Psyllid ID: psy16116


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610--
MKVPQYYCVFFVATAGLQGNLLGSDEQEIILLIYVIIDSYVNKVLITSQYKEPIQGFKKVLVEHILEFLGEFASNIVYQGVHMVYNSQGQPSGEAFIQMDSEHSAYLAAQLRHNRNMIFGKKQRYIEVFQCSGEDMNLVLNGVLPPTSPAISPVGKTLLSPGMLPHSSQPLYPQHNTQINPGLSHLDPLVNVHLTQALAQAQYAKSQQDNLMLMNQIAAQQMAALNKPHNMALNGHTPTLIPAPSPNALMPPPLNSKSTTIPTNLPALPAVPTSGGYFPQFQLPINMNTAHLLQPMNTPFFFNMPRMPVTPQVLPKFPVHQLNQTPTVYTIPTPGNPVALCPLVQNIWLSLLLNTIPGYEQVLGLGGVALCLSAFGRRNGEAIVRFIDQEHRDMALKRHKHHIDKRYIEVTKANGEDFINVAGGNNNEAQAFLTRGAQVIIRMRGLPYECTAKQVIDFFEAGTENSCNVMDGEEGVLFVKKPDGKATGDAFVLFEKEEEADKALSKHKESIGIRYIELFRSTTAEVQQVLNKTMELPKNNSLTSSNNGLSAQQPMLSHLAQVPVPYLPQHIITSGTRKDCIRLRGLPYEALCILMDIFFVGQQDSFVHKVPK
cccccEEEEEEEEEcccccccccccccEEEEEEEEEEccccccccccccccccccccccccHHHHHHHHHccccccccccEEEEEcccccccccEEEEEccHHHHHHHHHHHccccccccccccEEEEEEccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccHHHccccccEEEEEEEEcccccccEEEEEEEccHHHHHHHHHHcccccccEEEEEEEccccccccccccccccccccccccccEEEEEEcccccccHHHHHHHHHccccccccccccccEEEEEEccccccEEEEEEEEccHHHHHHHHHHcccccccEEEEEEEccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccHHHHHHccccccccccccccc
cccHHEEEEEEHHHcccccccccccccccccEEEEcccccccccEccccccccccccccccHHHHHHHHHHHHHHcccccEEEEEcccccccccEEEEEccHHHHHHHHHHHHHHHcccccEEEEEEEEEccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccHHEEEEEccccHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccEccccccHHHHHHcccHHHHHcccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHcccccccEEEEEcccccccccEEEEEccHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHccccccccccccccccEEEEEccccccccHHHHHHHHccccccccccccccccEEEEEcccccccccEEEEEccHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHcccccEEEEcccc
MKVPQYYCVFFVATaglqgnllgsdeQEIILLIYVIIDSYVNKVLITSQYKEPIQGFKKVLVEHILEFLGEFASNIVYQGVHMVynsqgqpsgeaFIQMDSEHSAYLAAQLRHNRNMIFGKKQRYIEVFQCSgedmnlvlngvlpptspaispvgktllspgmlphssqplypqhntqinpglshldplVNVHLTQALAQAQYAKSQQDNLMLMNQIAAQQMAALnkphnmalnghtptlipapspnalmppplnsksttiptnlpalpavptsggyfpqfqlpinmntahllqpmntpfffnmprmpvtpqvlpkfpvhqlnqtptvytiptpgnpvalcpLVQNIWLSLLLNTIPGYEQVLGLGGVALCLSAFGRRNGEAIVRFIDQEHRDMALKRHKHHIDKRYIEVTKangedfinvaggnnnEAQAFLTRGAQVIIRMrglpyectAKQVIDFFEagtenscnvmdgeegvlfvkkpdgkatgdAFVLFEKEEEADKALSKHKESIGIRYIELFRSTTAEVQQVLNKTmelpknnsltssnnglsaqqpmlshlaqvpvpylpqhiitsgtrkdcirlrglpyeALCILMDIFfvgqqdsfvhkvpk
MKVPQYYCVFFVATAGLQGNLLGSDEQEIILLIYVIIDSYVNKVLITSQYKEPIQGFKKVLVEHILEFLGEFASNIVYQGVHMVYNSQGQPSGEAFIQMDSEHSAYLAAQLRHNRNMIFGKKQRYIEVFQCSGEDMNLVLNGVLPPTSPAISPVGKTLLSPGMLPHSSQPLYPQHNTQINPGLSHLDPLVNVHLTQALAQAQYAKSQQDNLMLMNQIAAQQMAALNKPHNMALNGHTPTLIPAPSPNALMPPPLNSKSTTIPTNLPALPAVPTSGGYFPQFQLPINMNTAHLLQPMNTPFFFNMPRMPVTPQVLPKFPVHQLNQTPTVYTIPTPGNPVALCPLVQNIWLSLLLNTIPGYEQVLGLGGVALCLSAFGRRNGEAIVRFIDQEHRDMALKRHKHHIDKRYIEVTKANGEDFINVAGGNNNEAQAFLTRGAQVIIRMRGLPYECTAKQVIDFFEAGTENSCNVMDGEEGVLFVKKPDGKATGDAFVLFEKEEEADKALSKHKESIGIRYIELFRSTTAEVQQVLNKTMELPKNNSLTSSNNGLSAQQPMLSHLAQVPVPYLPQHIITSGTRKDCIRLRGLPYEALCILMDIFFVGQQDSFVHKVPK
MKVPQYYCVFFVATAGLQGNLLGSDEQEIILLIYVIIDSYVNKVLITSQYKEPIQGFKKVLVEHILEFLGEFASNIVYQGVHMVYNSQGQPSGEAFIQMDSEHSAYLAAQLRHNRNMIFGKKQRYIEVFQCSGEDMNLVLNGVLPPTSPAISPVGKTLLSPGMLPHSSQPLYPQHNTQINPGLSHLDPLVNVHLTQALAQAQYAKSQQDNLMLMNQIAAQQMAALNKPHNMALNGHTPTLIpapspnalmppplnsKSTTIPTNLPALPAVPTSGGYFPQFQLPINMNTAHLLQPMNTPFFFNMPRMPVTPQVLPKFPVHQLNQTPTVYTIPTPGNPVALCPLVQNIWLSLLLNTIPGYEQVLGLGGVALCLSAFGRRNGEAIVRFIDQEHRDMALKRHKHHIDKRYIEVTKANGEDFINVAGGNNNEAQAFLTRGAQVIIRMRGLPYECTAKQVIDFFEAGTENSCNVMDGEEGVLFVKKPDGKATGDAFVLFEKEEEADKALSKHKESIGIRYIELFRSTTAEVQQVLNKTMELPKnnsltssnnglsAQQPMLSHLAQVPVPYLPQHIITSGTRKDCIRLRGLPYEALCILMDIFFVGQQDSFVHKVPK
****QYYCVFFVATAGLQGNLLGSDEQEIILLIYVIIDSYVNKVLITSQYKEPIQGFKKVLVEHILEFLGEFASNIVYQGVHMVYNS*******AFIQMDSEHSAYLAAQLRHNRNMIFGKKQRYIEVFQCSGEDMNLVLNGVLP*************************************LSHLDPLVNVHLTQALAQAQYA*******MLM******************************************************PAVPTSGGYFPQFQLPINMNTAHLLQPMNTPFFFNMPRMPVTPQVLPKFPVHQLNQTPTVYTIPTPGNPVALCPLVQNIWLSLLLNTIPGYEQVLGLGGVALCLSAFGRRNGEAIVRFIDQEHRDMALKRHKHHIDKRYIEVTKANGEDFINVAGGNNNEAQAFLTRGAQVIIRMRGLPYECTAKQVIDFFEAGTENSCNVMDGEEGVLFVKKPDGKATGDAFVLFE**************SIGIRYIELFRSTTAEVQQV****************************HLAQVPVPYLPQHIITSGTRKDCIRLRGLPYEALCILMDIFFVGQQDSFV*****
****QYYCVFFVATAGLQ*****SDEQEIILLIYVIIDSYVN********KEPIQGFKKVLVEHILEFLGEFASNIVYQGVHMVYNSQGQPSGEAFIQMDSEHSAYLAAQLRHNRNMIFGKKQRYIEVFQCSGEDMNL*******************************************GLSHLDPLVNVHLTQALA******************************************************************************************************************************************VALCPLVQNIWLSLLLNTIPGYEQVLGLGGVALCLSAFGRRNGEAIVRFIDQEHRDMALKRHKHHIDKRYIEVTKANGEDFINV******************IIRMRGLPYECTAKQVIDFFEAGTENSCNVMDGEEGVLFVKKPDGKATGDAFVLFEKEEEADKALSKHKESIGIRYIELFRST*******************************************************KDCIRLRGLPYEALCILMDIFFVGQQDSFVHKVPK
MKVPQYYCVFFVATAGLQGNLLGSDEQEIILLIYVIIDSYVNKVLITSQYKEPIQGFKKVLVEHILEFLGEFASNIVYQGVHMVYNSQGQPSGEAFIQMDSEHSAYLAAQLRHNRNMIFGKKQRYIEVFQCSGEDMNLVLNGVLPPTSPAISPVGKTLLSPGMLPHSSQPLYPQHNTQINPGLSHLDPLVNVHLTQALAQAQYAKSQQDNLMLMNQIAAQQMAALNKPHNMALNGHTPTLIPAPSPNALMPPPLNSKSTTIPTNLPALPAVPTSGGYFPQFQLPINMNTAHLLQPMNTPFFFNMPRMPVTPQVLPKFPVHQLNQTPTVYTIPTPGNPVALCPLVQNIWLSLLLNTIPGYEQVLGLGGVALCLSAFGRRNGEAIVRFIDQEHRDMALKRHKHHIDKRYIEVTKANGEDFINVAGGNNNEAQAFLTRGAQVIIRMRGLPYECTAKQVIDFFEAGTENSCNVMDGEEGVLFVKKPDGKATGDAFVLFEKEE*********KESIGIRYIELFRSTTAEVQQVLNKTMELPKNNSLTSSNNGLSAQQPMLSHLAQVPVPYLPQHIITSGTRKDCIRLRGLPYEALCILMDIFFVGQQDSFVHKVPK
*KVPQYYCVFFVATAGLQGNLLGSDEQEIILLIYVIIDSYVNKVLITSQYKEPIQGFKKVLVEHILEFLGEFASNIVYQGVHMVYNSQGQPSGEAFIQMDSEHSAYLAAQLRHNRNMIFGKKQRYIEVFQCSGEDMNLVLNGVLPPTSPAISPVGKTLLSPGMLPHSSQPLYPQHNTQINPGLSHLDPLVNVHLTQALAQAQYAKSQQDNLMLMNQIAAQQMAALNKPHNMALNGHTPTLIPAPSPNALMPPPLNSKSTTIPTNLPALPAVPTSGGYFPQFQLPINMNTAHLLQPMNTPFFFNMPRMPVTPQVLPKFPVHQLNQT*TVYTIPTPGNPVALCPLVQNIWLSLLLNTIPGYEQVLGLGGVALCLSAFGRRNGEAIVRFIDQEHRDMALKRHKHHIDKRYIEVTKANGEDFINVAGGNNN**QAFLTRGAQVIIRMRGLPYECTAKQVIDFFEAGTENSCNVMDGEEGVLFVKKPDGKATGDAFVLFEKEEEADKALSKHKESIGIRYIELFRSTTAEVQQVLNKTM******************************************RKDCIRLRGLPYEALCILMDIFFVGQQDSFVHKV**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVPQYYCVFFVATAGLQGNLLGSDEQEIILLIYVIIDSYVNKVLITSQYKEPIQGFKKVLVEHILEFLGEFASNIVYQGVHMVYNSQGQPSGEAFIQMDSEHSAYLAAQLRHNRNMIFGKKQRYIEVFQCSGEDMNLVLNGVLPPTSPAISPVGKTLLSPGMLPHSSQPLYPQHNTQINPGLSHLDPLVNVHLTQALAQAQYAKSQQDNLMLMNQIAAQQMAALNKPHNMALNGHTPTLIPAPSPNALMPPPLNSKSTTIPTNLPALPAVPTSGGYFPQFQLPINMNTAHLLQPMNTPFFFNMPRMPVTPQVLPKFPVHQLNQTPTVYTIPTPGNPVALCPLVQNIWLSLLLNTIPGYEQVLGLGGVALCLSAFGRRNGEAIVRFIDQEHRDMALKRHKHHIDKRYIEVTKANGEDFINVAGGNNNEAQAFLTRGAQVIIRMRGLPYECTAKQVIDFFEAGTENSCNVMDGEEGVLFVKKPDGKATGDAFVLFEKEEEADKALSKHKESIGIRYIELFRSTTAEVQQVLNKTMELPKNNSLTSSNNGLSAQQPMLSHLAQVPVPYLPQHIITSGTRKDCIRLRGLPYEALCILMDIFFVGQQDSFVHKVPK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query612 2.2.26 [Sep-21-2011]
Q9BJZ5 967 RNA-binding protein fusil no N/A 0.361 0.228 0.607 2e-84
A1L1G1 714 Epithelial splicing regul yes N/A 0.357 0.306 0.554 2e-65
Q7ZVR8 736 Epithelial splicing regul no N/A 0.361 0.300 0.560 1e-64
B2RYD2 677 Epithelial splicing regul yes N/A 0.348 0.314 0.527 9e-63
Q3US41 680 Epithelial splicing regul yes N/A 0.349 0.314 0.537 2e-61
Q6NXG1 681 Epithelial splicing regul yes N/A 0.349 0.314 0.533 5e-61
Q6DEZ7 687 Epithelial splicing regul yes N/A 0.349 0.311 0.542 2e-60
Q7ZY29 688 Epithelial splicing regul N/A N/A 0.349 0.311 0.542 2e-60
Q5ZLR4 701 Epithelial splicing regul yes N/A 0.334 0.292 0.537 3e-60
Q9H6T0 727 Epithelial splicing regul no N/A 0.346 0.291 0.512 4e-57
>sp|Q9BJZ5|FUSIL_DROME RNA-binding protein fusilli OS=Drosophila melanogaster GN=fus PE=2 SV=1 Back     alignment and function desciption
 Score =  313 bits (802), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 156/257 (60%), Positives = 187/257 (72%), Gaps = 36/257 (14%)

Query: 366 GGVALCLSAFGRRNGEAIVRFIDQEHRDMALKRHKHHIDKRYIEVTKANGEDFINVAGGN 425
           GGVALCLS  GRRNGEA++RF+ QEHRDMALKRHKHHI  RYIEV +A+GEDF+ +AGG 
Sbjct: 307 GGVALCLSPLGRRNGEALIRFVCQEHRDMALKRHKHHIGTRYIEVYRASGEDFLAIAGGA 366

Query: 426 NNEAQAFLTRGAQVIIRMRGLPYECTAKQVIDFFEAGTENSCNVMDGEEGVLFVKKPDGK 485
           +NEAQAFL++GAQVIIRMRGLPY+ TAKQV+DFF  G    C+V+DG EGVLFVKKPDG+
Sbjct: 367 SNEAQAFLSKGAQVIIRMRGLPYDATAKQVLDFFTTGDTPPCHVLDGNEGVLFVKKPDGR 426

Query: 486 ATGDAFVLFEKEEEADKALSKHKESIGIRYIELFRSTTAEVQQVLNKTMELPKNNSLTSS 545
           ATGDAFVLF  E +A KAL +H+ESIG RYIELFRSTTAEVQQVLN++M+ PKN      
Sbjct: 427 ATGDAFVLFANETDAPKALGRHRESIGQRYIELFRSTTAEVQQVLNRSMD-PKN----YE 481

Query: 546 NNGLSAQQPMLSHLAQVPVPYLPQ-------------------------------HIITS 574
           + G  +Q P+++ L  + +P LPQ                               H+ITS
Sbjct: 482 SGGGHSQPPLIAQLPTMQLPLLPQVGAHSLSHSLGASPANLCPPVPPPALPLPTQHLITS 541

Query: 575 GTRKDCIRLRGLPYEAL 591
           GT K+CIRLRGLPYEA+
Sbjct: 542 GTTKNCIRLRGLPYEAM 558




mRNA splicing factor that regulates alternative splicing od specific genes. Has a maternal role in embryonic dorsal-ventral patterning; such role is probably indirect and due to its function as mRNA splicing factor regulator.
Drosophila melanogaster (taxid: 7227)
>sp|A1L1G1|ESRP1_DANRE Epithelial splicing regulatory protein 1 OS=Danio rerio GN=esrp1 PE=2 SV=1 Back     alignment and function description
>sp|Q7ZVR8|ESRP2_DANRE Epithelial splicing regulatory protein 2 OS=Danio rerio GN=esrp2 PE=2 SV=2 Back     alignment and function description
>sp|B2RYD2|ESRP1_RAT Epithelial splicing regulatory protein 1 OS=Rattus norvegicus GN=Esrp1 PE=2 SV=2 Back     alignment and function description
>sp|Q3US41|ESRP1_MOUSE Epithelial splicing regulatory protein 1 OS=Mus musculus GN=Esrp1 PE=2 SV=2 Back     alignment and function description
>sp|Q6NXG1|ESRP1_HUMAN Epithelial splicing regulatory protein 1 OS=Homo sapiens GN=ESRP1 PE=1 SV=2 Back     alignment and function description
>sp|Q6DEZ7|ESRP1_XENTR Epithelial splicing regulatory protein 1 OS=Xenopus tropicalis GN=esrp1 PE=2 SV=1 Back     alignment and function description
>sp|Q7ZY29|ESRP1_XENLA Epithelial splicing regulatory protein 1 OS=Xenopus laevis GN=esrp1 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZLR4|ESRP2_CHICK Epithelial splicing regulatory protein 2 OS=Gallus gallus GN=ESRP2 PE=2 SV=1 Back     alignment and function description
>sp|Q9H6T0|ESRP2_HUMAN Epithelial splicing regulatory protein 2 OS=Homo sapiens GN=ESRP2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query612
328716236 858 PREDICTED: RNA-binding protein fusilli-l 0.369 0.263 0.700 6e-91
312385573 1660 hypothetical protein AND_00606 [Anophele 0.351 0.129 0.724 1e-89
194756410 885 GF13378 [Drosophila ananassae] gi|190621 0.361 0.249 0.694 4e-89
170047639677 conserved hypothetical protein [Culex qu 0.351 0.317 0.706 4e-88
281363439 860 fusilli, isoform G [Drosophila melanogas 0.361 0.256 0.690 3e-87
240849679 860 RE48185p [Drosophila melanogaster] 0.361 0.256 0.685 1e-86
195442063 864 GK17961 [Drosophila willistoni] gi|19416 0.359 0.254 0.637 6e-84
194882767 892 GG22342 [Drosophila erecta] gi|190658669 0.361 0.247 0.610 2e-83
158301007 861 AGAP011722-PA [Anopheles gambiae str. PE 0.366 0.260 0.642 6e-83
198461689 910 GA20896 [Drosophila pseudoobscura pseudo 0.367 0.247 0.639 6e-83
>gi|328716236|ref|XP_001946855.2| PREDICTED: RNA-binding protein fusilli-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  341 bits (875), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 166/237 (70%), Positives = 190/237 (80%), Gaps = 11/237 (4%)

Query: 363 LGLGGVALCLSAFGRRNGEAIVRFIDQEHRDMALKRHKHHIDKRYIEVTKANGEDFINVA 422
           +  GGVALCLSA GRRNGEA+VRF++QEHRDMA+KRHKHHI  RYIEV KANGEDFINVA
Sbjct: 291 IAKGGVALCLSAHGRRNGEAVVRFVNQEHRDMAMKRHKHHIGSRYIEVYKANGEDFINVA 350

Query: 423 GGNNNEAQAFLTRGAQVIIRMRGLPYECTAKQVIDFFEAGTENSCNVMDGEEGVLFVKKP 482
           GGN++EAQ FLT+GAQVI+RMRGLPY+CTAK VI FFE G E +C+VMDGE+GVLFVKKP
Sbjct: 351 GGNSSEAQTFLTKGAQVIVRMRGLPYDCTAKDVITFFENG-EQTCSVMDGEDGVLFVKKP 409

Query: 483 DGKATGDAFVLFEKEEEADKALSKHKESIGIRYIELFRSTTAEVQQVLNKTMELPKNNSL 542
           DG+ATGDAFVLF  E++A KALSKH++ IG RYIELFRSTTAEVQQVLN+ M+ P   S 
Sbjct: 410 DGRATGDAFVLFADEDDAPKALSKHRDLIGTRYIELFRSTTAEVQQVLNRAMD-PSVRST 468

Query: 543 TSSNNG---------LSAQQPMLSHLAQVPVPYLPQHIITSGTRKDCIRLRGLPYEA 590
            S +NG                 + L  VP+  LPQH+ITSGTRKDCIRLRGLPYEA
Sbjct: 469 ASDSNGNITTPVTTTAGVNNSPTALLGHVPLLPLPQHVITSGTRKDCIRLRGLPYEA 525




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|312385573|gb|EFR30037.1| hypothetical protein AND_00606 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|194756410|ref|XP_001960472.1| GF13378 [Drosophila ananassae] gi|190621770|gb|EDV37294.1| GF13378 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|170047639|ref|XP_001851321.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167870002|gb|EDS33385.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|281363439|ref|NP_001163161.1| fusilli, isoform G [Drosophila melanogaster] gi|272432494|gb|ACZ94433.1| fusilli, isoform G [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|240849679|gb|ACS54296.1| RE48185p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195442063|ref|XP_002068780.1| GK17961 [Drosophila willistoni] gi|194164865|gb|EDW79766.1| GK17961 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|194882767|ref|XP_001975482.1| GG22342 [Drosophila erecta] gi|190658669|gb|EDV55882.1| GG22342 [Drosophila erecta] Back     alignment and taxonomy information
>gi|158301007|ref|XP_320791.4| AGAP011722-PA [Anopheles gambiae str. PEST] gi|157013433|gb|EAA00060.4| AGAP011722-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|198461689|ref|XP_001362087.2| GA20896 [Drosophila pseudoobscura pseudoobscura] gi|198137420|gb|EAL26667.2| GA20896 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query612
FB|FBgn0023441 967 fus "fusilli" [Drosophila mela 0.325 0.205 0.666 2.6e-89
ZFIN|ZDB-GENE-030131-9824 736 esrp2 "epithelial splicing reg 0.343 0.285 0.591 2.6e-72
UNIPROTKB|F1RY52 711 ESRP1 "Uncharacterized protein 0.274 0.236 0.616 5.8e-69
MGI|MGI:1917326 680 Esrp1 "epithelial splicing reg 0.274 0.247 0.622 7.4e-69
RGD|1560481 677 Esrp1 "epithelial splicing reg 0.274 0.248 0.616 1.5e-68
UNIPROTKB|F1LP81 681 Esrp1 "Epithelial-splicing reg 0.274 0.246 0.616 1.5e-68
ZFIN|ZDB-GENE-070112-1732 714 esrp1 "epithelial splicing reg 0.341 0.292 0.568 1.8e-68
UNIPROTKB|F1MVN3 677 ESRP1 "Uncharacterized protein 0.274 0.248 0.616 1.9e-68
UNIPROTKB|Q6DEZ7 687 esrp1 "Epithelial splicing reg 0.274 0.244 0.622 2.5e-68
UNIPROTKB|Q7ZY29 688 esrp1 "Epithelial splicing reg 0.274 0.244 0.622 2.5e-68
FB|FBgn0023441 fus "fusilli" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 697 (250.4 bits), Expect = 2.6e-89, Sum P(3) = 2.6e-89
 Identities = 136/204 (66%), Positives = 163/204 (79%)

Query:   366 GGVALCLSAFGRRNGEAIVRFIDQEHRDMALKRHKHHIDKRYIEVTKANGEDFINVAGGN 425
             GGVALCLS  GRRNGEA++RF+ QEHRDMALKRHKHHI  RYIEV +A+GEDF+ +AGG 
Sbjct:   307 GGVALCLSPLGRRNGEALIRFVCQEHRDMALKRHKHHIGTRYIEVYRASGEDFLAIAGGA 366

Query:   426 NNEAQAFLTRGAQVIIRMRGLPYECTAKQVIDFFEAGTENSCNVMDGEEGVLFVKKPDGK 485
             +NEAQAFL++GAQVIIRMRGLPY+ TAKQV+DFF  G    C+V+DG EGVLFVKKPDG+
Sbjct:   367 SNEAQAFLSKGAQVIIRMRGLPYDATAKQVLDFFTTGDTPPCHVLDGNEGVLFVKKPDGR 426

Query:   486 ATGDAFVLFEKEEEADKALSKHKESIGIRYIELFRSTTAEVQQVLNKTMELPKXXXXXXX 545
             ATGDAFVLF  E +A KAL +H+ESIG RYIELFRSTTAEVQQVLN++M+ PK       
Sbjct:   427 ATGDAFVLFANETDAPKALGRHRESIGQRYIELFRSTTAEVQQVLNRSMD-PKNYESGGG 485

Query:   546 XXXXXAQQPMLSHLAQVPVPYLPQ 569
                  +Q P+++ L  + +P LPQ
Sbjct:   486 H----SQPPLIAQLPTMQLPLLPQ 505


GO:0003729 "mRNA binding" evidence=ISS;NAS
GO:0007173 "epidermal growth factor receptor signaling pathway" evidence=IGI
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
ZFIN|ZDB-GENE-030131-9824 esrp2 "epithelial splicing regulatory protein 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RY52 ESRP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1917326 Esrp1 "epithelial splicing regulatory protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1560481 Esrp1 "epithelial splicing regulatory protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LP81 Esrp1 "Epithelial-splicing regulatory protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070112-1732 esrp1 "epithelial splicing regulatory protein 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MVN3 ESRP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q6DEZ7 esrp1 "Epithelial splicing regulatory protein 1" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|Q7ZY29 esrp1 "Epithelial splicing regulatory protein 1" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query612
cd12741100 cd12741, RRM2_Fusilli, RNA recognition motif 2 in 2e-57
cd1274385 cd12743, RRM3_Fusilli, RNA recognition motif 3 in 2e-41
cd1250880 cd12508, RRM2_ESRPs_Fusilli, RNA recognition motif 1e-39
cd12740107 cd12740, RRM2_ESRP2, RNA recognition motif 2 in ep 4e-37
cd12739109 cd12739, RRM2_ESRP1, RNA recognition motif 2 in ep 7e-37
cd1250981 cd12509, RRM3_ESRPs_Fusilli, RNA recognition motif 1e-29
cd1273880 cd12738, RRM1_Fusilli, RNA recognition motif 1 in 1e-27
cd1274281 cd12742, RRM3_ESRP1_ESRP2, RNA recognition motif i 7e-26
cd1250775 cd12507, RRM1_ESRPs_Fusilli, RNA recognition motif 1e-24
cd1250377 cd12503, RRM1_hnRNPH_GRSF1_like, RNA recognition m 1e-24
cd1273685 cd12736, RRM1_ESRP1, RNA recognition motif 1 in ep 2e-24
cd1250477 cd12504, RRM2_hnRNPH_like, RNA recognition motif 2 4e-24
cd1273780 cd12737, RRM1_ESRP2, RNA recognition motif 1 in ep 2e-23
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 7e-23
cd1273079 cd12730, RRM1_GRSF1, RNA recognition motif 1 in G- 9e-21
cd1250575 cd12505, RRM2_GRSF1, RNA recognition motif 2 in G- 1e-20
cd1273183 cd12731, RRM2_hnRNPH_hnRNPH2_hnRNPF, RNA recogniti 2e-19
cd1272979 cd12729, RRM1_hnRNPH_hnRNPH2_hnRNPF, RNA recogniti 2e-18
cd1273296 cd12732, RRM2_hnRNPH3, RNA recognition motif 2 in 9e-17
cd1250675 cd12506, RRM3_hnRNPH_CRSF1_like, RNA recognition m 1e-14
cd1250272 cd12502, RRM2_RMB19, RNA recognition motif 2 in RN 5e-14
cd1250775 cd12507, RRM1_ESRPs_Fusilli, RNA recognition motif 3e-13
cd1273880 cd12738, RRM1_Fusilli, RNA recognition motif 1 in 5e-13
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 8e-13
cd1274678 cd12746, RRM2_RBM12B, RNA recognition motif 2 in R 1e-12
cd1273780 cd12737, RRM1_ESRP2, RNA recognition motif 1 in ep 4e-12
cd12512101 cd12512, RRM3_RBM12, RNA recognition motif 3 in RN 2e-11
cd1250575 cd12505, RRM2_GRSF1, RNA recognition motif 2 in G- 3e-11
cd1273685 cd12736, RRM1_ESRP1, RNA recognition motif 1 in ep 4e-11
cd1250981 cd12509, RRM3_ESRPs_Fusilli, RNA recognition motif 5e-11
cd1250377 cd12503, RRM1_hnRNPH_GRSF1_like, RNA recognition m 6e-11
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 1e-10
cd1250880 cd12508, RRM2_ESRPs_Fusilli, RNA recognition motif 1e-09
cd1251173 cd12511, RRM2_RBM12_like, RNA recognition motif 2 3e-09
cd1273575 cd12735, RRM3_hnRNPH3, RNA recognition motif 3 in 5e-09
cd1274281 cd12742, RRM3_ESRP1_ESRP2, RNA recognition motif i 8e-09
cd1273476 cd12734, RRM3_hnRNPH_hnRNPH2_hnRNPF, RNA recogniti 9e-09
cd1250377 cd12503, RRM1_hnRNPH_GRSF1_like, RNA recognition m 2e-08
cd1273375 cd12733, RRM3_GRSF1, RNA recognition motif 3 in G- 2e-08
cd1272979 cd12729, RRM1_hnRNPH_hnRNPH2_hnRNPF, RNA recogniti 6e-08
cd1250880 cd12508, RRM2_ESRPs_Fusilli, RNA recognition motif 1e-07
cd1251473 cd12514, RRM4_RBM12_like, RNA recognition motif 4 2e-07
smart0036073 smart00360, RRM, RNA recognition motif 3e-07
pfam0007670 pfam00076, RRM_1, RNA recognition motif 6e-07
cd1251074 cd12510, RRM1_RBM12_like, RNA recognition motif 1 7e-07
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 7e-07
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 8e-07
cd1273079 cd12730, RRM1_GRSF1, RNA recognition motif 1 in G- 1e-06
cd1273183 cd12731, RRM2_hnRNPH_hnRNPH2_hnRNPF, RNA recogniti 1e-06
cd1273685 cd12736, RRM1_ESRP1, RNA recognition motif 1 in ep 2e-06
cd1274479 cd12744, RRM1_RBM12B, RNA recognition motif 1 in R 2e-06
cd1250575 cd12505, RRM2_GRSF1, RNA recognition motif 2 in G- 3e-06
cd1251173 cd12511, RRM2_RBM12_like, RNA recognition motif 2 3e-06
cd1250981 cd12509, RRM3_ESRPs_Fusilli, RNA recognition motif 7e-06
cd1250775 cd12507, RRM1_ESRPs_Fusilli, RNA recognition motif 7e-06
cd1250477 cd12504, RRM2_hnRNPH_like, RNA recognition motif 2 7e-06
cd1273296 cd12732, RRM2_hnRNPH3, RNA recognition motif 2 in 9e-06
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 1e-05
cd1250272 cd12502, RRM2_RMB19, RNA recognition motif 2 in RN 2e-05
cd1273880 cd12738, RRM1_Fusilli, RNA recognition motif 1 in 3e-05
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 3e-05
cd1250477 cd12504, RRM2_hnRNPH_like, RNA recognition motif 2 4e-05
cd1274678 cd12746, RRM2_RBM12B, RNA recognition motif 2 in R 4e-05
cd1251473 cd12514, RRM4_RBM12_like, RNA recognition motif 4 4e-05
cd1273780 cd12737, RRM1_ESRP2, RNA recognition motif 1 in ep 5e-05
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 5e-05
cd1274385 cd12743, RRM3_Fusilli, RNA recognition motif 3 in 1e-04
cd1273079 cd12730, RRM1_GRSF1, RNA recognition motif 1 in G- 1e-04
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 1e-04
cd1250675 cd12506, RRM3_hnRNPH_CRSF1_like, RNA recognition m 3e-04
cd1274775 cd12747, RRM2_RBM12, RNA recognition motif 2 in RN 3e-04
cd1272979 cd12729, RRM1_hnRNPH_hnRNPH2_hnRNPF, RNA recogniti 4e-04
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 4e-04
cd1229172 cd12291, RRM1_La, RNA recognition motif 1 in La au 5e-04
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 5e-04
cd1227172 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Ar 5e-04
cd1251381 cd12513, RRM3_RBM12B, RNA recognition motif 3 in R 8e-04
cd1250675 cd12506, RRM3_hnRNPH_CRSF1_like, RNA recognition m 0.002
cd1250272 cd12502, RRM2_RMB19, RNA recognition motif 2 in RN 0.002
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 0.002
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 0.002
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 0.002
cd1273183 cd12731, RRM2_hnRNPH_hnRNPH2_hnRNPF, RNA recogniti 0.003
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 0.003
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 0.003
cd12740107 cd12740, RRM2_ESRP2, RNA recognition motif 2 in ep 0.004
>gnl|CDD|241185 cd12741, RRM2_Fusilli, RNA recognition motif 2 in Drosophila RNA-binding protein Fusilli and similar proteins Back     alignment and domain information
 Score =  187 bits (477), Expect = 2e-57
 Identities = 76/100 (76%), Positives = 86/100 (86%)

Query: 422 AGGNNNEAQAFLTRGAQVIIRMRGLPYECTAKQVIDFFEAGTENSCNVMDGEEGVLFVKK 481
           AGG NNEAQAFL+RG QVI+RMRGLPY+CTAKQV++FF  G    C+V+DG EGVLFVKK
Sbjct: 1   AGGANNEAQAFLSRGGQVIVRMRGLPYDCTAKQVLEFFTTGDTPPCHVLDGNEGVLFVKK 60

Query: 482 PDGKATGDAFVLFEKEEEADKALSKHKESIGIRYIELFRS 521
           PDG+ATGDAFVLF  EE+A KAL KH+ESIG RYIELFRS
Sbjct: 61  PDGRATGDAFVLFATEEDAPKALGKHRESIGSRYIELFRS 100


This subgroup corresponds to the RRM2 of RNA-binding protein Fusilli which is encoded by Drosophila fusilli (fus) gene. Loss of Fusilli activity causes lethality during embryogenesis in flies. Drosophila Fusilli can regulate endogenous fibroblast growth factor receptor 2 (FGFR2) splicing and functions as a splicing factor. Fusilli contains three RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains), an N-terminal domain with unknown function and a C-terminal domain particularly rich in alanine, glutamine, and serine. . Length = 100

>gnl|CDD|241187 cd12743, RRM3_Fusilli, RNA recognition motif 3 in Drosophila RNA-binding protein Fusilli and similar proteins Back     alignment and domain information
>gnl|CDD|240952 cd12508, RRM2_ESRPs_Fusilli, RNA recognition motif 2 in epithelial splicing regulatory protein ESRP1, ESRP2, Drosophila RNA-binding protein Fusilli and similar proteins Back     alignment and domain information
>gnl|CDD|241184 cd12740, RRM2_ESRP2, RNA recognition motif 2 in epithelial splicing regulatory protein 2 (ESRP2) and similar proteins Back     alignment and domain information
>gnl|CDD|241183 cd12739, RRM2_ESRP1, RNA recognition motif 2 in epithelial splicing regulatory protein 1 (ESRP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240953 cd12509, RRM3_ESRPs_Fusilli, RNA recognition motif 3 in epithelial splicing regulatory protein ESRP1, ESRP2, Drosophila RNA-binding protein Fusilli and similar proteins Back     alignment and domain information
>gnl|CDD|241182 cd12738, RRM1_Fusilli, RNA recognition motif 1 in Drosophila RNA-binding protein Fusilli and similar proteins Back     alignment and domain information
>gnl|CDD|241186 cd12742, RRM3_ESRP1_ESRP2, RNA recognition motif in epithelial splicing regulatory protein ESRP1, ESRP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240951 cd12507, RRM1_ESRPs_Fusilli, RNA recognition motif 1 in epithelial splicing regulatory protein ESRP1, ESRP2, Drosophila RNA-binding protein Fusilli and similar proteins Back     alignment and domain information
>gnl|CDD|240947 cd12503, RRM1_hnRNPH_GRSF1_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, G-rich sequence factor 1 (GRSF-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241180 cd12736, RRM1_ESRP1, RNA recognition motif 1 in epithelial splicing regulatory protein 1 (ESRP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240948 cd12504, RRM2_hnRNPH_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family Back     alignment and domain information
>gnl|CDD|241181 cd12737, RRM1_ESRP2, RNA recognition motif 1 in epithelial splicing regulatory protein 2 (ESRP2) and similar proteins Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|241174 cd12730, RRM1_GRSF1, RNA recognition motif 1 in G-rich sequence factor 1 (GRSF-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240949 cd12505, RRM2_GRSF1, RNA recognition motif 2 in G-rich sequence factor 1 (GRSF-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241175 cd12731, RRM2_hnRNPH_hnRNPH2_hnRNPF, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP H, hnRNP H2, hnRNP F and similar proteins Back     alignment and domain information
>gnl|CDD|241173 cd12729, RRM1_hnRNPH_hnRNPH2_hnRNPF, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP H , hnRNP H2, hnRNP F and similar proteins Back     alignment and domain information
>gnl|CDD|241176 cd12732, RRM2_hnRNPH3, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein H3 (hnRNP H3) and similar proteins Back     alignment and domain information
>gnl|CDD|240950 cd12506, RRM3_hnRNPH_CRSF1_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein hnRNP H protein family, G-rich sequence factor 1 (GRSF-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240946 cd12502, RRM2_RMB19, RNA recognition motif 2 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240951 cd12507, RRM1_ESRPs_Fusilli, RNA recognition motif 1 in epithelial splicing regulatory protein ESRP1, ESRP2, Drosophila RNA-binding protein Fusilli and similar proteins Back     alignment and domain information
>gnl|CDD|241182 cd12738, RRM1_Fusilli, RNA recognition motif 1 in Drosophila RNA-binding protein Fusilli and similar proteins Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|241190 cd12746, RRM2_RBM12B, RNA recognition motif 2 in RNA-binding protein 12B (RBM12B) and similar proteins Back     alignment and domain information
>gnl|CDD|241181 cd12737, RRM1_ESRP2, RNA recognition motif 1 in epithelial splicing regulatory protein 2 (ESRP2) and similar proteins Back     alignment and domain information
>gnl|CDD|240956 cd12512, RRM3_RBM12, RNA recognition motif 3 in RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|240949 cd12505, RRM2_GRSF1, RNA recognition motif 2 in G-rich sequence factor 1 (GRSF-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241180 cd12736, RRM1_ESRP1, RNA recognition motif 1 in epithelial splicing regulatory protein 1 (ESRP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240953 cd12509, RRM3_ESRPs_Fusilli, RNA recognition motif 3 in epithelial splicing regulatory protein ESRP1, ESRP2, Drosophila RNA-binding protein Fusilli and similar proteins Back     alignment and domain information
>gnl|CDD|240947 cd12503, RRM1_hnRNPH_GRSF1_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, G-rich sequence factor 1 (GRSF-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|240952 cd12508, RRM2_ESRPs_Fusilli, RNA recognition motif 2 in epithelial splicing regulatory protein ESRP1, ESRP2, Drosophila RNA-binding protein Fusilli and similar proteins Back     alignment and domain information
>gnl|CDD|240955 cd12511, RRM2_RBM12_like, RNA recognition motif 2 in RNA-binding protein RBM12, RBM12B and similar proteins Back     alignment and domain information
>gnl|CDD|241179 cd12735, RRM3_hnRNPH3, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein H3 (hnRNP H3) and similar proteins Back     alignment and domain information
>gnl|CDD|241186 cd12742, RRM3_ESRP1_ESRP2, RNA recognition motif in epithelial splicing regulatory protein ESRP1, ESRP2 and similar proteins Back     alignment and domain information
>gnl|CDD|241178 cd12734, RRM3_hnRNPH_hnRNPH2_hnRNPF, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein hnRNP H , hnRNP H2, hnRNP F and similar proteins Back     alignment and domain information
>gnl|CDD|240947 cd12503, RRM1_hnRNPH_GRSF1_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, G-rich sequence factor 1 (GRSF-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241177 cd12733, RRM3_GRSF1, RNA recognition motif 3 in G-rich sequence factor 1 (GRSF-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241173 cd12729, RRM1_hnRNPH_hnRNPH2_hnRNPF, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP H , hnRNP H2, hnRNP F and similar proteins Back     alignment and domain information
>gnl|CDD|240952 cd12508, RRM2_ESRPs_Fusilli, RNA recognition motif 2 in epithelial splicing regulatory protein ESRP1, ESRP2, Drosophila RNA-binding protein Fusilli and similar proteins Back     alignment and domain information
>gnl|CDD|240958 cd12514, RRM4_RBM12_like, RNA recognition motif 4 in RNA-binding protein RBM12, RBM12B and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240954 cd12510, RRM1_RBM12_like, RNA recognition motif 1 in RNA-binding protein RBM12, RBM12B and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|241174 cd12730, RRM1_GRSF1, RNA recognition motif 1 in G-rich sequence factor 1 (GRSF-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241175 cd12731, RRM2_hnRNPH_hnRNPH2_hnRNPF, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP H, hnRNP H2, hnRNP F and similar proteins Back     alignment and domain information
>gnl|CDD|241180 cd12736, RRM1_ESRP1, RNA recognition motif 1 in epithelial splicing regulatory protein 1 (ESRP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241188 cd12744, RRM1_RBM12B, RNA recognition motif 1 in RNA-binding protein 12B (RBM12B) and similar proteins Back     alignment and domain information
>gnl|CDD|240949 cd12505, RRM2_GRSF1, RNA recognition motif 2 in G-rich sequence factor 1 (GRSF-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240955 cd12511, RRM2_RBM12_like, RNA recognition motif 2 in RNA-binding protein RBM12, RBM12B and similar proteins Back     alignment and domain information
>gnl|CDD|240953 cd12509, RRM3_ESRPs_Fusilli, RNA recognition motif 3 in epithelial splicing regulatory protein ESRP1, ESRP2, Drosophila RNA-binding protein Fusilli and similar proteins Back     alignment and domain information
>gnl|CDD|240951 cd12507, RRM1_ESRPs_Fusilli, RNA recognition motif 1 in epithelial splicing regulatory protein ESRP1, ESRP2, Drosophila RNA-binding protein Fusilli and similar proteins Back     alignment and domain information
>gnl|CDD|240948 cd12504, RRM2_hnRNPH_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family Back     alignment and domain information
>gnl|CDD|241176 cd12732, RRM2_hnRNPH3, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein H3 (hnRNP H3) and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240946 cd12502, RRM2_RMB19, RNA recognition motif 2 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241182 cd12738, RRM1_Fusilli, RNA recognition motif 1 in Drosophila RNA-binding protein Fusilli and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240948 cd12504, RRM2_hnRNPH_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family Back     alignment and domain information
>gnl|CDD|241190 cd12746, RRM2_RBM12B, RNA recognition motif 2 in RNA-binding protein 12B (RBM12B) and similar proteins Back     alignment and domain information
>gnl|CDD|240958 cd12514, RRM4_RBM12_like, RNA recognition motif 4 in RNA-binding protein RBM12, RBM12B and similar proteins Back     alignment and domain information
>gnl|CDD|241181 cd12737, RRM1_ESRP2, RNA recognition motif 1 in epithelial splicing regulatory protein 2 (ESRP2) and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|241187 cd12743, RRM3_Fusilli, RNA recognition motif 3 in Drosophila RNA-binding protein Fusilli and similar proteins Back     alignment and domain information
>gnl|CDD|241174 cd12730, RRM1_GRSF1, RNA recognition motif 1 in G-rich sequence factor 1 (GRSF-1) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240950 cd12506, RRM3_hnRNPH_CRSF1_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein hnRNP H protein family, G-rich sequence factor 1 (GRSF-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241191 cd12747, RRM2_RBM12, RNA recognition motif 2 in RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|241173 cd12729, RRM1_hnRNPH_hnRNPH2_hnRNPF, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP H , hnRNP H2, hnRNP F and similar proteins Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|240737 cd12291, RRM1_La, RNA recognition motif 1 in La autoantigen (La or LARP3) and similar proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240957 cd12513, RRM3_RBM12B, RNA recognition motif 3 in RNA-binding protein 12B (RBM12B) and similar proteins Back     alignment and domain information
>gnl|CDD|240950 cd12506, RRM3_hnRNPH_CRSF1_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein hnRNP H protein family, G-rich sequence factor 1 (GRSF-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240946 cd12502, RRM2_RMB19, RNA recognition motif 2 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241175 cd12731, RRM2_hnRNPH_hnRNPH2_hnRNPF, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP H, hnRNP H2, hnRNP F and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|241184 cd12740, RRM2_ESRP2, RNA recognition motif 2 in epithelial splicing regulatory protein 2 (ESRP2) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 612
KOG1365|consensus508 100.0
KOG4211|consensus510 100.0
KOG4211|consensus 510 100.0
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.96
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.96
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.96
KOG1365|consensus 508 99.95
KOG0127|consensus 678 99.94
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.94
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.92
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.91
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.91
KOG0117|consensus 506 99.91
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.91
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.9
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.9
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.89
KOG4307|consensus 944 99.86
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.86
KOG0123|consensus 369 99.86
KOG0148|consensus321 99.84
KOG0123|consensus369 99.82
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 99.79
KOG0145|consensus360 99.79
KOG4205|consensus311 99.79
KOG0131|consensus203 99.78
KOG0127|consensus 678 99.77
KOG0148|consensus 321 99.77
KOG0144|consensus 510 99.75
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.75
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.73
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.73
KOG0117|consensus506 99.72
KOG0124|consensus 544 99.68
KOG0147|consensus 549 99.66
KOG0110|consensus725 99.64
KOG0110|consensus725 99.63
KOG0145|consensus360 99.53
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.52
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.48
KOG0109|consensus 346 99.47
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.45
KOG4205|consensus 311 99.42
KOG4307|consensus 944 99.37
KOG0149|consensus247 99.36
KOG4212|consensus 608 99.36
PLN03120260 nucleic acid binding protein; Provisional 99.36
KOG0131|consensus203 99.35
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.35
KOG0125|consensus 376 99.34
KOG0144|consensus 510 99.31
KOG0124|consensus 544 99.29
PLN03121243 nucleic acid binding protein; Provisional 99.29
KOG0105|consensus241 99.25
KOG0146|consensus371 99.25
smart0036272 RRM_2 RNA recognition motif. 99.23
KOG4212|consensus 608 99.19
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.16
KOG0109|consensus 346 99.15
smart0036071 RRM RNA recognition motif. 99.14
KOG0122|consensus270 99.12
KOG0105|consensus241 99.12
KOG0106|consensus216 99.11
PLN03213 759 repressor of silencing 3; Provisional 99.08
KOG0125|consensus376 99.04
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.02
KOG0113|consensus335 99.01
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.01
KOG4207|consensus256 98.97
KOG0108|consensus 435 98.97
KOG0121|consensus153 98.96
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 98.96
KOG0226|consensus290 98.92
KOG0114|consensus124 98.9
smart0036170 RRM_1 RNA recognition motif. 98.89
KOG0126|consensus219 98.87
COG0724306 RNA-binding proteins (RRM domain) [General functio 98.87
KOG0149|consensus247 98.83
PLN03120260 nucleic acid binding protein; Provisional 98.81
KOG0111|consensus 298 98.72
KOG0107|consensus195 98.7
KOG1548|consensus382 98.7
PLN03121243 nucleic acid binding protein; Provisional 98.7
KOG0128|consensus881 98.69
KOG0130|consensus170 98.68
KOG4206|consensus221 98.68
KOG4206|consensus221 98.68
KOG0147|consensus 549 98.65
smart0036272 RRM_2 RNA recognition motif. 98.65
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.63
smart0036071 RRM RNA recognition motif. 98.58
KOG0122|consensus270 98.56
KOG1457|consensus284 98.56
KOG4210|consensus285 98.54
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.52
smart0036170 RRM_1 RNA recognition motif. 98.52
KOG0128|consensus 881 98.47
KOG1457|consensus284 98.43
KOG0108|consensus 435 98.39
PLN03213 759 repressor of silencing 3; Provisional 98.37
KOG4208|consensus214 98.36
KOG1190|consensus492 98.34
KOG1190|consensus492 98.34
KOG0121|consensus153 98.33
KOG0113|consensus335 98.33
KOG4207|consensus256 98.33
KOG4454|consensus267 98.29
KOG0533|consensus243 98.28
KOG0106|consensus216 98.26
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.25
KOG0120|consensus500 98.25
KOG0129|consensus520 98.21
KOG0116|consensus419 98.16
KOG4209|consensus231 98.15
KOG0146|consensus371 98.13
KOG0120|consensus500 98.1
KOG0107|consensus195 98.08
KOG0415|consensus479 98.07
KOG0111|consensus298 98.06
KOG0126|consensus219 98.05
KOG4661|consensus 940 98.02
KOG0153|consensus377 98.01
KOG0132|consensus 894 97.98
KOG0129|consensus 520 97.94
KOG1548|consensus382 97.87
KOG0114|consensus124 97.87
KOG4208|consensus214 97.87
KOG0130|consensus170 97.72
KOG1456|consensus494 97.57
KOG0226|consensus290 97.55
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 97.55
KOG1456|consensus494 97.52
KOG4454|consensus267 97.44
KOG4210|consensus285 97.38
KOG4209|consensus231 97.12
KOG0533|consensus243 96.97
KOG0116|consensus419 96.95
KOG4849|consensus 498 96.91
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 96.9
KOG4661|consensus 940 96.82
KOG0415|consensus479 96.79
KOG0153|consensus377 96.7
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 96.6
KOG0132|consensus 894 96.59
KOG4660|consensus 549 96.49
KOG1995|consensus 351 96.46
KOG1924|consensus 1102 96.31
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 95.71
KOG0112|consensus 975 95.62
KOG0115|consensus275 95.61
KOG0151|consensus 877 95.54
KOG1924|consensus 1102 95.05
COG5175 480 MOT2 Transcriptional repressor [Transcription] 94.93
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 94.79
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 94.48
KOG2314|consensus 698 94.43
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 94.32
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 93.92
KOG1995|consensus351 93.62
KOG2314|consensus 698 93.48
KOG3152|consensus278 93.17
KOG1855|consensus484 93.08
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 92.85
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 92.77
KOG2202|consensus260 91.4
KOG2202|consensus260 91.02
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 90.8
KOG4660|consensus 549 90.74
KOG0112|consensus 975 90.59
KOG4849|consensus498 90.49
COG5175480 MOT2 Transcriptional repressor [Transcription] 90.26
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 90.08
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 90.07
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 89.71
KOG4676|consensus 479 88.79
KOG4676|consensus 479 88.19
KOG4285|consensus350 87.59
KOG1996|consensus378 86.82
KOG0151|consensus 877 86.5
KOG1996|consensus378 86.23
KOG2193|consensus 584 84.84
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 84.65
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 84.55
KOG4285|consensus350 83.23
KOG2591|consensus 684 81.28
>KOG1365|consensus Back     alignment and domain information
Probab=100.00  E-value=5e-36  Score=310.13  Aligned_cols=173  Identities=36%  Similarity=0.495  Sum_probs=134.0

Q ss_pred             Ccc---ccc-hhhcHHHHHHHhhhhhcCcccceEEEEEccCCCCcccceEEecCHHHHHHHHHHHhhccccccCcceEEE
Q psy16116         52 EPI---QGF-KKVLVEHILEFLGEFASNIVYQGVHMVYNSQGQPSGEAFIQMDSEHSAYLAAQLRHNRNMIFGKKQRYIE  127 (612)
Q Consensus        52 ~~~---~~~-~~~~~~~il~f~~~~~~~~~~~gvhmv~n~qg~~sg~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~ry~~  127 (612)
                      ++|   +|| ++|+|||||+|||||+.+|++||||||||.||||||||||||+|+++|..||++|||++|    |.||||
T Consensus       280 kdcvRLRGLPy~AtvEdIL~FlgdFa~~i~f~gVHmv~N~qGrPSGeAFIqm~nae~a~aaaqk~hk~~m----k~RYiE  355 (508)
T KOG1365|consen  280 KDCVRLRGLPYEATVEDILDFLGDFATDIRFQGVHMVLNGQGRPSGEAFIQMRNAERARAAAQKCHKKLM----KSRYIE  355 (508)
T ss_pred             CCeeEecCCChhhhHHHHHHHHHHHhhhcccceeEEEEcCCCCcChhhhhhhhhhHHHHHHHHHHHHhhc----ccceEE
Confidence            666   888 599999999999999999999999999999999999999999999999999999999999    999999


Q ss_pred             EeecCccccceeecCCCCCCCCCCCCCccccCCCCCCCCCCCCCCCCCccCCCCCCCCCChhhhhHHHHHHHHHHHHHHH
Q psy16116        128 VFQCSGEDMNLVLNGVLPPTSPAISPVGKTLLSPGMLPHSSQPLYPQHNTQINPGLSHLDPLVNVHLTQALAQAQYAKSQ  207 (612)
Q Consensus       128 ~f~~~~~~m~~~~~~~~~~~~~~~~~~~~~~~~~~m~p~~~~p~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  207 (612)
                      ||+||+||||.||+|+.-.++ ..+|      +||-||+-...    +++..+|. --|                     
T Consensus       356 vfp~S~eeln~vL~~g~~g~~-~q~P------PP~plp~~g~t----p~qAtpP~-~~w---------------------  402 (508)
T KOG1365|consen  356 VFPCSVEELNEVLSGGLVGQQ-HQVP------PPAPLPFMGQT----PPQATPPQ-QFW---------------------  402 (508)
T ss_pred             EeeccHHHHHHHHhcCccccc-CCCC------CCCCccccCcC----CCCCCCcc-ccc---------------------
Confidence            999999999999999875555 4444      45666654311    11111111 001                     


Q ss_pred             HHHHHHHHHHHHHHHHHhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q psy16116        208 QDNLMLMNQIAAQQMAALNKPHNMALNGHTPTLIPAPSPNALMPPPLNSKSTTIPTNLPALPAVPTSGGYFPQFQL  283 (612)
Q Consensus       208 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~p~p~~~~~~~~~~~~~~~p~~p~~~~~~p~~~~  283 (612)
                                       .+.+++     -+|...-++.|.+++|-+..+..+..+.+-+.|+..++..++-+.+++
T Consensus       403 -----------------~YPSpp-----isP~vPga~tp~a~Yp~~~~~~~p~~~an~~~P~~s~~~V~f~~~Pt~  456 (508)
T KOG1365|consen  403 -----------------SYPSPP-----ISPIVPGAVTPLAIYPIHMSIGVPELVANFTTPEHSVDNVLFTRWPTH  456 (508)
T ss_pred             -----------------cCCCCC-----CCCCCCCCcCceeeeccccccCccccccCCCCCCCccceeeeecCccc
Confidence                             122222     233334677788899999998888888888888887777777665444



>KOG4211|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>KOG1924|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG1924|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query612
2dha_A123 Solution Structure Of The Second Rna Recognition Mo 2e-28
2lxu_A108 Solution Nmr Structure Of The Eukaryotic Rna Recogn 7e-16
2hgm_A126 Nmr Structure Of The Second Qrrm Domain Of Human Hn 2e-15
2db1_A118 Solution Structure Of The Rna Binding Domain In Het 3e-14
2lmi_A107 Nmr Structure Of The Protein Bc040485 From Homo Sap 6e-14
1wg5_A104 Solution Structure Of The First Rrm Domain In Heter 7e-14
2hgl_A136 Nmr Structure Of The First Qrrm Domain Of Human Hnr 7e-14
1wel_A124 Solution Structure Of Rna Binding Domain In Np_0060 2e-08
1wez_A102 Solution Structure Of Rrm Domain In Heterogeneous N 2e-07
2hgn_A139 Nmr Structure Of The Third Qrrm Domain Of Human Hnr 3e-07
2dgw_A91 Solution Structure Of The Second Rna Recognition Mo 4e-06
2dnn_A109 Solution Structure Of Rna Binding Domain In Rna-Bin 2e-04
>pdb|2DHA|A Chain A, Solution Structure Of The Second Rna Recognition Motif In Hypothetical Protein Flj201171 Length = 123 Back     alignment and structure

Iteration: 1

Score = 124 bits (311), Expect = 2e-28, Method: Compositional matrix adjust. Identities = 62/106 (58%), Positives = 76/106 (71%), Gaps = 4/106 (3%) Query: 427 NEAQAFLTRGAQVIIRMRGLPYECTAKQVIDFFEAGTENSCNVMDGEEGVLFVKKPDGKA 486 NE FL++ QVI+RMRGLP+ TA++V+ FF C + G+EG+LFV PDG+ Sbjct: 12 NEVAQFLSKENQVIVRMRGLPFTATAEEVVAFFG----QHCPITGGKEGILFVTYPDGRP 67 Query: 487 TGDAFVLFEKEEEADKALSKHKESIGIRYIELFRSTTAEVQQVLNK 532 TGDAFVLF EE A AL KHK+ +G RYIELFRST AEVQQVLN+ Sbjct: 68 TGDAFVLFACEEYAQNALRKHKDLLGKRYIELFRSTAAEVQQVLNR 113
>pdb|2LXU|A Chain A, Solution Nmr Structure Of The Eukaryotic Rna Recognition Motif, Rrm1, From The Heterogeneous Nuclear Ribonucleoprotein H From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr8614a Length = 108 Back     alignment and structure
>pdb|2HGM|A Chain A, Nmr Structure Of The Second Qrrm Domain Of Human Hnrnp F Length = 126 Back     alignment and structure
>pdb|2DB1|A Chain A, Solution Structure Of The Rna Binding Domain In Heterogeneous Nuclear Ribonucleoprotein F Homolog Length = 118 Back     alignment and structure
>pdb|2LMI|A Chain A, Nmr Structure Of The Protein Bc040485 From Homo Sapiens Length = 107 Back     alignment and structure
>pdb|1WG5|A Chain A, Solution Structure Of The First Rrm Domain In Heterogeneous Nuclear Ribonucleoprotein H Length = 104 Back     alignment and structure
>pdb|2HGL|A Chain A, Nmr Structure Of The First Qrrm Domain Of Human Hnrnp F Length = 136 Back     alignment and structure
>pdb|1WEL|A Chain A, Solution Structure Of Rna Binding Domain In Np_006038 Length = 124 Back     alignment and structure
>pdb|1WEZ|A Chain A, Solution Structure Of Rrm Domain In Heterogeneous Nuclear Ribonucleoprotein H' Length = 102 Back     alignment and structure
>pdb|2HGN|A Chain A, Nmr Structure Of The Third Qrrm Domain Of Human Hnrnp F Length = 139 Back     alignment and structure
>pdb|2DGW|A Chain A, Solution Structure Of The Second Rna Recognition Motif In Rna-Binding Protein 19 Length = 91 Back     alignment and structure
>pdb|2DNN|A Chain A, Solution Structure Of Rna Binding Domain In Rna-Binding Protein 12 Length = 109 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query612
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 1e-39
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 2e-14
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 3e-09
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 2e-39
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 5e-11
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 2e-09
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 2e-39
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 4e-14
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 3e-09
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 6e-37
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 9e-13
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 1e-09
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 8e-33
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 5e-15
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 1e-09
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 8e-33
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 5e-12
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 7e-09
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 5e-32
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 2e-16
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 2e-11
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 2e-30
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 4e-14
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 8e-12
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 2e-28
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 3e-11
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 4e-09
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 3e-28
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 9e-13
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 9e-13
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 5e-28
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 1e-12
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 5e-09
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 2e-26
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 3e-15
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 9e-12
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 1e-24
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 2e-14
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 9e-08
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 2e-23
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 9e-15
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 2e-07
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 2e-10
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 3e-05
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 1e-08
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 1e-07
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 3e-04
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 4e-07
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 4e-06
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-06
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 4e-06
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 8e-04
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 2e-06
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 3e-06
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 3e-06
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 4e-06
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 4e-06
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 7e-06
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 8e-06
2la6_A99 RNA-binding protein FUS; structural genomics, nort 1e-05
2f3j_A177 RNA and export factor binding protein 2; RRM domai 1e-05
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 1e-05
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 1e-05
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 2e-05
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 2e-05
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 2e-05
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-05
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 2e-05
2cph_A107 RNA binding motif protein 19; RNA recognition moti 2e-05
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 2e-05
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 2e-05
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 3e-05
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 3e-05
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 4e-05
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 5e-05
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 5e-05
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 6e-05
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 7e-05
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 8e-05
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 8e-05
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 9e-05
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 1e-04
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 1e-04
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 2e-04
2kt5_A124 RNA and export factor-binding protein 2; chaperone 2e-04
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 2e-04
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 3e-04
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 3e-04
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 3e-04
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 3e-04
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 3e-04
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 3e-04
2dnl_A114 Cytoplasmic polyadenylation element binding protei 3e-04
1x5o_A114 RNA binding motif, single-stranded interacting pro 4e-04
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 5e-04
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 5e-04
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 6e-04
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 6e-04
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 7e-04
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 7e-04
2cqd_A116 RNA-binding region containing protein 1; RNA recog 8e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 8e-04
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 9e-04
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
 Score =  140 bits (354), Expect = 1e-39
 Identities = 42/143 (29%), Positives = 69/143 (48%), Gaps = 12/143 (8%)

Query: 394 MALKRHKHHIDKRYIEVTKANGEDFINVAGGNNNEAQAFLT---RGAQVIIRMRGLPYEC 450
           M    H HH     +      G    ++ GG      + +     G   ++++RGLP+ C
Sbjct: 1   MGSSHHHHHHSSGLV----PRGSHMASMTGGQQMGRGSMMLGPEGGEGFVVKLRGLPWSC 56

Query: 451 TAKQVIDFFEAGTENSCNVMDGEEGVLFVKKPDGKATGDAFVLFEKEEEADKALSKHKES 510
           + + V +F        C + DG  GV F+   +G+ +G+AFV    E++   AL K +ES
Sbjct: 57  SVEDVQNFLS-----DCTIHDGAAGVHFIYTREGRQSGEAFVELGSEDDVKMALKKDRES 111

Query: 511 IGIRYIELFRSTTAEVQQVLNKT 533
           +G RYIE+F+S   E+  VL  +
Sbjct: 112 MGHRYIEVFKSHRTEMDWVLKHS 134


>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query612
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.97
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.97
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.95
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.95
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.94
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.94
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.94
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.94
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.94
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.94
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.93
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.93
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.93
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.93
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.92
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.9
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.89
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.89
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.87
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.86
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.86
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.84
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.84
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.83
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.83
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.82
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.82
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.82
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.81
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.8
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.79
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.77
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.77
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.77
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.76
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.76
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.76
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.76
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.75
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.75
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.74
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.74
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.74
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 99.72
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.71
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.7
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.69
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.69
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.69
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.66
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.65
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.65
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.64
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.64
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.64
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.63
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.63
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.63
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.63
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.62
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.62
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.61
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.61
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.61
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.6
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.6
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.6
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.59
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.59
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.59
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.59
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.59
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.59
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.59
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.58
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.58
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.58
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.58
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.58
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.58
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.58
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.57
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.57
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.57
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.57
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.57
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.57
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.57
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.57
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.57
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.57
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.57
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.56
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.56
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.56
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.56
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.56
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.56
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.56
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.56
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.56
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.56
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.56
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.55
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.55
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.55
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.55
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.55
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.55
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.55
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.55
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.55
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.55
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.55
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.55
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.55
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.55
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.55
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.54
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.54
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.54
2div_A99 TRNA selenocysteine associated protein; structural 99.54
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.54
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.53
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.53
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.53
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.53
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.52
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.52
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.52
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.52
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.51
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.51
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.51
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.5
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.5
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.5
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.5
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.5
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.49
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.49
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.49
2dis_A109 Unnamed protein product; structural genomics, RRM 99.49
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.49
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.48
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.48
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.48
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.47
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.47
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.46
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.45
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.45
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.45
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.44
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.44
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.44
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.44
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.43
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.43
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.43
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.43
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.43
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.42
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.14
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.42
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.42
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.42
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.42
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.41
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.41
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.41
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.41
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.41
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.41
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.41
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.4
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.4
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.39
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.39
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.39
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.39
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.38
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.38
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.38
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.38
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.38
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.38
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.38
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.37
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.36
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.35
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.35
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.34
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.34
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.34
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.34
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.34
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.34
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.32
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.32
1x5p_A97 Negative elongation factor E; structure genomics, 99.31
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.28
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.28
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.27
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.27
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.27
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.26
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.26
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.25
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.25
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.25
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.24
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.24
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.24
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.23
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.23
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.22
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.22
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.22
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.22
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.22
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.21
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.21
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.21
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.21
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.2
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.2
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.19
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.19
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.19
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.18
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.18
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.18
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.18
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.17
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.17
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.17
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.17
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.16
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.16
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.16
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.16
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.16
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.16
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.16
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.16
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.16
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.16
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.16
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.15
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.14
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.14
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.14
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.14
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.14
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.13
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.13
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.13
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.13
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.12
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.12
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.12
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.12
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.12
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.11
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.11
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.11
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.11
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.11
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.11
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.11
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.11
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.11
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.1
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.1
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.1
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.1
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.1
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.1
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.09
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.09
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.09
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.09
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.09
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.08
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.08
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.08
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.07
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.07
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.06
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.06
2div_A99 TRNA selenocysteine associated protein; structural 99.06
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.05
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.05
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.05
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.04
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.04
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.04
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.03
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.03
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.02
2dis_A109 Unnamed protein product; structural genomics, RRM 99.01
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.01
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.01
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.01
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 98.99
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 98.99
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 98.97
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 98.97
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 98.97
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 98.96
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 98.51
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 98.96
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 98.95
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 98.95
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 98.94
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.93
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 98.93
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 98.92
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 98.92
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 98.92
2f3j_A177 RNA and export factor binding protein 2; RRM domai 98.91
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 98.91
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 98.88
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 98.88
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 98.88
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 98.88
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 98.88
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 98.88
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 98.87
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 98.87
2cpj_A99 Non-POU domain-containing octamer-binding protein; 98.86
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 98.86
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 98.86
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 98.85
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 98.85
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 98.85
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 98.84
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 98.84
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 98.84
2dnl_A114 Cytoplasmic polyadenylation element binding protei 98.84
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.84
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 98.82
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 98.8
2i2y_A150 Fusion protein consists of immunoglobin G- binding 98.8
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 98.8
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 98.79
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 98.78
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 98.78
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 98.77
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 98.77
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 98.75
1x5p_A97 Negative elongation factor E; structure genomics, 98.75
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 98.75
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 98.74
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 98.74
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.73
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 98.7
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 98.7
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 98.7
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 98.69
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 98.69
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 98.69
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 98.64
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 98.62
2dit_A112 HIV TAT specific factor 1 variant; structural geno 98.61
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 98.6
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.6
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 98.59
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 98.45
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.44
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.42
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 98.41
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 98.38
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.24
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.07
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 97.94
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 97.93
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 97.83
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 97.48
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 97.34
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.09
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.05
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 96.06
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 96.01
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 95.08
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 94.79
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 93.62
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 93.25
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 93.2
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 90.65
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 90.48
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 84.53
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 80.91
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
Probab=99.97  E-value=1.2e-30  Score=265.60  Aligned_cols=201  Identities=16%  Similarity=0.062  Sum_probs=156.8

Q ss_pred             ccceecCCCHHHHHhhHhhcccc-cCeeeEEEeeCCCCCCcceEEEEeCCHHHHHHHHHhCCCccCceEEEEeccCccch
Q psy16116        340 LCPLVQNIWLSLLLNTIPGYEQV-LGLGGVALCLSAFGRRNGEAIVRFIDQEHRDMALKRHKHHIDKRYIEVTKANGEDF  418 (612)
Q Consensus       340 l~vlV~nLp~~~~e~~fkeff~~-~~v~~V~ii~d~~GrsrG~AFVeF~S~EdA~kAL~~ng~~IggR~IeV~~s~~~e~  418 (612)
                      .+|+|+|||.+.++++|+++|.. +.+.+|+|+.+.+| ++|||||+|.+.++|++||++++..++|+.|.|..+.    
T Consensus        42 ~~l~V~nLp~~~t~~~l~~~F~~~G~i~~v~i~~~~~~-~~g~afV~f~~~~~A~~A~~~~~~~~~g~~i~v~~~~----  116 (292)
T 2ghp_A           42 TTVLVKNLPKSYNQNKVYKYFKHCGPIIHVDVADSLKK-NFRFARIEFARYDGALAAITKTHKVVGQNEIIVSHLT----  116 (292)
T ss_dssp             CEEEEEEECTTCCHHHHHHHHGGGSCEEEEEEEECTTS-SSEEEEEEESSHHHHHHHHTTTTCEETTEECEEEECC----
T ss_pred             CEEEEeCCCCCCCHHHHHHHHHhcCCeEEEEEEECCCC-CcEEEEEEECCHHHHHHHHHhCCcEeCCcEEEEEECC----
Confidence            34556666666555555555544 45889999998876 5899999999999999999999999999999996542    


Q ss_pred             hhccCCCCcchhhhccCCcccEEEEeCCCCCCCHHHHHHHHhcCCCCccccccCceeEEEeeCCCCCceeEEEEEeCCHH
Q psy16116        419 INVAGGNNNEAQAFLTRGAQVIIRMRGLPYECTAKQVIDFFEAGTENSCNVMDGEEGVLFVKKPDGKATGDAFVLFEKEE  498 (612)
Q Consensus       419 ~~~~g~~~~e~~~~~~~~~~~~VfV~nLP~s~te~dLrefF~~~Gi~~~~Ivd~v~~I~i~~d~~GrskG~AFV~F~s~e  498 (612)
                                         ..+|||+|||+++++++|+++|+.||+       .+..|+++.+..|+++|||||+|.+.+
T Consensus       117 -------------------~~~l~v~nlp~~~t~~~l~~~f~~~G~-------~i~~v~i~~~~~~~~~g~afV~f~~~~  170 (292)
T 2ghp_A          117 -------------------ECTLWMTNFPPSYTQRNIRDLLQDINV-------VALSIRLPSLRFNTSRRFAYIDVTSKE  170 (292)
T ss_dssp             -------------------SCEEEEECCCTTCCHHHHHHHHHHTTC-------CCCEEECC-------CCEEEEECSSHH
T ss_pred             -------------------CCEEEEECCCCCCCHHHHHHHHHHhCC-------CeEEEEEEeCCCCCcceEEEEEECCHH
Confidence                               246999999999999999999999993       346799998888999999999999999


Q ss_pred             HHHHHHH-hCCcccCCEEEEEEecchHHHHHHhhhhcCCCCCCCCCCCCCCCCCcccccccccCCCCCCCCcccccCCCc
Q psy16116        499 EADKALS-KHKESIGIRYIELFRSTTAEVQQVLNKTMELPKNNSLTSSNNGLSAQQPMLSHLAQVPVPYLPQHIITSGTR  577 (612)
Q Consensus       499 dA~kAL~-~~~~~iggR~IeV~~as~~e~~~~~~~~~~~~~~~~~~~e~~~~s~~~~~~~~~s~~p~~~~~~~~~~~~~~  577 (612)
                      +|.+|++ +++..++||.|.|..+.......             +..                            .....
T Consensus       171 ~a~~A~~~l~g~~~~g~~l~v~~a~~~~~~~-------------~~~----------------------------~~~~~  209 (292)
T 2ghp_A          171 DARYCVEKLNGLKIEGYTLVTKVSNPLEKSK-------------RTD----------------------------SATLE  209 (292)
T ss_dssp             HHHHHHHHHTTCEETTEECEEEECCCC--------------------------------------------------CCT
T ss_pred             HHHHHHHHhCCCEeCCcEEEEEECCCCcccc-------------ccc----------------------------ccCCC
Confidence            9999998 89999999999998876332110             000                            00124


Q ss_pred             ccEEEEcCCCcc-CCHHHHHHhhccCCcEeEeeCCC
Q psy16116        578 KDCIRLRGLPYE-ALCILMDIFFVGQQDSFVHKVPK  612 (612)
Q Consensus       578 ~~~VfVrNLPf~-vTeeDLkefFs~~gdI~~~kip~  612 (612)
                      .++|||+|||++ +|+++|+++|+.||.|..+++++
T Consensus       210 ~~~l~v~nlp~~~~t~~~l~~~F~~~G~v~~v~i~~  245 (292)
T 2ghp_A          210 GREIMIRNLSTELLDENLLRESFEGFGSIEKINIPA  245 (292)
T ss_dssp             TTEEEEEEECTTTCCHHHHHHHHGGGSCEEEEECCS
T ss_pred             CceEEEECCCcccCCHHHHHHHHhccCCeeEEEEEe
Confidence            578999999999 99999999999999999888864



>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 612
d1wg5a_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 9e-12
d1wg5a_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-04
d1wg5a_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 0.002
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-11
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-04
d1wela1112 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human 6e-11
d1wela1112 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human 8e-05
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 3e-09
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 8e-08
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 4e-04
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 9e-08
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 2e-06
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 3e-06
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 5e-06
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 2e-05
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-05
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 3e-05
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 8e-05
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 4e-04
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 0.001
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 0.001
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 0.002
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Heterogeneous nuclear ribonucleoprotein H'
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 59.8 bits (144), Expect = 9e-12
 Identities = 36/89 (40%), Positives = 55/89 (61%), Gaps = 7/89 (7%)

Query: 440 IIRMRGLPYECTAKQVIDFFEAGTENSCNVMDGEEGVLFVKKPDGKATGDAFVLFEKEEE 499
            +R+RGLP+ C+ ++++ FF         +     G+       G++TG+AFV F  +E 
Sbjct: 17  FVRLRGLPFGCSKEEIVQFF-------SGLEIVPNGMTLPVDFQGRSTGEAFVQFASQEI 69

Query: 500 ADKALSKHKESIGIRYIELFRSTTAEVQQ 528
           A+KAL KHKE IG RYIE+F+S+ AEV+ 
Sbjct: 70  AEKALKKHKERIGHRYIEIFKSSRAEVRT 98


>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query612
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.94
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.79
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.74
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.72
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.72
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.71
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.71
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.71
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.7
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.7
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.69
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.69
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.68
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.68
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.67
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.67
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.67
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.67
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.66
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.66
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.66
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.66
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.66
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.66
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.65
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.65
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.65
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.65
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.65
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.65
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.64
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.63
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.63
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.63
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.63
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.62
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.62
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.61
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.61
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.61
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.61
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.61
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.61
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.6
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.59
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.59
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.58
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.57
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.57
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.56
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.55
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.5
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.49
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.48
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.48
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.48
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.48
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.47
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.47
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.47
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.46
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.46
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.44
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.44
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.44
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.44
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.44
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.43
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.42
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.41
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.41
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.41
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.4
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.4
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.4
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.39
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.39
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.38
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.37
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.37
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.37
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.35
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.35
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.34
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.34
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.32
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.32
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.3
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.3
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.3
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.3
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.3
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.29
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.29
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.29
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.29
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.29
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.29
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.28
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.27
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.27
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.26
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.26
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.25
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.25
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.25
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.25
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.24
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.24
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.24
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.24
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.24
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.23
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.23
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.23
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.21
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.21
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.21
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.19
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.19
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.18
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.18
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.18
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.15
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.15
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.14
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.13
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.13
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.12
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.08
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.07
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.07
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.06
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.06
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.0
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 98.99
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 98.99
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 98.99
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 98.98
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 98.97
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 98.97
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 98.96
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 98.96
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 98.95
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.93
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 98.92
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 98.92
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 98.92
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.9
d2cpja186 Non-POU domain-containing octamer-binding protein, 98.9
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 98.9
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 98.9
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 98.89
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 98.89
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 98.89
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 98.88
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.87
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.86
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 98.86
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 98.85
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 98.84
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 98.79
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 98.72
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.65
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 98.65
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 98.63
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.6
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 98.57
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 98.45
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.42
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 98.18
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 98.16
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 94.89
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 94.34
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 93.26
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 92.56
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 90.83
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.94  E-value=6.6e-26  Score=213.77  Aligned_cols=156  Identities=20%  Similarity=0.270  Sum_probs=126.9

Q ss_pred             HHHHhhHhhcccccCeeeEEEeeCC-CCCCcceEEEEeCCHHHHHHHHHhCCCccCceEEEEeccCccchhhccCCCCcc
Q psy16116        350 SLLLNTIPGYEQVLGLGGVALCLSA-FGRRNGEAIVRFIDQEHRDMALKRHKHHIDKRYIEVTKANGEDFINVAGGNNNE  428 (612)
Q Consensus       350 ~~~e~~fkeff~~~~v~~V~ii~d~-~GrsrG~AFVeF~S~EdA~kAL~~ng~~IggR~IeV~~s~~~e~~~~~g~~~~e  428 (612)
                      ++++++|+.|+   .+.++.++++. .|+++|||||+|.+.++|++|+..++..++++.+.+......+......     
T Consensus        21 ~~L~~~F~~~G---~v~~~~~~~~~~~~~~~g~afv~f~~~~~a~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----   92 (183)
T d1u1qa_          21 ESLRSHFEQWG---TLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPG-----   92 (183)
T ss_dssp             HHHHHHHGGGS---CEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHTCSCEETTEECEEEECCCTTGGGSTT-----
T ss_pred             HHHHHHHHHcC---CEEEEEeeecccCCCccCceecccCCHHHHHHHHHhcCCcccccchhhhhhhhcccccccc-----
Confidence            55555555554   47888888876 5889999999999999999999999889999988886654432211111     


Q ss_pred             hhhhccCCcccEEEEeCCCCCCCHHHHHHHHhcCCCCccccccCceeEEEeeCC-CCCceeEEEEEeCCHHHHHHHHHhC
Q psy16116        429 AQAFLTRGAQVIIRMRGLPYECTAKQVIDFFEAGTENSCNVMDGEEGVLFVKKP-DGKATGDAFVLFEKEEEADKALSKH  507 (612)
Q Consensus       429 ~~~~~~~~~~~~VfV~nLP~s~te~dLrefF~~~Gi~~~~Ivd~v~~I~i~~d~-~GrskG~AFV~F~s~edA~kAL~~~  507 (612)
                           ......+|||+|||+++|+++|+++|+.||        .+..+.|+.|. +|+++|||||+|.+.++|++||+++
T Consensus        93 -----~~~~~~~i~V~~lp~~~te~~L~~~f~~~G--------~v~~~~i~~~~~~~~~~g~~fV~f~~~e~A~~Al~~~  159 (183)
T d1u1qa_          93 -----AHLTVKKIFVGGIKEDTEEHHLRDYFEQYG--------KIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQK  159 (183)
T ss_dssp             -----TTCCCSEEEEECCCTTCCHHHHHHHHGGGS--------CEEEEEEEECTTTCCEEEEEEEEESCHHHHHHHHTSS
T ss_pred             -----cccccceeEEccCCCcCCHHHHhhhhccCC--------ceeeeeeecccccCccceeEEEEECCHHHHHHHHHhC
Confidence                 112346799999999999999999999999        45679999886 6899999999999999999999999


Q ss_pred             CcccCCEEEEEEecc-hHHH
Q psy16116        508 KESIGIRYIELFRST-TAEV  526 (612)
Q Consensus       508 ~~~iggR~IeV~~as-~~e~  526 (612)
                      ++.++||.|+|..+. ++++
T Consensus       160 ~~~~~G~~i~V~~A~~k~e~  179 (183)
T d1u1qa_         160 YHTVNGHNCEVRKALSKQEM  179 (183)
T ss_dssp             CEEETTEEEEEEECCCHHHH
T ss_pred             CCeECCEEEEEEecCCcccc
Confidence            999999999999984 4444



>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure