectivity potentiator p 2e-04
d1u79a_125 d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha 2e-04
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: Calcineurin (FKBP12.6)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 56.7 bits (136), Expect = 5e-13
 Identities = 38/64 (59%), Positives = 47/64 (73%)

Query: 2  GVDVETLSPGDGQTYPKPGQVVVVHYTGTLTDGTKFDSSRDRGVPFKFRLGKGDVIKGWD 61
           V ++ +SPGDG T+PK G +V +HYTGTL +G KFDSS DRG PF+  +G G VIKGWD
Sbjct: 7  NVKIDRISPGDGATFPKTGDLVTIHYTGTLENGQKFDSSVDRGSPFQCNIGVGQVIKGWD 66

Query: 62 HGIA 65
           GI 
Sbjct: 67 VGIP 70
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Length = 151 Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Length = 85 Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Length = 160 Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query67
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.82
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 99.82
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 99.81
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 99.79
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.78
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escheric 99.74
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 99.73
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) { 99.71
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 99.64
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.47
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithot 99.38
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.36
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 99.15
d1l1pa_106 Trigger factor PPIase domain {Escherichia coli [Ta 98.56
d1t11a3113 Trigger factor PPIase domain {Vibrio cholerae [Tax 98.52
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: FKBP52, N-terminal domains
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.82  E-value=6.7e-20  Score=98.18  Aligned_cols=66  Identities=55%  Similarity=0.784  Sum_probs=61.8

Q ss_pred             CCeEEEEEecCCCccCCCCCCEEEEEEEEEeCCCCEEeccCCCCccEEEEeCCCCccHHHHHhhcC
Q psy16059          1 MGVDVETLSPGDGQTYPKPGQVVVVHYTGTLTDGTKFDSSRDRGVPFKFRLGKGDVIKGWDHGIAQ   66 (67)
Q Consensus         1 ~Gv~~~~~~~g~g~~~~~~gd~V~v~y~~~~~dg~~~~~s~~~~~p~~~~lG~~~~~~g~e~~l~~   66 (67)
                      .||+|+++++|.|...|..||.|.+||++++.||++|++|+..+.|+.|.+|.+++++||+++|..
T Consensus        11 ~gv~~~i~~~G~G~~~P~~gd~V~v~y~~~l~dG~~fdss~~~~~p~~f~~g~~~~i~G~~~~l~~   76 (120)
T d1q1ca1          11 EGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIAT   76 (120)
T ss_dssp             SSEEEEEEECCSSSCCCCTTCEEEEEEEEEETTSCEEEESTTSSSCEEEETTTTSSCHHHHHHHTT
T ss_pred             CCEEEEEEEcccCCcCCCCCCEEEEEEEEEEcCCCEEEeccccccceeeecCCCceeeeeeeeecc
Confidence            489999999999987789999999999999999999999998889999999999999999999864
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure