Psyllid ID: psy16105


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
MIIVVVLNGPYQGEFTVMYLYTRLAFRWNEYNYSTFYTAYYFTDFLGAVASLFSNASFIAMRAIISKLTSAEELGKVMSAFMLFEAIAPMIYNPIYNAVYTATLDFMPSTFLLMSLVLTSPALFIFLCHS
cEEEEEEEEEEcccEEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccc
cEEEEEEEcccccHHEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHEEEEEEcc
MIIVVVLNGPYQGEFTVMYLYTRLAFRwneynystfYTAYYFTDFLGAVASLFSNASFIAMRAIISKLTSAEELGKVMSAFMLFEAIapmiynpiynavYTATLDFMPSTFLLMSLVLTSPALFIFLCHS
MIIVVVlngpyqgeFTVMYLYTRLAFRWNEYNYSTFYTAYYFTDFLGAVASLFSNASFIAMRAIISKLTSAEELGKVMSAFMLFEAIAPMIYNPIYNAVYTATLDFMPSTFLLMSLVLTSPALFIFLCHS
MIIVVVLNGPYQGEFTVMYLYTRLAFRWNEYNYSTFYTAYYFTDFLGAVASLFSNASFIAMRAIISKLTSAEELGKVMSAFMLFEAIAPMIYNPIYNAVYTATLDFMPSTFLLMSLVLTSPALFIFLCHS
*IIVVVLNGPYQGEFTVMYLYTRLAFRWNEYNYSTFYTAYYFTDFLGAVASLFSNASFIAMRAIISKLTSAEELGKVMSAFMLFEAIAPMIYNPIYNAVYTATLDFMPSTFLLMSLVLTSPALFIFLC**
MIIVVVLNGPYQGEFTVMYLYTRLAFRWNEYNYSTFYTAYYFTDFLGAVASLFSNASFIAMRAIISKLTSAEELGKVMSAFMLFEAIAPMIYNPIYNAVYTATLDFMPSTFLLMSLVLTSPALFIFLCHS
MIIVVVLNGPYQGEFTVMYLYTRLAFRWNEYNYSTFYTAYYFTDFLGAVASLFSNASFIAMRAIISKLTSAEELGKVMSAFMLFEAIAPMIYNPIYNAVYTATLDFMPSTFLLMSLVLTSPALFIFLCHS
MIIVVVLNGPYQGEFTVMYLYTRLAFRWNEYNYSTFYTAYYFTDFLGAVASLFSNASFIAMRAIISKLTSAEELGKVMSAFMLFEAIAPMIYNPIYNAVYTATLDFMPSTFLLMSLVLTSPALFIFLCHS
iHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHii
ooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooo
ooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHiii
ooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIIVVVLNGPYQGEFTVMYLYTRLAFRWNEYNYSTFYTAYYFTDFLGAVASLFSNASFIAMRAIISKLTSAEELGKVMSAFMLFEAIAPMIYNPIYNAVYTATLDFMPSTFLLMSLVLTSPALFIFLCHS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query130 2.2.26 [Sep-21-2011]
Q6PEM8459 Proton-coupled folate tra yes N/A 0.5 0.141 0.393 0.0005
Q5EBA8459 Proton-coupled folate tra yes N/A 0.5 0.141 0.393 0.0008
>sp|Q6PEM8|PCFT_MOUSE Proton-coupled folate transporter OS=Mus musculus GN=Slc46a1 PE=1 SV=1 Back     alignment and function desciption
 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 41/66 (62%), Gaps = 1/66 (1%)

Query: 61  MRAIISKLTSAEELGKVMSAFMLFEAIAPMIYNPIYNAVYTATLDFMPS-TFLLMSLVLT 119
           +RA +SKL S  E G + SA     ++A ++ + I+N++Y ATL+FM    FLL + +L 
Sbjct: 375 IRAKLSKLVSESEQGALFSAVACVNSLAMLMASGIFNSIYPATLNFMKGFPFLLGAGLLF 434

Query: 120 SPALFI 125
            PA+ I
Sbjct: 435 IPAILI 440




Has been shown to act both as an intestinal proton-coupled high-affinity folate transporter and as an intestinal heme transporter which mediates heme uptake from the gut lumen into duodenal epithelial cells. The iron is then released from heme and may be transported into the bloodstream. Dietary heme iron is an important nutritional source of iron. Shows a higher affinity for folate than heme.
Mus musculus (taxid: 10090)
>sp|Q5EBA8|PCFT_RAT Proton-coupled folate transporter OS=Rattus norvegicus GN=Slc46a1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
193664492 563 PREDICTED: proton-coupled folate transpo 0.976 0.225 0.387 1e-23
189239551 482 PREDICTED: similar to adenylate cyclase 0.969 0.261 0.360 7e-22
91087373 666 PREDICTED: similar to adenylate cyclase 0.969 0.189 0.348 2e-21
157122007 597 adenylate cyclase [Aedes aegypti] gi|108 0.976 0.212 0.335 2e-19
170035719 568 adenylate cyclase [Culex quinquefasciatu 0.976 0.223 0.329 4e-19
347972151 557 AGAP004562-PA [Anopheles gambiae str. PE 0.976 0.228 0.335 5e-19
328711223 525 PREDICTED: proton-coupled folate transpo 0.915 0.226 0.345 1e-18
328726363 350 PREDICTED: solute carrier family 46 memb 0.915 0.34 0.351 2e-18
357623126 498 adenylate cyclase [Danaus plexippus] 0.969 0.253 0.331 3e-18
91084449 552 PREDICTED: similar to adenylate cyclase 0.907 0.213 0.335 3e-18
>gi|193664492|ref|XP_001942608.1| PREDICTED: proton-coupled folate transporter-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 67/173 (38%), Positives = 89/173 (51%), Gaps = 46/173 (26%)

Query: 1   MIIVVVLNGPYQGEFTVMYLYTRLAFRWNEYNYSTFYT---------------------- 38
           M++V+V+ GP  GE +VMYL+TR+ F W+E NYS F T                      
Sbjct: 310 MVVVIVVMGPLHGEMSVMYLFTRVRFNWDEVNYSMFSTYSMITNLVGTMFSVGVFSHMLQ 369

Query: 39  ---------------------AYYFTDF---LGAVASLFSNASFIAMRAIISKLTSAEEL 74
                                A+  TDF   L  +  + +  SFIAMR+IISKL   +EL
Sbjct: 370 IDDALIGVISCMSKILAGFVYAFATTDFVFYLAPLVDIVNGTSFIAMRSIISKLVPPDEL 429

Query: 75  GKVMSAFMLFEAIAPMIYNPIYNAVYTATLDFMPSTFLLMSLVLTSPALFIFL 127
           GKV S F + EA+ P+IY P+Y+AVY ATL  +P  F L+   LT+PA  IFL
Sbjct: 430 GKVNSLFGVCEALVPLIYGPMYSAVYKATLKTVPGAFFLLGGALTAPAALIFL 482




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189239551|ref|XP_975637.2| PREDICTED: similar to adenylate cyclase [Tribolium castaneum] gi|270009516|gb|EFA05964.1| hypothetical protein TcasGA2_TC008783 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91087373|ref|XP_975639.1| PREDICTED: similar to adenylate cyclase [Tribolium castaneum] Back     alignment and taxonomy information
>gi|157122007|ref|XP_001659917.1| adenylate cyclase [Aedes aegypti] gi|108874606|gb|EAT38831.1| AAEL009314-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170035719|ref|XP_001845715.1| adenylate cyclase [Culex quinquefasciatus] gi|167878021|gb|EDS41404.1| adenylate cyclase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|347972151|ref|XP_562320.4| AGAP004562-PA [Anopheles gambiae str. PEST] gi|333469195|gb|EAL40562.4| AGAP004562-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|328711223|ref|XP_001946964.2| PREDICTED: proton-coupled folate transporter-like isoform 1 [Acyrthosiphon pisum] gi|328711225|ref|XP_003244477.1| PREDICTED: proton-coupled folate transporter-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328726363|ref|XP_003248866.1| PREDICTED: solute carrier family 46 member 3-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|357623126|gb|EHJ74402.1| adenylate cyclase [Danaus plexippus] Back     alignment and taxonomy information
>gi|91084449|ref|XP_969712.1| PREDICTED: similar to adenylate cyclase [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
FB|FBgn0030576599 CG15890 [Drosophila melanogast 0.638 0.138 0.457 3.4e-14
FB|FBgn0033387566 CG8008 [Drosophila melanogaste 0.630 0.144 0.265 8.7e-10
WB|WBGene00021159469 Y4C6B.5 [Caenorhabditis elegan 0.538 0.149 0.385 1.6e-08
FB|FBgn0051321601 CG31321 [Drosophila melanogast 0.653 0.141 0.290 2.4e-08
FB|FBgn0050345494 CG30345 [Drosophila melanogast 0.938 0.246 0.302 3.2e-07
UNIPROTKB|Q7Z3Q1461 SLC46A3 "Solute carrier family 0.630 0.177 0.317 4.5e-07
UNIPROTKB|E2QTY8461 SLC46A3 "Uncharacterized prote 0.630 0.177 0.294 8.2e-06
FB|FBgn0050344507 CG30344 [Drosophila melanogast 0.623 0.159 0.317 8.3e-06
UNIPROTKB|I3L9X9459 LOC100624611 "Uncharacterized 0.5 0.141 0.424 9.2e-06
UNIPROTKB|I3LB07459 SLC46A1 "Uncharacterized prote 0.5 0.141 0.424 9.2e-06
FB|FBgn0030576 CG15890 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 192 (72.6 bits), Expect = 3.4e-14, P = 3.4e-14
 Identities = 38/83 (45%), Positives = 56/83 (67%)

Query:    45 FLGAVASLFSNASFIAMRAIISKLTSAEELGKVMSAFMLFEAIAPMIYNPIYNAVYTATL 104
             +LG +  +F+  +FIAMR+I +KL S +ELGKV S F + EA+ PM++ P+Y  +Y ATL
Sbjct:   422 YLGGLVEIFNGTAFIAMRSIATKLVSKDELGKVNSLFGVAEALMPMVFAPMYTTLYAATL 481

Query:   105 DFMPSTFLLMSLVLTSPALFIFL 127
               +P  F L+   LT  ++FIFL
Sbjct:   482 RVLPGAFFLLGGGLTLFSVFIFL 504


GO:0055085 "transmembrane transport" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
FB|FBgn0033387 CG8008 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00021159 Y4C6B.5 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0051321 CG31321 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0050345 CG30345 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q7Z3Q1 SLC46A3 "Solute carrier family 46 member 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2QTY8 SLC46A3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0050344 CG30344 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|I3L9X9 LOC100624611 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LB07 SLC46A1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 130
KOG2816|consensus463 99.59
PRK10054 395 putative transporter; Provisional 98.42
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 98.38
PRK11646 400 multidrug resistance protein MdtH; Provisional 98.35
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 98.3
TIGR00893399 2A0114 d-galactonate transporter. 98.24
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 98.22
TIGR00893 399 2A0114 d-galactonate transporter. 98.17
PRK03545 390 putative arabinose transporter; Provisional 98.12
PRK10213 394 nepI ribonucleoside transporter; Reviewed 98.11
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 98.08
PRK11646400 multidrug resistance protein MdtH; Provisional 98.08
TIGR00900 365 2A0121 H+ Antiporter protein. 98.02
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 98.01
PRK10489417 enterobactin exporter EntS; Provisional 98.01
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 98.0
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 98.0
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 97.97
PRK11195 393 lysophospholipid transporter LplT; Provisional 97.96
PRK11663 434 regulatory protein UhpC; Provisional 97.94
TIGR00900365 2A0121 H+ Antiporter protein. 97.93
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 97.93
KOG2615|consensus451 97.92
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 97.89
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 97.84
PRK05122 399 major facilitator superfamily transporter; Provisi 97.83
PRK12382 392 putative transporter; Provisional 97.82
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 97.81
PRK10091 382 MFS transport protein AraJ; Provisional 97.8
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 97.79
PRK11902 402 ampG muropeptide transporter; Reviewed 97.79
TIGR00901 356 2A0125 AmpG-related permease. 97.78
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 97.78
TIGR00891405 2A0112 putative sialic acid transporter. 97.76
TIGR00891 405 2A0112 putative sialic acid transporter. 97.75
PRK15011 393 sugar efflux transporter B; Provisional 97.75
TIGR00895 398 2A0115 benzoate transport. 97.74
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 97.73
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 97.72
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 97.71
PRK03633381 putative MFS family transporter protein; Provision 97.69
PRK10489 417 enterobactin exporter EntS; Provisional 97.67
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 97.66
PRK03545390 putative arabinose transporter; Provisional 97.64
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 97.63
TIGR00902382 2A0127 phenyl proprionate permease family protein. 97.61
TIGR00892455 2A0113 monocarboxylate transporter 1. 97.61
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 97.6
TIGR00889418 2A0110 nucleoside transporter. This family of prot 97.59
TIGR00897402 2A0118 polyol permease family. This family of prot 97.59
PRK03699 394 putative transporter; Provisional 97.59
COG2270438 Permeases of the major facilitator superfamily [Ge 97.57
PRK03893496 putative sialic acid transporter; Provisional 97.57
PRK10504 471 putative transporter; Provisional 97.56
TIGR00880141 2_A_01_02 Multidrug resistance protein. 97.55
KOG2532|consensus 466 97.53
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 97.52
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 97.52
TIGR00881379 2A0104 phosphoglycerate transporter family protein 97.51
PRK03633 381 putative MFS family transporter protein; Provision 97.51
TIGR00895398 2A0115 benzoate transport. 97.48
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 97.47
PRK03893 496 putative sialic acid transporter; Provisional 97.47
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 97.46
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 97.44
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 97.44
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 97.44
PRK12307 426 putative sialic acid transporter; Provisional 97.44
PRK09874408 drug efflux system protein MdtG; Provisional 97.43
TIGR00788468 fbt folate/biopterin transporter. The only functio 97.42
PRK10473 392 multidrug efflux system protein MdtL; Provisional 97.42
PRK05122399 major facilitator superfamily transporter; Provisi 97.4
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 97.37
PRK09874 408 drug efflux system protein MdtG; Provisional 97.36
PRK11043 401 putative transporter; Provisional 97.36
PRK10213394 nepI ribonucleoside transporter; Reviewed 97.34
PRK09705 393 cynX putative cyanate transporter; Provisional 97.33
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 97.32
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 97.32
PRK14995 495 methyl viologen resistance protein SmvA; Provision 97.32
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 97.32
PRK11010491 ampG muropeptide transporter; Validated 97.31
PRK11195393 lysophospholipid transporter LplT; Provisional 97.27
PRK12382392 putative transporter; Provisional 97.24
PRK15011393 sugar efflux transporter B; Provisional 97.22
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 97.22
PRK09528 420 lacY galactoside permease; Reviewed 97.22
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 97.21
PRK15402406 multidrug efflux system translocase MdfA; Provisio 97.2
PRK03699394 putative transporter; Provisional 97.2
PRK09705393 cynX putative cyanate transporter; Provisional 97.18
PRK11652 394 emrD multidrug resistance protein D; Provisional 97.17
TIGR00897 402 2A0118 polyol permease family. This family of prot 97.17
PRK10207 489 dipeptide/tripeptide permease B; Provisional 97.12
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 97.11
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 97.0
PRK10504471 putative transporter; Provisional 96.94
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 96.92
PRK09584 500 tppB putative tripeptide transporter permease; Rev 96.9
KOG4686|consensus459 96.9
TIGR00901356 2A0125 AmpG-related permease. 96.9
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 96.88
PRK15403 413 multidrug efflux system protein MdtM; Provisional 96.86
TIGR00896355 CynX cyanate transporter. This family of proteins 96.86
PRK11902402 ampG muropeptide transporter; Reviewed 96.86
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 96.85
PRK11663434 regulatory protein UhpC; Provisional 96.81
PRK15462 493 dipeptide/tripeptide permease D; Provisional 96.78
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 96.78
TIGR00896 355 CynX cyanate transporter. This family of proteins 96.76
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 96.75
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 96.73
PRK10077 479 xylE D-xylose transporter XylE; Provisional 96.67
TIGR00892 455 2A0113 monocarboxylate transporter 1. 96.64
TIGR00898 505 2A0119 cation transport protein. 96.62
PRK14995495 methyl viologen resistance protein SmvA; Provision 96.62
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 96.53
PRK12307426 putative sialic acid transporter; Provisional 96.49
PTZ00207 591 hypothetical protein; Provisional 96.49
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 96.48
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 96.48
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 96.44
PRK11652394 emrD multidrug resistance protein D; Provisional 96.43
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 96.43
KOG2533|consensus 495 96.42
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 96.4
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 96.33
PLN00028 476 nitrate transmembrane transporter; Provisional 96.3
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 96.3
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 96.19
PRK10054395 putative transporter; Provisional 96.18
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 96.18
TIGR01272310 gluP glucose/galactose transporter. Disruption of 96.14
PRK09528420 lacY galactoside permease; Reviewed 96.12
PRK10091382 MFS transport protein AraJ; Provisional 96.07
KOG3764|consensus 464 96.06
TIGR01272 310 gluP glucose/galactose transporter. Disruption of 95.94
PRK15075434 citrate-proton symporter; Provisional 95.93
PRK11010 491 ampG muropeptide transporter; Validated 95.92
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 95.91
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 95.83
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 95.82
TIGR00898505 2A0119 cation transport protein. 95.48
PRK10077479 xylE D-xylose transporter XylE; Provisional 95.41
PRK09952438 shikimate transporter; Provisional 95.36
PRK10133 438 L-fucose transporter; Provisional 95.31
PRK10642490 proline/glycine betaine transporter; Provisional 95.2
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 95.13
TIGR00805 633 oat sodium-independent organic anion transporter. 94.93
PRK11043401 putative transporter; Provisional 94.82
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 94.71
KOG2504|consensus509 94.68
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 94.56
PRK09669 444 putative symporter YagG; Provisional 94.55
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 94.55
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 94.4
PRK10406432 alpha-ketoglutarate transporter; Provisional 94.39
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 94.25
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 94.17
PRK09584500 tppB putative tripeptide transporter permease; Rev 93.96
PRK09848448 glucuronide transporter; Provisional 93.92
PRK15462493 dipeptide/tripeptide permease D; Provisional 93.92
PRK10207489 dipeptide/tripeptide permease B; Provisional 93.87
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 93.87
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 93.69
PRK15075 434 citrate-proton symporter; Provisional 93.57
PRK10406 432 alpha-ketoglutarate transporter; Provisional 93.56
PLN00028476 nitrate transmembrane transporter; Provisional 93.47
KOG2325|consensus488 93.46
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 93.44
TIGR00788 468 fbt folate/biopterin transporter. The only functio 93.09
PRK10642 490 proline/glycine betaine transporter; Provisional 93.01
PRK10473392 multidrug efflux system protein MdtL; Provisional 92.84
PRK09952 438 shikimate transporter; Provisional 92.64
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 91.51
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 91.28
TIGR00889 418 2A0110 nucleoside transporter. This family of prot 91.08
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 91.01
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 90.7
PRK15403413 multidrug efflux system protein MdtM; Provisional 90.45
KOG2615|consensus 451 90.18
PF03209 403 PUCC: PUCC protein; InterPro: IPR004896 This prote 90.13
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 89.28
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 89.04
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 89.03
PF05631 354 DUF791: Protein of unknown function (DUF791); Inte 89.0
PRK10133438 L-fucose transporter; Provisional 88.89
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 88.7
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 88.63
COG0738422 FucP Fucose permease [Carbohydrate transport and m 88.24
PRK10429 473 melibiose:sodium symporter; Provisional 88.18
KOG2532|consensus466 86.83
COG2807395 CynX Cyanate permease [Inorganic ion transport and 86.81
PRK09669444 putative symporter YagG; Provisional 86.32
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 86.31
PRK10429473 melibiose:sodium symporter; Provisional 83.94
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 81.2
KOG1330|consensus 493 80.95
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 80.35
>KOG2816|consensus Back     alignment and domain information
Probab=99.59  E-value=1.6e-15  Score=125.30  Aligned_cols=107  Identities=26%  Similarity=0.451  Sum_probs=94.9

Q ss_pred             ccchhHHHHHhhhhhccccchhHHHHHHHHHHHHH--------------------------------------------H
Q psy16105         11 YQGEFTVMYLYTRLAFRWNEYNYSTFYTAYYFTDF--------------------------------------------L   46 (130)
Q Consensus        11 ~~g~~~i~~ly~~~~f~W~~~~~g~~~~~~~~~~~--------------------------------------------~   46 (130)
                      ..+.+++.++|+|.||+||+++++.+.+..+....                                            .
T Consensus       257 ~~~~~~~~~~yl~~~f~w~~~~~s~~~~~~~~~~~i~~l~~~~~l~~~l~~~~~i~lGl~~~~~~~~~~af~~~~w~~~~  336 (463)
T KOG2816|consen  257 AGGASDVLLLYLKAKFGWNKKEFSDLLSLVSILGIISQLLLLPLLSSILGEKRLISLGLLSEFLQLLLFAFATETWMMFA  336 (463)
T ss_pred             hcCceeEEEEEEeeecCcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHhhHHHHHHHHHHHHHHHhccchhhhH
Confidence            44555577999999999999999999888765544                                            4


Q ss_pred             HHHHHHHHhhHHHHHHHHHhcCCCccchHHHHHHHHHHHHHhHhhHHHHHHHHHHhccccCCchHHHHHHH
Q psy16105         47 GAVASLFSNASFIAMRAIISKLTSAEELGKVMSAFMLFEAIAPMIYNPIYNAVYTATLDFMPSTFLLMSLV  117 (130)
Q Consensus        47 ~~~~~~~~~~~~p~~rs~iSk~v~~~eqG~~~~~~~~~~sl~~~i~~~l~~~iy~~t~~~~pg~~f~~~a~  117 (130)
                      +.++.+++....|++|+.+||.+++|||||+++..+.+++++++++|++++.+|..|.+.+||..|...++
T Consensus       337 ~~v~~~~~~~~~pa~~s~~s~~v~~~e~g~v~~~is~i~~l~~~~~~~~~~~i~~~t~~~~~~~~~~~~~~  407 (463)
T KOG2816|consen  337 AGVVVALAGIVFPAIRAFASILVSPEEQGKVFGIISGIEGLSGVVSPALYGNIFALTLDDLPGFLFVISSL  407 (463)
T ss_pred             HHHHHHhhcchhHHHHhHHHhhcccccccchhhHHHHHHHHhhhhhHHHHHHHHHHHHHhcccccccccch
Confidence            56677788999999999999999999999999999999999999999999999999999999988887766



>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 98.38
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 98.15
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 98.08
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 97.81
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 97.73
2xut_A 524 Proton/peptide symporter family protein; transport 97.7
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 97.56
2cfq_A417 Lactose permease; transport, transport mechanism, 96.88
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 96.62
2xut_A524 Proton/peptide symporter family protein; transport 96.45
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 96.43
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 95.15
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 89.03
2cfq_A 417 Lactose permease; transport, transport mechanism, 87.96
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
Probab=98.38  E-value=1.4e-05  Score=62.07  Aligned_cols=113  Identities=11%  Similarity=0.042  Sum_probs=84.9

Q ss_pred             chhHHHHHhhhhhccccchhHHHHHHHHHHHHH-----------------------------------------------
Q psy16105         13 GEFTVMYLYTRLAFRWNEYNYSTFYTAYYFTDF-----------------------------------------------   45 (130)
Q Consensus        13 g~~~i~~ly~~~~f~W~~~~~g~~~~~~~~~~~-----------------------------------------------   45 (130)
                      +.......|.++.+++++.+.|...+..++..+                                               
T Consensus       270 ~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~g~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  349 (451)
T 1pw4_A          270 GILDWSPTYLKEVKHFALDKSSWAYFLYEYAGIPGTLLCGWMSDKVFRGNRGATGVFFMTLVTIATIVYWMNPAGNPTVD  349 (451)
T ss_dssp             HHHHHHHHHBTTBSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSTTCHHHHHHHHHHHHHHHHHHTTSCCTTCHHHH
T ss_pred             HHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCchhHHHHHHHHHHHHHHHHHHhcccCHHHH
Confidence            445566677788899999998888776654333                                               


Q ss_pred             --HHHHHHHHHhhHHHHHHHHHhcCCCccchHHHHHHHHHHHHH-hHhhHHHHHHHHHHhccccCCchHHHHHHHHHHHH
Q psy16105         46 --LGAVASLFSNASFIAMRAIISKLTSAEELGKVMSAFMLFEAI-APMIYNPIYNAVYTATLDFMPSTFLLMSLVLTSPA  122 (130)
Q Consensus        46 --~~~~~~~~~~~~~p~~rs~iSk~v~~~eqG~~~~~~~~~~sl-~~~i~~~l~~~iy~~t~~~~pg~~f~~~a~l~~~~  122 (130)
                        .....+...+...|...+++++.+|++++|+.+|.......+ +..++|.+...+++..   -....|++.+++.+++
T Consensus       350 ~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~g~~~~~~~~g~l~~~~---g~~~~~~~~~~~~~~~  426 (451)
T 1pw4_A          350 MICMIVIGFLIYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVAASAIVGYTVDFF---GWDGGFMVMIGGSILA  426 (451)
T ss_dssp             HHHHHHHHHHHTHHHHHHHHHHHHTSCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSS---CSHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhchHHHHHHHHHHHhchhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHhc---CcHHHHHHHHHHHHHH
Confidence              111222234566788889999999999999999999999999 9999999999998862   3556788877777766


Q ss_pred             HHHHHh
Q psy16105        123 LFIFLC  128 (130)
Q Consensus       123 ~~l~~~  128 (130)
                      .++..+
T Consensus       427 ~~~~~~  432 (451)
T 1pw4_A          427 VILLIV  432 (451)
T ss_dssp             HHHHHH
T ss_pred             HHHHHH
Confidence            665554



>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 97.99
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 97.96
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 97.93
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 93.81
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: LacY-like proton/sugar symporter
domain: Lactose permease
species: Escherichia coli [TaxId: 562]
Probab=97.99  E-value=2.9e-05  Score=56.13  Aligned_cols=77  Identities=8%  Similarity=0.024  Sum_probs=61.1

Q ss_pred             HHHHHHhhHHHHHHHHHhcCCCccchHHHHHHH-HHHHHHhHhhHHHHHHHHHHhccccCCchHHHHHHHHHHHHHHHHH
Q psy16105         49 VASLFSNASFIAMRAIISKLTSAEELGKVMSAF-MLFEAIAPMIYNPIYNAVYTATLDFMPSTFLLMSLVLTSPALFIFL  127 (130)
Q Consensus        49 ~~~~~~~~~~p~~rs~iSk~v~~~eqG~~~~~~-~~~~sl~~~i~~~l~~~iy~~t~~~~pg~~f~~~a~l~~~~~~l~~  127 (130)
                      ..+...+...|...+.+++.+|++++|+.+|.. +...+++..++|++...+++.   +-....|++.+++.+...++..
T Consensus       321 l~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~i~~~~~G~l~~~---~g~~~~~~~~~~~~~~~~~~~~  397 (417)
T d1pv7a_         321 LHMFEVPFLLVGCFKYITSQFEVRFSATIYLVCFCFFKQLAMIFMSVLAGNMYES---IGFQGAYLVLGLVALGFTLISV  397 (417)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHSCGGGHHHHHHHHHTTTHHHHHHHHHHHHHHHHHH---HCHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HCHHHHHHHHHHHHHHHHHHHH
Confidence            344456788999999999999999999999985 556789999999999999876   2345677787777766666555


Q ss_pred             h
Q psy16105        128 C  128 (130)
Q Consensus       128 ~  128 (130)
                      |
T Consensus       398 ~  398 (417)
T d1pv7a_         398 F  398 (417)
T ss_dssp             H
T ss_pred             H
Confidence            4



>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure