Psyllid ID: psy16142


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420------
MKSLSVDTMQIILTIAEWHFLLYLLPWRWEPLLAGLRKKGGTVSISNLGMFGIKNFSAIINPPQACILAVGSLSQRLVREGNDRVALPALSPTMEMGTIVSWAKKEGDKLNEGDLLAEIETDKATMGFETPEEGYLAKILVPAGSKDVPIGKLVCIIVENESDVAAFKDFKDDAPPAAGASAPAPPPPKVAAAPPPPPPKAAPAPSPTPVPSQKTSGGTRVYASPLAKRLAAEKGLDLSSIGAGSGLFGSITSADLSKASKAGAVAAPSKSAKPTANGPFTDLPVSGVRGVIAKRLLQSKQVIKLREQMNKALEKRGAKLSINDFIIKATALASRRVPEANSSWQDTFIREYHSVDVSVAVNTDKGLFTPIVFDADKKGLVDISNDSRSLISFRRPVKFSEESNDVKTLAAKAKEGKLQPHEFQVR
ccccccHHHHHHHHHHHHHHHHHHccccccccccccEEccccEEEEccccccccccEEEEcccccHHcccccccccccccccccccccccccccccEEEEEEEEccccccccccEEEEEEEccEEEEEEccccEEEEEEEccccccccccccEEEEEEcccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccHHHHHHHHHHcccccccccccccccEEEHHHHHHHHHccccccccccccccccccccEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEHHHHHHHHHHHHHHHccccccEEEcccEEEcccccEEEEEEccccEEcccccccccccHHHHHHccccccccccccccccccHHHHHHHHHHHcccccccccccc
cccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEccccccccccccccccccccEEEEccccccccccccccEEEcccccccccccEEEEEEEccccccccccEEEEEEcccEEEEEEcccccEEEEEEEccccEEcccccEEEEEEcccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccEEccHHHHHHHHHccccHHHccccccccccEEHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccEEEHHHHHHHHHHHHHHHccHHcccccccEEEEEcEEEEEEEEEcccccEEEEEEcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHcEcc
MKSLSVDTMQIILTIAEWHFLLYLLpwrwepllaglrkkggtvsisnlgmfgiknfsaiinpPQACILAVGSLSQRLVRegndrvalpalsptmemgTIVSWAKkegdklnegDLLAEIetdkatmgfetpeegYLAKIlvpagskdvpigKLVCIIVEnesdvaafkdfkddappaagasapappppkvaaappppppkaapapsptpvpsqktsggtrvyasPLAKRLAAEkgldlssigagsglfgsitsadlskaskagavaapsksakptangpftdlpvsgvRGVIAKRLLQSKQVIKLREQMNKALEKRGAKLSINDFIIKATALAsrrvpeansswqdTFIREYHSVDVSVavntdkglftpivfdadkkglvdisndsrslisfrrpvkfseesnDVKTLAAKakegklqphefqvr
MKSLSVDTMQIILTIAEWHFLLYLLPWRWEPLLAGLRKKGGTVSISNLGMFGIKNFSAIINPPQACILAVGSLSQRLVREGNDrvalpalsptmemGTIVSWAKKEGDKLNEGDLLAEIETDKATMGFETPEEGYLAKILVPAGSKDVPIGKLVCIIVENESDVAAFKDFKDDAPPAAGASAPAPPPPKVAAAPPPPPPKAAPAPSPTPVPSQKTSGGTRVYASPLAKRLAAEKGLDLSSIGAGSGLFGSITSADLSKASKAGAVAapsksakptangpftdlpvSGVRGVIAKRLLQSKQVIKLREQMNKALekrgaklsiNDFIIKATalasrrvpeansSWQDTFIREYHSVDVSVAVNTDKGLFTPivfdadkkglvdisndsrslisfrrpvkfseesndVKTLaakakegklqphefqvr
MKSLSVDTMQIILTIAEWHFLLYLLPWRWEPLLAGLRKKGGTVSISNLGMFGIKNFSAIINPPQACILAVGSLSQRLVREGNDRVALPALSPTMEMGTIVSWAKKEGDKLNEGDLLAEIETDKATMGFETPEEGYLAKILVPAGSKDVPIGKLVCIIVENESDVaafkdfkddappaagasapappppkvaaappppppkaapapsptpvpSQKTSGGTRVYASPLAKRLAAEKGLDLSSIGAGSGLFGSITSADLSKASKAGAVAAPSKSAKPTANGPFTDLPVSGVRGVIAKRLLQSKQVIKLREQMNKALEKRGAKLSINDFIIKATALASRRVPEANSSWQDTFIREYHSVDVSVAVNTDKGLFTPIVFDADKKGLVDISNDSRSLISFRRPVKFSEESNDVKTLAAKAKEGKLQPHEFQVR
******DTMQIILTIAEWHFLLYLLPWRWEPLLAGLRKKGGTVSISNLGMFGIKNFSAIINPPQACILAVGSLSQRLVREGNDRVALPALSPTMEMGTIVSWAKK****L**GDLLAEIETDKATMGFETPEEGYLAKILVPAGSKDVPIGKLVCIIVENESDVAAF*******************************************************************************************************************LPVSGVRGVIAKRLLQSKQVIKLREQMNKALEKRGAKLSINDFIIKATALASRRVPEANSSWQDTFIREYHSVDVSVAVNTDKGLFTPIVFDADKKGLVDIS******************************************
*********QIILTIAEWHFLLYLLPWRWEPLLAGLRKKGGTVSISNLGMFGIKNFSAIINPPQACILAVGSLSQRLVREGNDRVALPALSPTMEMGTIVSWAKKEGDKLNEGDLLAEIETDKATMGFETPEEGYLAKILVPAGSKDVPIGKLVCIIVENESDV************************************************************PLAKRLAAEKGLDLSSIGAGSGLFGSITSADL**************************LPVSGVRGVIAKRLLQSKQVIKLREQMNKALEKRGAKLSINDFIIKATALASRRVPEANSSWQDTFIREYHSVDVSVAVNTDKGLFTPIVFDADKKGLVDISNDSRSLISFRRPVK*SEE*NDVKTLAAKAKEGKLQP*EFQV*
MKSLSVDTMQIILTIAEWHFLLYLLPWRWEPLLAGLRKKGGTVSISNLGMFGIKNFSAIINPPQACILAVGSLSQRLVREGNDRVALPALSPTMEMGTIVSWAKKEGDKLNEGDLLAEIETDKATMGFETPEEGYLAKILVPAGSKDVPIGKLVCIIVENESDVAAFKDFKDDA**********************************************VYASPLAKRLAAEKGLDLSSIGAGSGLFGSITSADL******************TANGPFTDLPVSGVRGVIAKRLLQSKQVIKLREQMNKALEKRGAKLSINDFIIKATALAS*********WQDTFIREYHSVDVSVAVNTDKGLFTPIVFDADKKGLVDISNDSRSLISFRRPVKFSEESNDVKTLAAKAKEGKLQPHEFQVR
***LSVDTMQIILTIAEWHFLLYLLPWRWEPLLAGLRKKGGTVSISNLGMFGIKNFSAIINPPQACILAVGSLSQRLVREGNDRVALPALSPTMEMGTIVSWAKKEGDKLNEGDLLAEIETDKATMGFETPEEGYLAKILVPAGSKDVPIGKLVCIIVENESDVAAFKD**************************************************RVYASPLAKRLAAEKGLDLSSIGAGSGLFGSITSADLSKASKA*****************FTDLPVSGVRGVIAKRLLQSKQVIKLREQMNKALEKRGAKLSINDFIIKATALASRRVPEANSSWQDTFIREYHSVDVSVAVNTDKGLFTPIVFDADKKGLVDISNDSRSLISFRRPVKFSEESNDVKTLAAKAKEGKLQPH*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSLSVDTMQIILTIAEWHFLLYLLPWRWEPLLAGLRKKGGTVSISNLGMFGIKNFSAIINPPQACILAVGSLSQRLVREGNDRVALPALSPTMEMGTIVSWAKKEGDKLNEGDLLAEIETDKATMGFETPEEGYLAKILVPAGSKDVPIGKLVCIIVENESDVAAFKDFKDDAPPAAGASAPAPPPPKVAAAPPPPPPKAAPAPSPTPVPSQKTSGGTRVYASPLAKRLAAEKGLDLSSIGAGSGLFGSITSADLSKASKAGAVAAPSKSAKPTANGPFTDLPVSGVRGVIAKRLLQSKQVIKLREQMNKALEKRGAKLSINDFIIKATALASRRVPEANSSWQDTFIREYHSVDVSVAVNTDKGLFTPIVFDADKKGLVDISNDSRSLISFRRPVKFSEESNDVKTLAAKAKEGKLQPHEFQVR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query426 2.2.26 [Sep-21-2011]
Q19749507 Dihydrolipoyllysine-resid yes N/A 0.755 0.635 0.542 3e-93
P10515647 Dihydrolipoyllysine-resid yes N/A 0.732 0.482 0.482 5e-79
Q8BMF4642 Dihydrolipoyllysine-resid yes N/A 0.734 0.487 0.497 2e-77
P08461632 Dihydrolipoyllysine-resid yes N/A 0.734 0.495 0.501 1e-76
Q5M729539 Dihydrolipoyllysine-resid yes N/A 0.741 0.586 0.405 2e-64
P12695482 Dihydrolipoyllysine-resid yes N/A 0.748 0.661 0.379 4e-58
Q8RWN9539 Dihydrolipoyllysine-resid no N/A 0.746 0.589 0.391 4e-57
O59816483 Dihydrolipoyllysine-resid yes N/A 0.734 0.648 0.393 2e-56
Q1RJT3418 Dihydrolipoyllysine-resid yes N/A 0.725 0.739 0.371 2e-55
P36413635 Dihydrolipoyllysine-resid yes N/A 0.732 0.491 0.390 6e-55
>sp|Q19749|ODP2_CAEEL Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Caenorhabditis elegans GN=F23B12.5 PE=1 SV=1 Back     alignment and function desciption
 Score =  342 bits (878), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 206/380 (54%), Positives = 253/380 (66%), Gaps = 58/380 (15%)

Query: 76  RLVREGN----DRVALPALSPTMEMGTIVSWAKKEGDKLNEGDLLAEIETDKATMGFETP 131
           RL   GN    +RVALPALSPTME+GT+VSW KKEGD+L+EGDLL EIETDKATMGFETP
Sbjct: 67  RLYSSGNLPKHNRVALPALSPTMELGTVVSWQKKEGDQLSEGDLLCEIETDKATMGFETP 126

Query: 132 EEGYLAKILVPAGSKDVPIGKLVCIIVENESDVAAFKDFKDDAPPAAGASAP----APPP 187
           EEGYLAKIL+  GSKDVPIGKL+CIIV+NE+DVAAFKDFKDD   ++G SAP    AP P
Sbjct: 127 EEGYLAKILIQEGSKDVPIGKLLCIIVDNEADVAAFKDFKDDG-ASSGGSAPAAEKAPEP 185

Query: 188 PKVAAAPPPPPP----KAAPAPSPTPVPSQKTSGGTRVYASPLAKRLAAEKGLDLSSIGA 243
            K AA+  P PP    +A   P   P+P   +SG  RV ASP AK+LAAE GLDLS + +
Sbjct: 186 AKPAASSQPSPPAQMYQAPSVPKSAPIP-HSSSG--RVSASPFAKKLAAENGLDLSGV-S 241

Query: 244 GSGLFGSITSADLSKASKAGAVAAPSKSAKPTANGPFTDLPVSGVRGVIAKRLLQSKQVI 303
           GSG  G I ++DLS+A   GA    S + +  +   +TD+P+S +R  IAKRL +SK  I
Sbjct: 242 GSGPGGRILASDLSQAPAKGAT---STTTQAVSGQDYTDIPLSNMRKTIAKRLTESKSTI 298

Query: 304 ---------------KLREQMNKALEK----RGAKLSINDFIIKATALASRRVPEANSSW 344
                          ++RE++N  L K    +  K+SINDFIIKA+ALA +RVPEANS W
Sbjct: 299 PHYYLTSEIQLDTLLQVREKLNGLLAKGTSGQATKISINDFIIKASALACQRVPEANSYW 358

Query: 345 QDTFIREYHSVDVSVAVNTDKGLFTPIVFDADKKGLVDISNDSRSLISFRRPVKFSEESN 404
            D+FIRE H VDVSVAV+T  GL TPI+F+A  KGL  I                   ++
Sbjct: 359 MDSFIRENHHVDVSVAVSTPAGLITPIIFNAHAKGLATI-------------------AS 399

Query: 405 DVKTLAAKAKEGKLQPHEFQ 424
           ++  LA +A+EGKLQPHEFQ
Sbjct: 400 EIVELAQRAREGKLQPHEFQ 419




The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).
Caenorhabditis elegans (taxid: 6239)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 1EC: 2
>sp|P10515|ODP2_HUMAN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Homo sapiens GN=DLAT PE=1 SV=3 Back     alignment and function description
>sp|Q8BMF4|ODP2_MOUSE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Mus musculus GN=Dlat PE=1 SV=2 Back     alignment and function description
>sp|P08461|ODP2_RAT Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Rattus norvegicus GN=Dlat PE=1 SV=3 Back     alignment and function description
>sp|Q5M729|OPD23_ARATH Dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=At1g54220 PE=1 SV=1 Back     alignment and function description
>sp|P12695|ODP2_YEAST Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAT1 PE=1 SV=1 Back     alignment and function description
>sp|Q8RWN9|OPD22_ARATH Dihydrolipoyllysine-residue acetyltransferase component 2 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=At3g13930 PE=1 SV=2 Back     alignment and function description
>sp|O59816|ODP2_SCHPO Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lat1 PE=3 SV=1 Back     alignment and function description
>sp|Q1RJT3|ODP2_RICBR Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia bellii (strain RML369-C) GN=pdhC PE=3 SV=1 Back     alignment and function description
>sp|P36413|ODP2_DICDI Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Dictyostelium discoideum GN=pdhC PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query426
321463356502 hypothetical protein DAPPUDRAFT_188759 [ 0.744 0.631 0.564 1e-103
328696627492 PREDICTED: dihydrolipoyllysine-residue a 0.730 0.632 0.568 1e-95
332375672501 unknown [Dendroctonus ponderosae] 0.734 0.624 0.557 8e-95
158297231512 AGAP007975-PA [Anopheles gambiae str. PE 0.755 0.628 0.590 9e-95
332023094487 Dihydrolipoyllysine-residue acetyltransf 0.732 0.640 0.560 1e-94
170062538512 dihydrolipoamide acetyltransferase compo 0.755 0.628 0.596 2e-93
157105359503 dihydrolipoamide acetyltransferase compo 0.755 0.640 0.601 2e-93
341883307507 hypothetical protein CAEBREN_15446 [Caen 0.727 0.611 0.529 4e-92
156545418489 PREDICTED: dihydrolipoyllysine-residue a 0.744 0.648 0.587 7e-92
383864431494 PREDICTED: dihydrolipoyllysine-residue a 0.753 0.649 0.583 1e-91
>gi|321463356|gb|EFX74372.1| hypothetical protein DAPPUDRAFT_188759 [Daphnia pulex] Back     alignment and taxonomy information
 Score =  382 bits (980), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 205/363 (56%), Positives = 246/363 (67%), Gaps = 46/363 (12%)

Query: 82  NDRVALPALSPTMEMGTIVSWAKKEGDKLNEGDLLAEIETDKATMGFETPEEGYLAKILV 141
           + RV LPALSPTME GT++SW K+EGDKLNEGDLLAEIETDKATMGFETPEEGYLAKI++
Sbjct: 77  HKRVELPALSPTMESGTLISWEKQEGDKLNEGDLLAEIETDKATMGFETPEEGYLAKIMI 136

Query: 142 PAGSKDVPIGKLVCIIVENESDVAAFKDFKDDAPPAAGASAPAPPPPKVAAAPPPPPPKA 201
           PAGSKDVPIGKLVCIIVE   DVAAFKDFKDD      A+  A   P++          A
Sbjct: 137 PAGSKDVPIGKLVCIIVEKAEDVAAFKDFKDDGAAV--AAPAASQQPEIITPSQSSVATA 194

Query: 202 APAPSPTPVPSQKTSGGTRVYASPLAKRLAAEKGLDLSSIGAGSGLFGSITSADLSKASK 261
           AP PS T   S +     RV+ASPLA+++AAEKG+ L+S+  GSG  GSIT+ DL K S 
Sbjct: 195 APVPSSTAATSSE-----RVFASPLARKMAAEKGISLASVSGGSGFEGSITAKDLDKVSV 249

Query: 262 A-----GAVAAPSKSAKPTANGPFTDLPVSGVRGVIAKRLLQSKQ--------------- 301
           A           +   +  A   +TDLPV+ +RGVIAKRLLQSKQ               
Sbjct: 250 APKPVAAVPPTAAAPIQAVAGQKYTDLPVTNIRGVIAKRLLQSKQSIPHYYLTVDVTMDS 309

Query: 302 VIKLREQMNKALEKRGAKLSINDFIIKATALASRRVPEANSSWQDTFIREYHSVDVSVAV 361
           V+ LR++ N  L K GAKLS+NDF+IKA ALA R+VPE NSSWQ+TFIR+Y +VD+SVAV
Sbjct: 310 VLSLRQEFNTLLGKDGAKLSVNDFVIKAAALACRKVPEVNSSWQETFIRQYDTVDISVAV 369

Query: 362 NTDKGLFTPIVFDADKKGLVDISNDSRSLISFRRPVKFSEESNDVKTLAAKAKEGKLQPH 421
           +TD+GL TPIVF+A++KGL  I                   S DV+TLA KA++GKLQPH
Sbjct: 370 STDRGLITPIVFNAERKGLASI-------------------SADVRTLAGKARDGKLQPH 410

Query: 422 EFQ 424
           EFQ
Sbjct: 411 EFQ 413




Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328696627|ref|XP_001943838.2| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|332375672|gb|AEE62977.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|158297231|ref|XP_317493.4| AGAP007975-PA [Anopheles gambiae str. PEST] gi|157015094|gb|EAA12479.4| AGAP007975-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|332023094|gb|EGI63357.1| Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|170062538|ref|XP_001866712.1| dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase [Culex quinquefasciatus] gi|167880446|gb|EDS43829.1| dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157105359|ref|XP_001648832.1| dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase [Aedes aegypti] gi|108880101|gb|EAT44326.1| AAEL004294-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|341883307|gb|EGT39242.1| hypothetical protein CAEBREN_15446 [Caenorhabditis brenneri] Back     alignment and taxonomy information
>gi|156545418|ref|XP_001606561.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383864431|ref|XP_003707682.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query426
FB|FBgn0031912512 CG5261 [Drosophila melanogaste 0.422 0.351 0.525 5.9e-76
WB|WBGene00009082507 dlat-1 [Caenorhabditis elegans 0.225 0.189 0.752 1.3e-74
UNIPROTKB|H0YDD4479 DLAT "Dihydrolipoyllysine-resi 0.330 0.294 0.496 4.3e-61
UNIPROTKB|F1N690647 DLAT "Dihydrolipoyllysine-resi 0.319 0.210 0.513 8.5e-60
UNIPROTKB|F1SMB2647 DLAT "Dihydrolipoyllysine-resi 0.319 0.210 0.519 1.7e-59
RGD|619859632 Dlat "dihydrolipoamide S-acety 0.330 0.223 0.518 2.3e-59
MGI|MGI:2385311642 Dlat "dihydrolipoamide S-acety 0.330 0.219 0.515 4.3e-59
UNIPROTKB|E2RQS9647 DLAT "Uncharacterized protein" 0.330 0.217 0.509 6.1e-59
UNIPROTKB|E1C6N5632 DLAT "Uncharacterized protein" 0.190 0.128 0.753 6.1e-59
UNIPROTKB|P10515647 DLAT "Dihydrolipoyllysine-resi 0.330 0.217 0.496 2.9e-58
FB|FBgn0031912 CG5261 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 450 (163.5 bits), Expect = 5.9e-76, Sum P(2) = 5.9e-76
 Identities = 105/200 (52%), Positives = 139/200 (69%)

Query:   216 SGGTRVYASPLAKRLAAEKGLDLSSIGAGSGLFGSITSADLS--KASKAGAVAAPSKSAK 273
             +G  RVYASP+AKRLA  + L L   G GSG+ GSI S DL+  KA+   A AAP+K+ +
Sbjct:   220 AGTGRVYASPMAKRLAEAQQLRLQ--GKGSGVHGSIKSGDLAGQKAAAKPAAAAPAKAPR 277

Query:   274 PTANGPFTDLPVSGVRGVIAKRLLQSK------------QV---IKLREQMNKALEKRGA 318
               A   + D+PV+ +R VIAKRLL+SK            QV   +K R ++NK  EK+GA
Sbjct:   278 -AAGARYEDIPVTNMRAVIAKRLLESKTQLPHYYVTVQCQVDKLLKFRAKVNKKYEKQGA 336

Query:   319 KLSINDFIIKATALASRRVPEANSSWQDTFIREYHSVDVSVAVNTDKGLFTPIVFDADKK 378
             ++S+NDFIIKA A+AS +VPEANS+W DT IR+Y  VDVSVAV+TDKGL TPIVF+AD+K
Sbjct:   337 RVSVNDFIIKAVAIASLKVPEANSAWMDTVIRKYDDVDVSVAVSTDKGLITPIVFNADRK 396

Query:   379 GLVDISNDSRSLISFRRPVK 398
             G+++IS D ++L +  R  K
Sbjct:   397 GVLEISKDVKALAAKARDNK 416


GO:0004742 "dihydrolipoyllysine-residue acetyltransferase activity" evidence=ISS
GO:0005967 "mitochondrial pyruvate dehydrogenase complex" evidence=ISS
GO:0006086 "acetyl-CoA biosynthetic process from pyruvate" evidence=ISS
GO:0005811 "lipid particle" evidence=IDA
WB|WBGene00009082 dlat-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|H0YDD4 DLAT "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N690 DLAT "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SMB2 DLAT "Dihydrolipoyllysine-residue acetyltransferase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|619859 Dlat "dihydrolipoamide S-acetyltransferase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2385311 Dlat "dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RQS9 DLAT "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1C6N5 DLAT "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P10515 DLAT "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q19749ODP2_CAEEL2, ., 3, ., 1, ., 1, 20.54210.75580.6351yesN/A
Q68WK6ODP2_RICTY2, ., 3, ., 1, ., 1, 20.36130.70180.7400yesN/A
Q4ULG1ODP2_RICFE2, ., 3, ., 1, ., 1, 20.35830.71360.7378yesN/A
P12695ODP2_YEAST2, ., 3, ., 1, ., 1, 20.37930.74880.6618yesN/A
O66119ODP2_ZYMMO2, ., 3, ., 1, ., 1, 20.34560.73230.7090yesN/A
Q9R9N3ODP2_RHIME2, ., 3, ., 1, ., 1, 20.38420.74410.7091yesN/A
Q9ZD20ODP2_RICPR2, ., 3, ., 1, ., 1, 20.36130.71120.7426yesN/A
P08461ODP2_RAT2, ., 3, ., 1, ., 1, 20.50130.73470.4952yesN/A
Q1RJT3ODP2_RICBR2, ., 3, ., 1, ., 1, 20.37150.72530.7392yesN/A
O59816ODP2_SCHPO2, ., 3, ., 1, ., 1, 20.39340.73470.6480yesN/A
Q92HK7ODP2_RICCN2, ., 3, ., 1, ., 1, 20.36460.70890.7330yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.10.766
3rd Layer2.3.1.120.824

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query426
TIGR01349436 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase 1e-119
PLN02744539 PLN02744, PLN02744, dihydrolipoyllysine-residue ac 2e-99
PRK11856411 PRK11856, PRK11856, branched-chain alpha-keto acid 2e-91
COG0508404 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogena 5e-75
PRK11855547 PRK11855, PRK11855, dihydrolipoamide acetyltransfe 5e-52
PRK05704407 PRK05704, PRK05704, dihydrolipoamide succinyltrans 2e-50
TIGR01347403 TIGR01347, sucB, 2-oxoglutarate dehydrogenase comp 9e-43
PRK11892 464 PRK11892, PRK11892, pyruvate dehydrogenase subunit 2e-36
PRK11854633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipo 8e-33
TIGR01348546 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase 1e-32
pfam00198212 pfam00198, 2-oxoacid_dh, 2-oxoacid dehydrogenases 6e-32
PTZ00144418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 9e-32
TIGR02927579 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena 3e-31
cd0684974 cd06849, lipoyl_domain, Lipoyl domain of the dihyd 7e-27
cd0666373 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_ 4e-17
PRK14875371 PRK14875, PRK14875, acetoin dehydrogenase E2 subun 7e-16
PLN02226463 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E 1e-15
pfam00198212 pfam00198, 2-oxoacid_dh, 2-oxoacid dehydrogenases 3e-14
PRK11855 547 PRK11855, PRK11855, dihydrolipoamide acetyltransfe 4e-14
PRK11856411 PRK11856, PRK11856, branched-chain alpha-keto acid 2e-13
TIGR01349436 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase 4e-13
pfam0036473 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme 8e-13
PRK14843347 PRK14843, PRK14843, dihydrolipoamide acetyltransfe 3e-12
PLN02528416 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase 3e-12
TIGR02927 579 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena 3e-11
PRK11857306 PRK11857, PRK11857, dihydrolipoamide acetyltransfe 2e-10
PLN02744539 PLN02744, PLN02744, dihydrolipoyllysine-residue ac 3e-10
COG0508404 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogena 7e-10
PRK11854 633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipo 2e-09
pfam0281739 pfam02817, E3_binding, e3 binding domain 8e-09
PRK11854 633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipo 4e-07
TIGR01348 546 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase 2e-06
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 3e-06
PRK11855547 PRK11855, PRK11855, dihydrolipoamide acetyltransfe 1e-05
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 1e-05
PRK14843347 PRK14843, PRK14843, dihydrolipoamide acetyltransfe 2e-05
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 3e-05
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 3e-05
PTZ00144418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 9e-05
cd0685067 cd06850, biotinyl_domain, The biotinyl-domain or b 9e-05
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-04
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 1e-04
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-04
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 2e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 2e-04
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 3e-04
pfam10152147 pfam10152, DUF2360, Predicted coiled-coil domain-c 3e-04
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 3e-04
PLN02528416 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase 4e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 4e-04
PRK05704407 PRK05704, PRK05704, dihydrolipoamide succinyltrans 5e-04
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 5e-04
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 6e-04
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 6e-04
PTZ00436357 PTZ00436, PTZ00436, 60S ribosomal protein L19-like 6e-04
PRK06995 484 PRK06995, flhF, flagellar biosynthesis regulator F 6e-04
PRK0822570 PRK08225, PRK08225, acetyl-CoA carboxylase biotin 8e-04
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 9e-04
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 0.001
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 0.001
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 0.001
PRK10547 670 PRK10547, PRK10547, chemotaxis protein CheA; Provi 0.001
PTZ00436357 PTZ00436, PTZ00436, 60S ribosomal protein L19-like 0.002
pfam04625407 pfam04625, DEC-1_N, DEC-1 protein, N-terminal regi 0.002
PRK06549130 PRK06549, PRK06549, acetyl-CoA carboxylase biotin 0.002
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 0.002
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 0.002
PLN02983274 PLN02983, PLN02983, biotin carboxyl carrier protei 0.002
PLN02983274 PLN02983, PLN02983, biotin carboxyl carrier protei 0.003
PRK14971614 PRK14971, PRK14971, DNA polymerase III subunits ga 0.003
PHA03264416 PHA03264, PHA03264, envelope glycoprotein D; Provi 0.003
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 0.003
PHA0173294 PHA01732, PHA01732, proline-rich protein 0.003
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 0.003
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 0.004
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 0.004
>gnl|CDD|233367 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
 Score =  353 bits (907), Expect = e-119
 Identities = 175/368 (47%), Positives = 222/368 (60%), Gaps = 50/368 (13%)

Query: 85  VALPALSPTMEMGTIVSWAKKEGDKLNEGDLLAEIETDKATMGFETPEEGYLAKILVPAG 144
           + +PALSPTM  G +  W KKEGDK+N GD++AEIETDKATM FE  EEGYLAKILVP G
Sbjct: 2   ITMPALSPTMTTGNLAKWLKKEGDKVNPGDVIAEIETDKATMEFEAVEEGYLAKILVPEG 61

Query: 145 SKDVPIGKLVCIIVENESDVA-AFKDFK--DDAPPAAGASAPAPPPPKVAAAPPPPPPKA 201
           +KDVP+ K + ++VE + DVA AFK++K    A PA   S  AP  P  A  P P P K 
Sbjct: 62  TKDVPVNKPIAVLVEEKEDVADAFKNYKLESSASPAPKPSEIAPTAPPSAPKPSPAPQKQ 121

Query: 202 APAPSPTPVPSQKTSGGTRVYASPLAKRLAAEKGLDLSSIGAGSGLFGSITSADL----- 256
           +P PS  P P      G R++ASPLAK+LA EKG+DLS++ AGSG  G I   D+     
Sbjct: 122 SPEPSS-PAPLSDKESGDRIFASPLAKKLAKEKGIDLSAV-AGSGPNGRIVKKDIESFVP 179

Query: 257 -----SKASKAGAVAAPSKSAKPTANGPFTDLPVSGVRGVIAKRLLQSKQ---------- 301
                +    A    A   +A P + G + D+P+S +R +IAKRLL+SKQ          
Sbjct: 180 QSPASANQQAAATTPATYPAAAPVSTGSYEDVPLSNIRKIIAKRLLESKQTIPHYYVSIE 239

Query: 302 -----VIKLREQMNKALEKRGAKLSINDFIIKATALASRRVPEANSSWQDTFIREYHSVD 356
                ++ LR+++N    +   KLS+NDFIIKA+ALA R VPEANSSW D FIR Y +VD
Sbjct: 240 CNVDKLLALRKELNAMASEV-YKLSVNDFIIKASALALREVPEANSSWTDNFIRRYKNVD 298

Query: 357 VSVAVNTDKGLFTPIVFDADKKGLVDISNDSRSLISFRRPVKFSEESNDVKTLAAKAKEG 416
           +SVAV T  GL TPIV +AD KGL  I                   SN++K LA +A+  
Sbjct: 299 ISVAVATPDGLITPIVRNADAKGLSTI-------------------SNEIKDLAKRARNN 339

Query: 417 KLQPHEFQ 424
           KL+P EFQ
Sbjct: 340 KLKPEEFQ 347


This model represents one of several closely related clades of the dihydrolipoamide acetyltransferase subunit of the pyruvate dehydrogenase complex. It includes sequences from mitochondria and from alpha and beta branches of the proteobacteria, as well as from some other bacteria. Sequences from Gram-positive bacteria are not included. The non-enzymatic homolog protein X, which serves as an E3 component binding protein, falls within the clade phylogenetically but is rejected by its low score [Energy metabolism, Pyruvate dehydrogenase]. Length = 436

>gnl|CDD|215397 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Back     alignment and domain information
>gnl|CDD|237001 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>gnl|CDD|223582 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|235571 PRK05704, PRK05704, dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>gnl|CDD|233365 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) Back     alignment and domain information
>gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|215782 pfam00198, 2-oxoacid_dh, 2-oxoacid dehydrogenases acyltransferase (catalytic domain) Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|133458 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|177871 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 component Back     alignment and domain information
>gnl|CDD|215782 pfam00198, 2-oxoacid_dh, 2-oxoacid dehydrogenases acyltransferase (catalytic domain) Back     alignment and domain information
>gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|237001 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>gnl|CDD|233367 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|201182 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme Back     alignment and domain information
>gnl|CDD|184847 PRK14843, PRK14843, dihydrolipoamide acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|215289 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase E2 component Back     alignment and domain information
>gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|237002 PRK11857, PRK11857, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|215397 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Back     alignment and domain information
>gnl|CDD|223582 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|202412 pfam02817, E3_binding, e3 binding domain Back     alignment and domain information
>gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184847 PRK14843, PRK14843, dihydrolipoamide acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|220603 pfam10152, DUF2360, Predicted coiled-coil domain-containing protein (DUF2360) Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|215289 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase E2 component Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|235571 PRK05704, PRK05704, dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|185616 PTZ00436, PTZ00436, 60S ribosomal protein L19-like protein; Provisional Back     alignment and domain information
>gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|181304 PRK08225, PRK08225, acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236712 PRK10547, PRK10547, chemotaxis protein CheA; Provisional Back     alignment and domain information
>gnl|CDD|185616 PTZ00436, PTZ00436, 60S ribosomal protein L19-like protein; Provisional Back     alignment and domain information
>gnl|CDD|113398 pfam04625, DEC-1_N, DEC-1 protein, N-terminal region Back     alignment and domain information
>gnl|CDD|235826 PRK06549, PRK06549, acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|215533 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>gnl|CDD|215533 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223029 PHA03264, PHA03264, envelope glycoprotein D; Provisional Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|222828 PHA01732, PHA01732, proline-rich protein Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 426
KOG0557|consensus470 100.0
PLN02744539 dihydrolipoyllysine-residue acetyltransferase comp 100.0
PRK05704407 dihydrolipoamide succinyltransferase; Validated 100.0
TIGR01347403 sucB 2-oxoglutarate dehydrogenase complex dihydrol 100.0
TIGR02927590 SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo 100.0
TIGR01349435 PDHac_trf_mito pyruvate dehydrogenase complex dihy 100.0
COG0508404 AceF Pyruvate/2-oxoglutarate dehydrogenase complex 100.0
TIGR01348546 PDHac_trf_long pyruvate dehydrogenase complex dihy 100.0
PLN02528416 2-oxoisovalerate dehydrogenase E2 component 100.0
PRK11854633 aceF pyruvate dehydrogenase dihydrolipoyltransacet 100.0
PRK11855547 dihydrolipoamide acetyltransferase; Reviewed 100.0
PRK11856411 branched-chain alpha-keto acid dehydrogenase subun 100.0
PLN02226463 2-oxoglutarate dehydrogenase E2 component 100.0
PTZ00144418 dihydrolipoamide succinyltransferase; Provisional 100.0
KOG0558|consensus474 100.0
KOG0559|consensus457 100.0
PRK14843347 dihydrolipoamide acetyltransferase; Provisional 100.0
PRK11857306 dihydrolipoamide acetyltransferase; Reviewed 100.0
PF00198231 2-oxoacid_dh: 2-oxoacid dehydrogenases acyltransfe 99.96
PRK12270 1228 kgd alpha-ketoglutarate decarboxylase; Reviewed 99.92
PF0036474 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: 99.61
PRK14843347 dihydrolipoamide acetyltransferase; Provisional 99.59
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 99.58
TIGR02927590 SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo 99.55
PRK11857306 dihydrolipoamide acetyltransferase; Reviewed 99.55
PLN02226463 2-oxoglutarate dehydrogenase E2 component 99.55
PRK0674883 hypothetical protein; Validated 99.54
KOG0559|consensus457 99.53
PF00198231 2-oxoacid_dh: 2-oxoacid dehydrogenases acyltransfe 99.53
PTZ00144418 dihydrolipoamide succinyltransferase; Provisional 99.51
TIGR01347403 sucB 2-oxoglutarate dehydrogenase complex dihydrol 99.5
PRK05704407 dihydrolipoamide succinyltransferase; Validated 99.5
PLN02528416 2-oxoisovalerate dehydrogenase E2 component 99.5
TIGR01349435 PDHac_trf_mito pyruvate dehydrogenase complex dihy 99.48
PLN02744539 dihydrolipoyllysine-residue acetyltransferase comp 99.47
TIGR01348546 PDHac_trf_long pyruvate dehydrogenase complex dihy 99.46
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabo 99.4
PRK11892 464 pyruvate dehydrogenase subunit beta; Provisional 99.37
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl ca 99.36
KOG0558|consensus474 99.32
PF0281739 E3_binding: e3 binding domain; InterPro: IPR004167 99.31
COG0508404 AceF Pyruvate/2-oxoglutarate dehydrogenase complex 99.31
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier pro 99.24
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar 99.24
PRK11854 633 aceF pyruvate dehydrogenase dihydrolipoyltransacet 99.19
PRK12270 1228 kgd alpha-ketoglutarate decarboxylase; Reviewed 99.18
PRK06549130 acetyl-CoA carboxylase biotin carboxyl carrier pro 99.15
PRK05641153 putative acetyl-CoA carboxylase biotin carboxyl ca 99.08
TIGR00531156 BCCP acetyl-CoA carboxylase, biotin carboxyl carri 99.07
KOG0557|consensus470 99.07
PRK06302155 acetyl-CoA carboxylase biotin carboxyl carrier pro 99.05
PRK11856411 branched-chain alpha-keto acid dehydrogenase subun 99.04
PRK0705180 hypothetical protein; Validated 99.03
PLN02983274 biotin carboxyl carrier protein of acetyl-CoA carb 99.02
PRK14042596 pyruvate carboxylase subunit B; Provisional 98.96
PRK11855 547 dihydrolipoamide acetyltransferase; Reviewed 98.95
cd0685067 biotinyl_domain The biotinyl-domain or biotin carb 98.94
COG4770645 Acetyl/propionyl-CoA carboxylase, alpha subunit [L 98.91
TIGR027121201 urea_carbox urea carboxylase. Members of this fami 98.78
TIGR01108582 oadA oxaloacetate decarboxylase alpha subunit. Thi 98.75
PRK14040593 oxaloacetate decarboxylase; Provisional 98.71
TIGR012351143 pyruv_carbox pyruvate carboxylase. This enzyme pla 98.68
cd0684974 lipoyl_domain Lipoyl domain of the dihydrolipoyl a 98.67
PRK09282592 pyruvate carboxylase subunit B; Validated 98.59
PRK129991146 pyruvate carboxylase; Reviewed 98.55
COG10381149 PycA Pyruvate carboxylase [Energy production and c 98.39
KOG0369|consensus1176 98.06
KOG0238|consensus670 97.99
cd0684896 GCS_H Glycine cleavage H-protein. Glycine cleavage 97.76
KOG0368|consensus 2196 97.54
TIGR03077110 not_gcvH glycine cleavage protein H-like protein, 97.46
PRK00624114 glycine cleavage system protein H; Provisional 97.26
PF1353350 Biotin_lipoyl_2: Biotin-lipoyl like 97.25
PRK01202127 glycine cleavage system protein H; Provisional 97.12
PRK13380144 glycine cleavage system protein H; Provisional 96.99
TIGR00998334 8a0101 efflux pump membrane protein (multidrug res 96.85
PRK09783409 copper/silver efflux system membrane fusion protei 96.8
TIGR01730322 RND_mfp RND family efflux transporter, MFP subunit 96.75
TIGR00527127 gcvH glycine cleavage system H protein. The genome 96.72
PRK10559310 p-hydroxybenzoic acid efflux subunit AaeA; Provisi 96.58
PRK10476346 multidrug resistance protein MdtN; Provisional 96.53
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl ca 96.47
PRK03598331 putative efflux pump membrane fusion protein; Prov 96.24
PRK15136390 multidrug efflux system protein EmrA; Provisional 96.11
PRK09578385 periplasmic multidrug efflux lipoprotein precursor 96.04
PRK0674883 hypothetical protein; Validated 95.9
PF01597122 GCV_H: Glycine cleavage H-protein; InterPro: IPR00 95.53
PRK09859385 multidrug efflux system protein MdtE; Provisional 95.36
PRK1278484 hypothetical protein; Provisional 95.35
PRK15030397 multidrug efflux system transporter AcrA; Provisio 95.3
cd0685067 biotinyl_domain The biotinyl-domain or biotin carb 95.25
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier pro 95.19
COG0509131 GcvH Glycine cleavage system H protein (lipoate-bi 95.13
PRK11578370 macrolide transporter subunit MacA; Provisional 95.09
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabo 95.07
PRK11556415 multidrug efflux system subunit MdtA; Provisional 94.68
PF13437105 HlyD_3: HlyD family secretion protein 94.42
TIGR03309256 matur_yqeB selenium-dependent molybdenum hydroxyla 94.36
PRK06549130 acetyl-CoA carboxylase biotin carboxyl carrier pro 94.03
TIGR02971327 heterocyst_DevB ABC exporter membrane fusion prote 93.93
PF00302206 CAT: Chloramphenicol acetyltransferase; InterPro: 93.66
PF13375101 RnfC_N: RnfC Barrel sandwich hybrid domain 93.56
PF12700328 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 93.55
PF1353350 Biotin_lipoyl_2: Biotin-lipoyl like 93.5
PF0036474 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: 93.43
PRK05641153 putative acetyl-CoA carboxylase biotin carboxyl ca 92.85
PF00529305 HlyD: HlyD family secretion protein the correspond 92.71
PRK0705180 hypothetical protein; Validated 92.37
cd06250359 M14_PaAOTO_like An uncharacterized subgroup of the 92.1
TIGR00998334 8a0101 efflux pump membrane protein (multidrug res 91.95
cd06253298 M14_ASTE_ASPA_like_3 A functionally uncharacterize 91.7
PRK10476346 multidrug resistance protein MdtN; Provisional 90.44
COG3608331 Predicted deacylase [General function prediction o 90.44
TIGR02971327 heterocyst_DevB ABC exporter membrane fusion prote 90.29
COG4845219 Chloramphenicol O-acetyltransferase [Defense mecha 90.22
cd06251287 M14_ASTE_ASPA_like_1 A functionally uncharacterize 90.17
TIGR02994325 ectoine_eutE ectoine utilization protein EutE. Mem 90.13
cd06252316 M14_ASTE_ASPA_like_2 A functionally uncharacterize 89.93
TIGR01730322 RND_mfp RND family efflux transporter, MFP subunit 89.7
PRK10559310 p-hydroxybenzoic acid efflux subunit AaeA; Provisi 89.18
PRK15136390 multidrug efflux system protein EmrA; Provisional 89.16
PRK03598331 putative efflux pump membrane fusion protein; Prov 88.44
PRK13757219 chloramphenicol acetyltransferase; Provisional 87.62
TIGR00999265 8a0102 Membrane Fusion Protein cluster 2 (function 87.33
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 87.3
TIGR03794421 NHPM_micro_HlyD NHPM bacteriocin system secretion 87.01
TIGR01000457 bacteriocin_acc bacteriocin secretion accessory pr 86.99
PF12700328 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 86.78
PRK11578370 macrolide transporter subunit MacA; Provisional 86.68
TIGR00531156 BCCP acetyl-CoA carboxylase, biotin carboxyl carri 86.17
PRK09859385 multidrug efflux system protein MdtE; Provisional 86.15
PLN02983274 biotin carboxyl carrier protein of acetyl-CoA carb 86.04
PRK11556415 multidrug efflux system subunit MdtA; Provisional 86.0
PRK15030397 multidrug efflux system transporter AcrA; Provisio 85.94
PRK14042596 pyruvate carboxylase subunit B; Provisional 85.85
PRK09578385 periplasmic multidrug efflux lipoprotein precursor 85.73
cd06254288 M14_ASTE_ASPA_like_4 A functionally uncharacterize 85.71
TIGR012351143 pyruv_carbox pyruvate carboxylase. This enzyme pla 85.21
PF05896257 NQRA: Na(+)-translocating NADH-quinone reductase s 84.62
TIGR01108582 oadA oxaloacetate decarboxylase alpha subunit. Thi 83.44
PRK06302155 acetyl-CoA carboxylase biotin carboxyl carrier pro 83.43
PRK09783409 copper/silver efflux system membrane fusion protei 83.38
COG4770645 Acetyl/propionyl-CoA carboxylase, alpha subunit [L 81.82
PRK14040593 oxaloacetate decarboxylase; Provisional 81.77
TIGR03794421 NHPM_micro_HlyD NHPM bacteriocin system secretion 80.84
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 80.51
COG1566352 EmrA Multidrug resistance efflux pump [Defense mec 80.4
>KOG0557|consensus Back     alignment and domain information
Probab=100.00  E-value=5.5e-60  Score=476.06  Aligned_cols=319  Identities=55%  Similarity=0.820  Sum_probs=254.7

Q ss_pred             cccCceEeccCCCCCcccceeeecccccCCccccCcchhhhhcccccceeecCCCeEEEEEeecCCCccccCCcEEEEEE
Q psy16142         79 REGNDRVALPALSPTMEMGTIVSWAKKEGDKLNEGDLLAEIETDKATMGFETPEEGYLAKILVPAGSKDVPIGKLVCIIV  158 (426)
Q Consensus        79 v~~~~~i~mP~lg~s~d~g~i~~w~v~vGd~Ve~gd~L~~vetdK~~~ei~a~~~G~v~~i~v~~G~~~v~vG~~l~~i~  158 (426)
                      ...+..|.||.|+.+|++|.|++|.+++||.++.||+||||||||++|+++++++|+|++|++++|.+.|+||++||+|.
T Consensus        35 ~p~h~~i~MPALSPTMeeGnIvsW~kKeGdkls~GDvl~EVETDKAtmd~E~~ddGyLAKILi~EGskdvpVGk~Iaiiv  114 (470)
T KOG0557|consen   35 LPAHKTFSMPALSPTMEEGNIVSWKKKEGDKLSAGDVLLEVETDKATMDVEAQDDGYLAKILIEEGSKDVPVGKPIAIIV  114 (470)
T ss_pred             CCcceEeecCCCCccccCCceeeEeeccCCccCCCceEEEEecccceeeeeeccCCeeeeeeeccCcccccCCCceEEEe
Confidence            45678899999999999999999999999999999999999999999999999999999999999966899999999999


Q ss_pred             cCCcchhcccCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCccccChHHHHHHHHcC
Q psy16142        159 ENESDVAAFKDFKDDAP--PAAGASAPAPPPPKVAAAPPPPP-PKAAPAPSPTPVPSQKTSGGTRVYASPLAKRLAAEKG  235 (426)
Q Consensus       159 ~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~-~~~~p~~~~~~~~~~~~~~~~~~~asP~aR~lA~e~g  235 (426)
                      +.++++..+..+.++..  ...+..  +++++++....++.| +.+.+..    ..+..+...+++.+||++|+||.|+|
T Consensus       115 e~e~di~~~k~~k~~~s~~~~~~~~--~~~~app~~~~~~~Ps~~~~~~~----~~p~~~~~~~r~~asP~Ak~la~e~~  188 (470)
T KOG0557|consen  115 EDEDDIAAFKLPKDEASSGEQSPSA--APPPAPPKVAKPEAPSAPSKPST----SQPVKAKNGGRVFASPLAKKLAEEKG  188 (470)
T ss_pred             cccccHHHhhccccccccccCCccc--CCCCCCCcccccCCCCCCccccc----cccCCcCCCCceecChHHHHHHHHhC
Confidence            99988877754433210  000111  111111111111100 0000100    00111112458899999999999999


Q ss_pred             CCCcCccCCCCCCCcccchhhhhhhhcCC---CCCC---CCCC---C-CCCCCCceeecCCchhhHHHHHHHhhHHH---
Q psy16142        236 LDLSSIGAGSGLFGSITSADLSKASKAGA---VAAP---SKSA---K-PTANGPFTDLPVSGVRGVIAKRLLQSKQV---  302 (426)
Q Consensus       236 IDl~~v~~gtG~~GrI~~~DV~~~~~~~~---~~~~---~~~~---~-~~~~~~~~~~~ls~~Rk~iA~~m~~S~~~---  302 (426)
                      +|++.| .||||+|||++.||+++.+...   ...+   ..+.   + +...+.++++|++.||+.|++||.+|++.   
T Consensus       189 l~ls~i-~gtGP~Gri~k~Di~~~v~~~~~k~~~~~~~~~~~~~~~a~~~~~~~~~diP~s~mr~viakrl~eSk~~IPh  267 (470)
T KOG0557|consen  189 LELSSI-PGTGPHGRILKGDIEKHVGSGKKKSAKAPKASAPPPAPAAPPVSLPGYEDIPVSNMRRVIAKRLLESKQTIPH  267 (470)
T ss_pred             CccccC-cCcCCCceeehhhHHHhhcccccccccCCCccCCCcCccCCcCCCCcccccccchhhhhhhhhhhhhhcCCCe
Confidence            999999 9999999999999999754211   0000   0000   1 12234489999999999999999999877   


Q ss_pred             ------------HHHHHHHHHHHHHhCCcccHHHHHHHHHHHHhhhcccccceeeC-CceEEcCCCcEEEEeecCCceEe
Q psy16142        303 ------------IKLREQMNKALEKRGAKLSINDFIIKATALASRRVPEANSSWQD-TFIREYHSVDVSVAVNTDKGLFT  369 (426)
Q Consensus       303 ------------~~lr~~~~~~~~~~~~~~s~~~~~~ka~~~al~~~p~~n~~~~~-~~i~~~~~v~i~iAv~~~~GL~~  369 (426)
                                  +++|+++|  +++.+.++|++|||+||++.||+++|++|++|.+ ..|+++++|||++||+|++||++
T Consensus       268 ~yvt~~~~~d~ll~~r~~ln--~~~~~~~vsvndliiKAaa~al~~vPevNs~w~~~~~i~~~~~VdisvAVat~~GLit  345 (470)
T KOG0557|consen  268 YYVTVDVNLDKLLALREKLN--FEKSIKKVSLNDLIAKAAALALAKVPEVNSSWMDELVIRQLSSVDISVAVATPNGLIT  345 (470)
T ss_pred             EEEeeeeehHHHHHHHHHhh--hcccCcccchhHHHHHHHHHHHhcCCcccceecCCccccccCcCChhheeeccCcccc
Confidence                        78888888  5667889999999999999999999999999988 79999999999999999999999


Q ss_pred             ecccCcCCCCHHHHHhccccccccccCcCCccchHHHHHHHHHHHcCCCCcccccC
Q psy16142        370 PIVFDADKKGLVDISNDSRSLISFRRPVKFSEESNDVKTLAAKAKEGKLQPHEFQV  425 (426)
Q Consensus       370 pvi~~a~~~~l~~i~~~~~~~~~~~~~~~~~~~~~~~~~l~~~a~~~~l~~~e~~~  425 (426)
                      |+|+|++.++|.+|++                   ++++|+.|||+|||+||||||
T Consensus       346 Pii~na~~kgl~~is~-------------------~vkel~~kAr~~kL~Pee~qg  382 (470)
T KOG0557|consen  346 PIIQNADAKGLSTISS-------------------KVKELAQKAREGKLQPEEFQG  382 (470)
T ss_pred             hhhhhcccccHHHHHH-------------------HHHHHHHHHhhccCCcccccC
Confidence            9999999999999999                   999999999999999999998



>PLN02744 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Back     alignment and domain information
>PRK05704 dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) Back     alignment and domain information
>TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>PLN02528 2-oxoisovalerate dehydrogenase E2 component Back     alignment and domain information
>PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>PLN02226 2-oxoglutarate dehydrogenase E2 component Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>KOG0558|consensus Back     alignment and domain information
>KOG0559|consensus Back     alignment and domain information
>PRK14843 dihydrolipoamide acetyltransferase; Provisional Back     alignment and domain information
>PRK11857 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>PF00198 2-oxoacid_dh: 2-oxoacid dehydrogenases acyltransferase (catalytic domain); InterPro: IPR001078 This domain is found in the lipoamide acyltransferase component of the branched-chain alpha-keto acid dehydrogenase complex 2 Back     alignment and domain information
>PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid Back     alignment and domain information
>PRK14843 dihydrolipoamide acetyltransferase; Provisional Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>PRK11857 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>PLN02226 2-oxoglutarate dehydrogenase E2 component Back     alignment and domain information
>PRK06748 hypothetical protein; Validated Back     alignment and domain information
>KOG0559|consensus Back     alignment and domain information
>PF00198 2-oxoacid_dh: 2-oxoacid dehydrogenases acyltransferase (catalytic domain); InterPro: IPR001078 This domain is found in the lipoamide acyltransferase component of the branched-chain alpha-keto acid dehydrogenase complex 2 Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) Back     alignment and domain information
>PRK05704 dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>PLN02528 2-oxoisovalerate dehydrogenase E2 component Back     alignment and domain information
>TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>PLN02744 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>KOG0558|consensus Back     alignment and domain information
>PF02817 E3_binding: e3 binding domain; InterPro: IPR004167 A small domain of the E2 subunit of 2-oxo-acid dehydrogenases that is responsible for the binding of the E3 subunit Back     alignment and domain information
>COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein Back     alignment and domain information
>KOG0557|consensus Back     alignment and domain information
>PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>KOG0369|consensus Back     alignment and domain information
>KOG0238|consensus Back     alignment and domain information
>cd06848 GCS_H Glycine cleavage H-protein Back     alignment and domain information
>KOG0368|consensus Back     alignment and domain information
>TIGR03077 not_gcvH glycine cleavage protein H-like protein, Chlamydial Back     alignment and domain information
>PRK00624 glycine cleavage system protein H; Provisional Back     alignment and domain information
>PF13533 Biotin_lipoyl_2: Biotin-lipoyl like Back     alignment and domain information
>PRK01202 glycine cleavage system protein H; Provisional Back     alignment and domain information
>PRK13380 glycine cleavage system protein H; Provisional Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) Back     alignment and domain information
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional Back     alignment and domain information
>TIGR01730 RND_mfp RND family efflux transporter, MFP subunit Back     alignment and domain information
>TIGR00527 gcvH glycine cleavage system H protein Back     alignment and domain information
>PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>PRK03598 putative efflux pump membrane fusion protein; Provisional Back     alignment and domain information
>PRK15136 multidrug efflux system protein EmrA; Provisional Back     alignment and domain information
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed Back     alignment and domain information
>PRK06748 hypothetical protein; Validated Back     alignment and domain information
>PF01597 GCV_H: Glycine cleavage H-protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes Back     alignment and domain information
>PRK09859 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information
>PRK12784 hypothetical protein; Provisional Back     alignment and domain information
>PRK15030 multidrug efflux system transporter AcrA; Provisional Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>COG0509 GcvH Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11578 macrolide transporter subunit MacA; Provisional Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>PF13437 HlyD_3: HlyD family secretion protein Back     alignment and domain information
>TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family Back     alignment and domain information
>PF00302 CAT: Chloramphenicol acetyltransferase; InterPro: IPR001707 Chloramphenicol acetyltransferase (CAT) (2 Back     alignment and domain information
>PF13375 RnfC_N: RnfC Barrel sandwich hybrid domain Back     alignment and domain information
>PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C Back     alignment and domain information
>PF13533 Biotin_lipoyl_2: Biotin-lipoyl like Back     alignment and domain information
>PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) Back     alignment and domain information
>cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>COG3608 Predicted deacylase [General function prediction only] Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family Back     alignment and domain information
>COG4845 Chloramphenicol O-acetyltransferase [Defense mechanisms] Back     alignment and domain information
>cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>TIGR02994 ectoine_eutE ectoine utilization protein EutE Back     alignment and domain information
>cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>TIGR01730 RND_mfp RND family efflux transporter, MFP subunit Back     alignment and domain information
>PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional Back     alignment and domain information
>PRK15136 multidrug efflux system protein EmrA; Provisional Back     alignment and domain information
>PRK03598 putative efflux pump membrane fusion protein; Provisional Back     alignment and domain information
>PRK13757 chloramphenicol acetyltransferase; Provisional Back     alignment and domain information
>TIGR00999 8a0102 Membrane Fusion Protein cluster 2 (function with RND porters) Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C Back     alignment and domain information
>PRK11578 macrolide transporter subunit MacA; Provisional Back     alignment and domain information
>TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein Back     alignment and domain information
>PRK09859 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information
>PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>PRK15030 multidrug efflux system transporter AcrA; Provisional Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed Back     alignment and domain information
>cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>PF05896 NQRA: Na(+)-translocating NADH-quinone reductase subunit A (NQRA); InterPro: IPR008703 This family consists of several bacterial Na+-translocating NADH-quinone reductase subunit A (NQRA) proteins Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query426
3b8k_A239 Structure Of The Truncated Human Dihydrolipoyl Acet 1e-37
1y8n_B128 Crystal Structure Of The Pdk3-L2 Complex Length = 1 1e-28
1fyc_A106 Inner Lipoyl Domain From Human Pyruvate Dehydrogena 2e-28
3crk_C87 Crystal Structure Of The Pdhk2-L2 Complex. Length = 2e-27
2dne_A108 Solution Structure Of Rsgi Ruh-058, A Lipoyl Domain 5e-26
2dnc_A98 Solution Structure Of Rsgi Ruh-054, A Lipoyl Domain 9e-17
1zy8_L229 The Crystal Structure Of Dihydrolipoamide Dehydroge 3e-16
1c4t_A233 Catalytic Domain From Trimeric Dihydrolipoamide Suc 1e-12
3duf_I428 Snapshots Of Catalysis In The E1 Subunit Of The Pyr 2e-11
1b5s_A242 Dihydrolipoyl Transacetylase (E.C.2.3.1.12) Catalyt 8e-10
3mae_A256 Crystal Structure Of Probable Dihydrolipamide Acety 2e-09
1lab_A80 Three-Dimensional Structure Of The Lipoyl Domain Fr 7e-07
2ihw_A262 Crystal Structure Of A Cubic Core Of The Dihydrolip 1e-04
2l5t_A77 Solution Nmr Structure Of E2 Lipoyl Domain From The 2e-04
3l60_A250 Crystal Structure Of Branched-Chain Alpha-Keto Acid 3e-04
3rqc_A224 Crystal Structure Of The Catalytic Core Of The 2-Ox 6e-04
>pdb|3B8K|A Chain A, Structure Of The Truncated Human Dihydrolipoyl Acetyltransferase (E2) Length = 239 Back     alignment and structure

Iteration: 1

Score = 154 bits (389), Expect = 1e-37, Method: Compositional matrix adjust. Identities = 85/166 (51%), Positives = 107/166 (64%), Gaps = 35/166 (21%) Query: 274 PTANGPFTDLPVSGVRGVIAKRLLQSKQ---------------VIKLREQMNKALEKRGA 318 P G FTD+P+S +R VIA+RL+QSKQ V+ +R+++NK LE R + Sbjct: 6 PVPTGVFTDIPISNIRRVIAQRLMQSKQTIPHYYLSIDVNMGEVLLVRKELNKILEGR-S 64 Query: 319 KLSINDFIIKATALASRRVPEANSSWQDTFIREYHSVDVSVAVNTDKGLFTPIVFDADKK 378 K+S+NDFIIKA+ALA +VPEANSSW DT IR+ H VDVSVAV+T GL TPIVF+A K Sbjct: 65 KISVNDFIIKASALACLKVPEANSSWMDTVIRQNHVVDVSVAVSTPAGLITPIVFNAHIK 124 Query: 379 GLVDISNDSRSLISFRRPVKFSEESNDVKTLAAKAKEGKLQPHEFQ 424 G+ I +NDV +LA KA+EGKLQPHEFQ Sbjct: 125 GVETI-------------------ANDVVSLATKAREGKLQPHEFQ 151
>pdb|1Y8N|B Chain B, Crystal Structure Of The Pdk3-L2 Complex Length = 128 Back     alignment and structure
>pdb|1FYC|A Chain A, Inner Lipoyl Domain From Human Pyruvate Dehydrogenase (Pdh) Complex, Nmr, 1 Structure Length = 106 Back     alignment and structure
>pdb|3CRK|C Chain C, Crystal Structure Of The Pdhk2-L2 Complex. Length = 87 Back     alignment and structure
>pdb|2DNE|A Chain A, Solution Structure Of Rsgi Ruh-058, A Lipoyl Domain Of Human 2-Oxoacid Dehydrogenase Length = 108 Back     alignment and structure
>pdb|2DNC|A Chain A, Solution Structure Of Rsgi Ruh-054, A Lipoyl Domain From Human 2-Oxoacid Dehydrogenase Length = 98 Back     alignment and structure
>pdb|1C4T|A Chain A, Catalytic Domain From Trimeric Dihydrolipoamide Succinyltransferase Length = 233 Back     alignment and structure
>pdb|3DUF|I Chain I, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 428 Back     alignment and structure
>pdb|1B5S|A Chain A, Dihydrolipoyl Transacetylase (E.C.2.3.1.12) Catalytic Domain (Residues 184-425) From Bacillus Stearothermophilus Length = 242 Back     alignment and structure
>pdb|3MAE|A Chain A, Crystal Structure Of Probable Dihydrolipamide Acetyltransferase From Listeria Monocytogenes 4b F2365 Length = 256 Back     alignment and structure
>pdb|1LAB|A Chain A, Three-Dimensional Structure Of The Lipoyl Domain From Bacillus Stearothermophilus Pyruvate Dehydrogenase Multienzyme Complex Length = 80 Back     alignment and structure
>pdb|2IHW|A Chain A, Crystal Structure Of A Cubic Core Of The Dihydrolipoamide Acyltransferase (E2b) Component In The Branched-Chain Alpha-Ketoacid Dehydrogenase Complex (Bckdc), Apo Form Length = 262 Back     alignment and structure
>pdb|2L5T|A Chain A, Solution Nmr Structure Of E2 Lipoyl Domain From Thermoplasma Acidophilum Length = 77 Back     alignment and structure
>pdb|3L60|A Chain A, Crystal Structure Of Branched-Chain Alpha-Keto Acid Dehydrogenase Subunit E2 From Mycobacterium Tuberculosis Length = 250 Back     alignment and structure
>pdb|3RQC|A Chain A, Crystal Structure Of The Catalytic Core Of The 2-Oxoacid Dehydrogenase Multienzyme Complex From Thermoplasma Acidophilum Length = 224 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query426
1zy8_K229 Pyruvate dehydrogenase protein X component, mitoch 4e-71
3dva_I428 Dihydrolipoyllysine-residue acetyltransferase comp 1e-70
3dva_I428 Dihydrolipoyllysine-residue acetyltransferase comp 4e-06
3b8k_A239 PDCE2;, dihydrolipoyllysine-residue acetyltransfer 2e-56
3b8k_A239 PDCE2;, dihydrolipoyllysine-residue acetyltransfer 6e-19
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase COM 5e-49
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase comp 5e-49
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic 2e-44
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase COM 1e-38
3l60_A250 Branched-chain alpha-keto acid dehydrogenase; stru 9e-31
3l60_A250 Branched-chain alpha-keto acid dehydrogenase; stru 8e-12
3mae_A256 2-oxoisovalerate dehydrogenase E2 component, dihyd 2e-26
3mae_A256 2-oxoisovalerate dehydrogenase E2 component, dihyd 6e-06
2ii3_A262 Lipoamide acyltransferase component of branched-C 7e-26
2ii3_A262 Lipoamide acyltransferase component of branched-C 3e-08
1dpb_A243 Dihydrolipoyl-transacetylase; dihydrolipoamide ace 5e-24
1dpb_A243 Dihydrolipoyl-transacetylase; dihydrolipoamide ace 9e-08
3rqc_A224 Probable lipoamide acyltransferase; alpha beta fol 6e-23
3rqc_A224 Probable lipoamide acyltransferase; alpha beta fol 5e-08
1scz_A233 E2, dihydrolipoamide succinyltransferase; COA-depe 2e-20
1scz_A233 E2, dihydrolipoamide succinyltransferase; COA-depe 5e-05
2l5t_A77 Lipoamide acyltransferase; E2 lipoyl domain; NMR { 3e-12
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehy 8e-12
1q23_A219 Chloramphenicol acetyltransferase; CAT I, trimer, 2e-11
1q23_A219 Chloramphenicol acetyltransferase; CAT I, trimer, 1e-04
3cla_A213 Type III chloramphenicol acetyltransferase; transf 4e-11
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase c 5e-11
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate 8e-11
1w4i_A62 Pyruvate dehydrogenase E2; transferase, peripheral 4e-10
2coo_A70 Lipoamide acyltransferase component of branched- c 2e-08
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, 2e-08
1w85_I49 Dihydrolipoyllysine-residue acetyltransferase comp 7e-08
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 9e-08
3rnm_E58 Lipoamide acyltransferase component of branched-C 1e-07
2eq9_C41 Pyruvate dehydrogenase complex, dihydrolipoamide a 2e-06
1bal_A51 Dihydrolipoamide succinyltransferase; glycolysis; 7e-06
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase comp 1e-05
2eq7_C40 2-oxoglutarate dehydrogenase E2 component; protein 1e-05
2i9d_A217 Chloramphenicol acetyltransferase; structural geno 2e-05
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl dom 3e-05
2eq8_C40 Pyruvate dehydrogenase complex, dihydrolipoamide a 8e-05
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, 9e-05
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component 9e-05
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 8e-04
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 9e-04
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 8e-04
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 8e-04
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 Back     alignment and structure
>3b8k_A PDCE2;, dihydrolipoyllysine-residue acetyltransferase; central beta-sheet surrounded by five alpha-helices; 8.80A {Homo sapiens} Length = 239 Back     alignment and structure
>3b8k_A PDCE2;, dihydrolipoyllysine-residue acetyltransferase; central beta-sheet surrounded by five alpha-helices; 8.80A {Homo sapiens} Length = 239 Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Length = 128 Back     alignment and structure
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Length = 87 Back     alignment and structure
>3l60_A Branched-chain alpha-keto acid dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.00A {Mycobacterium tuberculosis} Length = 250 Back     alignment and structure
>3l60_A Branched-chain alpha-keto acid dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.00A {Mycobacterium tuberculosis} Length = 250 Back     alignment and structure
>3mae_A 2-oxoisovalerate dehydrogenase E2 component, dihydrolipamide acetyltransferase; 2-oxoacid dehydrogenases acyltransferase; 2.50A {Listeria monocytogenes} Length = 256 Back     alignment and structure
>3mae_A 2-oxoisovalerate dehydrogenase E2 component, dihydrolipamide acetyltransferase; 2-oxoacid dehydrogenases acyltransferase; 2.50A {Listeria monocytogenes} Length = 256 Back     alignment and structure
>2ii3_A Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex...; cubic core, HOMO trimer, oxidized COA-bound form; HET: CAO; 2.17A {Bos taurus} PDB: 2ihw_A* 2ii4_A* 2ii5_A* Length = 262 Back     alignment and structure
>2ii3_A Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex...; cubic core, HOMO trimer, oxidized COA-bound form; HET: CAO; 2.17A {Bos taurus} PDB: 2ihw_A* 2ii4_A* 2ii5_A* Length = 262 Back     alignment and structure
>1dpb_A Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltransferase; 2.50A {Azotobacter vinelandii} SCOP: c.43.1.1 PDB: 1dpd_A 1eaa_A 1eab_A* 1eac_A* 1ead_A* 1eae_A* 1eaf_A 1dpc_A Length = 243 Back     alignment and structure
>1dpb_A Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltransferase; 2.50A {Azotobacter vinelandii} SCOP: c.43.1.1 PDB: 1dpd_A 1eaa_A 1eab_A* 1eac_A* 1ead_A* 1eae_A* 1eaf_A 1dpc_A Length = 243 Back     alignment and structure
>3rqc_A Probable lipoamide acyltransferase; alpha beta fold; 4.01A {Thermoplasma acidophilum dsm 1728} Length = 224 Back     alignment and structure
>3rqc_A Probable lipoamide acyltransferase; alpha beta fold; 4.01A {Thermoplasma acidophilum dsm 1728} Length = 224 Back     alignment and structure
>1scz_A E2, dihydrolipoamide succinyltransferase; COA-dependent acyltransferase, CAT-like, alpha and beta (2 L mixed beta-sheeet of 6 strands; 2.20A {Escherichia coli} SCOP: c.43.1.1 PDB: 1e2o_A 1c4t_A Length = 233 Back     alignment and structure
>1scz_A E2, dihydrolipoamide succinyltransferase; COA-dependent acyltransferase, CAT-like, alpha and beta (2 L mixed beta-sheeet of 6 strands; 2.20A {Escherichia coli} SCOP: c.43.1.1 PDB: 1e2o_A 1c4t_A Length = 233 Back     alignment and structure
>2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Length = 77 Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Length = 93 Back     alignment and structure
>1q23_A Chloramphenicol acetyltransferase; CAT I, trimer, fusidic acid; HET: FUA; 2.18A {Escherichia coli} SCOP: c.43.1.1 PDB: 1noc_B 1pd5_A* 3u9b_A 3u9f_A* Length = 219 Back     alignment and structure
>1q23_A Chloramphenicol acetyltransferase; CAT I, trimer, fusidic acid; HET: FUA; 2.18A {Escherichia coli} SCOP: c.43.1.1 PDB: 1noc_B 1pd5_A* 3u9b_A 3u9f_A* Length = 219 Back     alignment and structure
>3cla_A Type III chloramphenicol acetyltransferase; transferase (acyltransferase); HET: CLM; 1.75A {Escherichia coli} SCOP: c.43.1.1 PDB: 1cla_A* 2cla_A 4cla_A* 1cia_A 1qca_A* Length = 213 Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Length = 79 Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 Back     alignment and structure
>1w4i_A Pyruvate dehydrogenase E2; transferase, peripheral-subunit binding domain, ultrafast folding, homologues,; NMR {Pyrobaculum aerophilum} PDB: 1w4j_A 1w4k_A Length = 62 Back     alignment and structure
>2coo_A Lipoamide acyltransferase component of branched- chain alpha-keto acid dehydrogenase...; E3_binding domain; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1w85_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: a.9.1.1 PDB: 1w88_I* 1w4g_A 1w4e_A 1w4f_A 2pdd_A 2pde_A 1ebd_C* Length = 49 Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>3rnm_E Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex,...; protein-protein interaction, redox protein; HET: FAD NHE; 2.40A {Homo sapiens} PDB: 1zwv_A Length = 58 Back     alignment and structure
>2eq9_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 2.09A {Thermus thermophilus} Length = 41 Back     alignment and structure
>1bal_A Dihydrolipoamide succinyltransferase; glycolysis; NMR {Escherichia coli} SCOP: a.9.1.1 PDB: 1bbl_A 1w4h_A 2wav_A 2wxc_A 2btg_A 2bth_A 2cyu_A Length = 51 Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Length = 85 Back     alignment and structure
>2eq7_C 2-oxoglutarate dehydrogenase E2 component; protein-protein complex, oxidoreductase; HET: FAD NAD; 1.80A {Thermus thermophilus} Length = 40 Back     alignment and structure
>2i9d_A Chloramphenicol acetyltransferase; structural genomics, PSI- protein structure initiative, midwest center for structural genomics; 2.30A {Bacteroides thetaiotaomicron} Length = 217 Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Length = 81 Back     alignment and structure
>2eq8_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 1.94A {Thermus thermophilus} Length = 40 Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Length = 79 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query426
3dva_I428 Dihydrolipoyllysine-residue acetyltransferase comp 100.0
3mae_A256 2-oxoisovalerate dehydrogenase E2 component, dihyd 99.96
3rqc_A224 Probable lipoamide acyltransferase; alpha beta fol 99.96
1dpb_A243 Dihydrolipoyl-transacetylase; dihydrolipoamide ace 99.95
3b8k_A239 PDCE2;, dihydrolipoyllysine-residue acetyltransfer 99.95
3l60_A250 Branched-chain alpha-keto acid dehydrogenase; stru 99.95
1scz_A233 E2, dihydrolipoamide succinyltransferase; COA-depe 99.95
2ii3_A262 Lipoamide acyltransferase component of branched-C 99.95
1zy8_K229 Pyruvate dehydrogenase protein X component, mitoch 99.93
3cla_A213 Type III chloramphenicol acetyltransferase; transf 99.78
2xt6_A 1113 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET 99.78
1q23_A219 Chloramphenicol acetyltransferase; CAT I, trimer, 99.76
2i9d_A217 Chloramphenicol acetyltransferase; structural geno 99.71
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase comp 99.59
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic 99.58
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehy 99.57
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase COM 99.57
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase COM 99.57
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase c 99.52
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate 99.49
3l60_A250 Branched-chain alpha-keto acid dehydrogenase; stru 99.47
3mae_A256 2-oxoisovalerate dehydrogenase E2 component, dihyd 99.46
2l5t_A77 Lipoamide acyltransferase; E2 lipoyl domain; NMR { 99.45
1dpb_A243 Dihydrolipoyl-transacetylase; dihydrolipoamide ace 99.44
2ii3_A262 Lipoamide acyltransferase component of branched-C 99.43
1scz_A233 E2, dihydrolipoamide succinyltransferase; COA-depe 99.43
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, 99.42
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component 99.38
3b8k_A239 PDCE2;, dihydrolipoyllysine-residue acetyltransfer 99.36
3rqc_A224 Probable lipoamide acyltransferase; alpha beta fol 99.35
3dva_I428 Dihydrolipoyllysine-residue acetyltransferase comp 99.34
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl dom 99.33
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase comp 99.27
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 99.14
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein 99.13
1z6h_A72 Biotin/lipoyl attachment protein; solution structu 99.09
2eq9_C41 Pyruvate dehydrogenase complex, dihydrolipoamide a 99.08
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transfera 99.06
2eq7_C40 2-oxoglutarate dehydrogenase E2 component; protein 99.05
3rnm_E58 Lipoamide acyltransferase component of branched-C 99.05
2eq8_C40 Pyruvate dehydrogenase complex, dihydrolipoamide a 99.04
2xt6_A 1113 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET 99.04
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, 99.03
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondri 99.0
3u9t_A675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 98.97
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta s 98.96
1w85_I49 Dihydrolipoyllysine-residue acetyltransferase comp 98.95
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; bioti 98.95
1bal_A51 Dihydrolipoamide succinyltransferase; glycolysis; 98.95
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; bio 98.91
3va7_A1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 98.87
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 98.85
2coo_A70 Lipoamide acyltransferase component of branched- c 98.83
2f60_K64 Pyruvate dehydrogenase protein X component; protei 98.83
1w4i_A62 Pyruvate dehydrogenase E2; transferase, peripheral 98.81
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 98.51
1zko_A136 Glycine cleavage system H protein; TM0212, structu 98.48
2qf7_A1165 Pyruvate carboxylase protein; multi-domain, multi- 98.46
2k32_A116 A; NMR {Campylobacter jejuni} PDB: 2k33_A* 98.35
1q23_A219 Chloramphenicol acetyltransferase; CAT I, trimer, 98.24
1onl_A128 Glycine cleavage system H protein; hybrid barrel-s 97.89
1hpc_A131 H protein of the glycine cleavage system; transit 97.84
3a7l_A128 H-protein, glycine cleavage system H protein; lipo 97.79
3cla_A213 Type III chloramphenicol acetyltransferase; transf 97.71
2i9d_A217 Chloramphenicol acetyltransferase; structural geno 97.21
2f1m_A277 Acriflavine resistance protein A; helical hairpin, 97.08
3lnn_A359 Membrane fusion protein (MFP) heavy metal cation Z 96.97
3fpp_A341 Macrolide-specific efflux protein MACA; hexameric 96.94
3ne5_B413 Cation efflux system protein CUSB; transmembrane h 96.93
3klr_A125 Glycine cleavage system H protein; antiparallel be 96.91
3mxu_A143 Glycine cleavage system H protein; seattle structu 96.77
3tzu_A137 GCVH, glycine cleavage system H protein 1; ssgcid, 96.7
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, 96.64
1vf7_A369 Multidrug resistance protein MEXA; alpha hairpin, 96.53
3hgb_A155 Glycine cleavage system H protein; ssgcid, niaid, 96.22
4dk0_A369 Putative MACA; alpha-hairpin, lipoyl, beta-barrel, 96.05
1z6h_A72 Biotin/lipoyl attachment protein; solution structu 95.91
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta s 95.73
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; bioti 95.67
2k32_A116 A; NMR {Campylobacter jejuni} PDB: 2k33_A* 95.33
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 95.19
3na6_A331 Succinylglutamate desuccinylase/aspartoacylase; st 94.87
3cdx_A354 Succinylglutamatedesuccinylase/aspartoacylase; str 94.55
3fmc_A368 Putative succinylglutamate desuccinylase / aspart; 94.28
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; bio 94.16
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondri 94.16
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transfera 93.16
2l5t_A77 Lipoamide acyltransferase; E2 lipoyl domain; NMR { 92.29
1f3z_A161 EIIA-GLC, glucose-specific phosphocarrier; phospho 91.61
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, 91.53
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase COM 91.46
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase comp 91.28
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase c 91.26
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl dom 91.14
3lnn_A359 Membrane fusion protein (MFP) heavy metal cation Z 91.09
2f1m_A277 Acriflavine resistance protein A; helical hairpin, 91.06
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehy 91.04
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic 90.9
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase comp 90.25
2gpr_A154 Glucose-permease IIA component; phosphotransferase 90.25
1ax3_A162 Iiaglc, glucose permease IIA domain; phosphotransf 89.61
3fpp_A341 Macrolide-specific efflux protein MACA; hexameric 89.55
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase COM 89.25
2qj8_A332 MLR6093 protein; structural genomics, joint center 88.77
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate 87.12
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component 86.74
3ne5_B413 Cation efflux system protein CUSB; transmembrane h 86.63
1vf7_A369 Multidrug resistance protein MEXA; alpha hairpin, 86.58
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein 85.54
2xha_A193 NUSG, transcription antitermination protein NUSG; 84.88
4dk0_A369 Putative MACA; alpha-hairpin, lipoyl, beta-barrel, 82.81
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 80.23
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 80.05
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Back     alignment and structure
Probab=100.00  E-value=8.2e-60  Score=486.81  Aligned_cols=311  Identities=30%  Similarity=0.493  Sum_probs=38.9

Q ss_pred             ceEeccCCCCCcccceeeecccccCCccccCcchhhhhcccccceeecCCCeEEEEEeecCCCccccCCcEEEEEEcCCc
Q psy16142         83 DRVALPALSPTMEMGTIVSWAKKEGDKLNEGDLLAEIETDKATMGFETPEEGYLAKILVPAGSKDVPIGKLVCIIVENES  162 (426)
Q Consensus        83 ~~i~mP~lg~s~d~g~i~~w~v~vGd~Ve~gd~L~~vetdK~~~ei~a~~~G~v~~i~v~~G~~~v~vG~~l~~i~~~~~  162 (426)
                      ..|+||+||++|++|+|.+|++++||.|++||.||+|||||++++|+||++|+|.++++++|+ .|.+|++|++|+.+++
T Consensus         3 ~~i~mP~lg~~~~eg~i~~w~v~~Gd~V~~gd~l~~vEt~K~~~~i~ap~~G~v~~i~v~~G~-~V~~G~~l~~i~~~~~   81 (428)
T 3dva_I            3 FEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEILVPEGT-VATVGQTLITLDAPGY   81 (428)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             eeEEcCCCCCCCccEEEEEEEcCCCCEECCCCEEEEEEeCCeeEEEecCCCeEEEEEEeCCCC-EeCCCCEEEEEecCCc
Confidence            358999999999999999999999999999999999999999999999999999999999999 8999999999987654


Q ss_pred             chhcccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccChHHHHHHHHcCCCCcCcc
Q psy16142        163 DVAAFKDFKDDAPPAAGASAPAPPPPKVAAAPPPPPPKAAPAPSPTPVPSQKTSGGTRVYASPLAKRLAAEKGLDLSSIG  242 (426)
Q Consensus       163 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~asP~aR~lA~e~gIDl~~v~  242 (426)
                      +.......   ....++.   .+.+...+.+.+.  +...+..   +..........++++||+||+||+|+||||++| 
T Consensus        82 ~~~~~~~~---~~~~~~~---~~~~~~~~~~~~~--~~~~~~~---~~~~~~~~~~~~~~asP~~R~lA~e~gvdl~~v-  149 (428)
T 3dva_I           82 ENMTFKGQ---EQEEAKK---EEKTETVSKEEKV--DAVAPNA---PAAEAEAGPNRRVIAMPSVRKYAREKGVDIRLV-  149 (428)
T ss_dssp             ---------------------------------------------------------CCCCCHHHHHHHHHTTCCGGGS-
T ss_pred             cccccccc---ccccccc---CCCcccCCccccc--cCCCccc---cccccccccccccccCHHHHHHHHHcCCCHHHC-
Confidence            33211000   0000000   0000000000000  0000000   000000112346789999999999999999999 


Q ss_pred             CCCCCCCcccchhhhhhhhcCCCCC--C---C---CCCCC---CCCCCceeecCCchhhHHHHHHHhhHHH---------
Q psy16142        243 AGSGLFGSITSADLSKASKAGAVAA--P---S---KSAKP---TANGPFTDLPVSGVRGVIAKRLLQSKQV---------  302 (426)
Q Consensus       243 ~gtG~~GrI~~~DV~~~~~~~~~~~--~---~---~~~~~---~~~~~~~~~~ls~~Rk~iA~~m~~S~~~---------  302 (426)
                      +|||++|||+++||+++........  .   .   .+..+   .....++++||++|||+||++|++||++         
T Consensus       150 ~gtG~~GrI~k~DV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~s~~Rk~ia~~m~~S~~~~P~~~~~~e  229 (428)
T 3dva_I          150 QGTGKNGRVLKEDIDAFLAGGAKPAPAAAEEKAAPAAAKPATTEGEFPETREKMSGIRRAIAKAMVHSKHTAPHVTLMDE  229 (428)
T ss_dssp             CCCSTTSCCCTTTTTTTSCC------------------------------------------------------------
T ss_pred             CCCCCCCceeHHHHHHHhhccccccccccccccccCCCCccccccCCccccccCcHHHHHHHHHHHHhcccCCeEEEEEE
Confidence            9999999999999999753211000  0   0   00000   0112357899999999999999999977         


Q ss_pred             ------HHHHHHHHHHHHHhCCcccHHHHHHHHHHHHhhhcccccceeeC--CceEEcCCCcEEEEeecCCceEeecccC
Q psy16142        303 ------IKLREQMNKALEKRGAKLSINDFIIKATALASRRVPEANSSWQD--TFIREYHSVDVSVAVNTDKGLFTPIVFD  374 (426)
Q Consensus       303 ------~~lr~~~~~~~~~~~~~~s~~~~~~ka~~~al~~~p~~n~~~~~--~~i~~~~~v~i~iAv~~~~GL~~pvi~~  374 (426)
                            +++|+++++..++.|.|+||++||+||+++||++||+||++|++  +.|++|++|||||||++++||++|||+|
T Consensus       230 vDvt~l~~~rk~~~~~~~~~g~kls~~~~~ikAva~Al~~~P~~Na~~~~~~~~i~~~~~v~igiAV~t~~GL~vPvi~~  309 (428)
T 3dva_I          230 ADVTKLVAHRKKFKAIAAEKGIKLTFLPYVVKALVSALREYPVLNTSIDDETEEIIQKHYYNIGIAADTDRGLLVPVIKH  309 (428)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             EeHHHHHHHHHHhhhhHhhcCCCcCHHHHHHHHHHHHHHhCHHhhheEecCCCeEEEcCccCeEEEEEcCCceEEeeecc
Confidence                  78899888766677999999999999999999999999999988  7899999999999999999999999999


Q ss_pred             cCCCCHHHHHhccccccccccCcCCccchHHHHHHHHHHHcCCCCcccccC
Q psy16142        375 ADKKGLVDISNDSRSLISFRRPVKFSEESNDVKTLAAKAKEGKLQPHEFQV  425 (426)
Q Consensus       375 a~~~~l~~i~~~~~~~~~~~~~~~~~~~~~~~~~l~~~a~~~~l~~~e~~~  425 (426)
                      ++++||.+|++                   ++++|++|||+|+|+++||+|
T Consensus       310 a~~~sl~eia~-------------------~~~~l~~~ar~gkL~~~e~~g  341 (428)
T 3dva_I          310 ADRKPIFALAQ-------------------EINELAEKARDGKLTPGEMKG  341 (428)
T ss_dssp             ---------------------------------------------------
T ss_pred             CCCCCHHHHHH-------------------HHHHHHHHHHcCCCCccccCC
Confidence            99999999999                   999999999999999999987



>3mae_A 2-oxoisovalerate dehydrogenase E2 component, dihydrolipamide acetyltransferase; 2-oxoacid dehydrogenases acyltransferase; 2.50A {Listeria monocytogenes} Back     alignment and structure
>3rqc_A Probable lipoamide acyltransferase; alpha beta fold; 4.01A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>1dpb_A Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltransferase; 2.50A {Azotobacter vinelandii} SCOP: c.43.1.1 PDB: 1dpd_A 1eaa_A 1eab_A* 1eac_A* 1ead_A* 1eae_A* 1eaf_A 1dpc_A Back     alignment and structure
>3b8k_A PDCE2;, dihydrolipoyllysine-residue acetyltransferase; central beta-sheet surrounded by five alpha-helices; 8.80A {Homo sapiens} Back     alignment and structure
>3l60_A Branched-chain alpha-keto acid dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: c.43.1.0 Back     alignment and structure
>1scz_A E2, dihydrolipoamide succinyltransferase; COA-dependent acyltransferase, CAT-like, alpha and beta (2 L mixed beta-sheeet of 6 strands; 2.20A {Escherichia coli} SCOP: c.43.1.1 PDB: 1e2o_A 1c4t_A Back     alignment and structure
>2ii3_A Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex...; cubic core, HOMO trimer, oxidized COA-bound form; HET: CAO; 2.17A {Bos taurus} PDB: 2ihw_A* 2ii4_A* 2ii5_A* Back     alignment and structure
>3cla_A Type III chloramphenicol acetyltransferase; transferase (acyltransferase); HET: CLM; 1.75A {Escherichia coli} SCOP: c.43.1.1 PDB: 1cla_A* 2cla_A 4cla_A* 1cia_A 1qca_A* Back     alignment and structure
>2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} Back     alignment and structure
>1q23_A Chloramphenicol acetyltransferase; CAT I, trimer, fusidic acid; HET: FUA; 2.18A {Escherichia coli} SCOP: c.43.1.1 PDB: 1noc_B 1pd5_A* 3u9b_A 3u9f_A* Back     alignment and structure
>2i9d_A Chloramphenicol acetyltransferase; structural genomics, PSI- protein structure initiative, midwest center for structural genomics; 2.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>3l60_A Branched-chain alpha-keto acid dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: c.43.1.0 Back     alignment and structure
>3mae_A 2-oxoisovalerate dehydrogenase E2 component, dihydrolipamide acetyltransferase; 2-oxoacid dehydrogenases acyltransferase; 2.50A {Listeria monocytogenes} Back     alignment and structure
>2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Back     alignment and structure
>1dpb_A Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltransferase; 2.50A {Azotobacter vinelandii} SCOP: c.43.1.1 PDB: 1dpd_A 1eaa_A 1eab_A* 1eac_A* 1ead_A* 1eae_A* 1eaf_A 1dpc_A Back     alignment and structure
>2ii3_A Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex...; cubic core, HOMO trimer, oxidized COA-bound form; HET: CAO; 2.17A {Bos taurus} PDB: 2ihw_A* 2ii4_A* 2ii5_A* Back     alignment and structure
>1scz_A E2, dihydrolipoamide succinyltransferase; COA-dependent acyltransferase, CAT-like, alpha and beta (2 L mixed beta-sheeet of 6 strands; 2.20A {Escherichia coli} SCOP: c.43.1.1 PDB: 1e2o_A 1c4t_A Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Back     alignment and structure
>3b8k_A PDCE2;, dihydrolipoyllysine-residue acetyltransferase; central beta-sheet surrounded by five alpha-helices; 8.80A {Homo sapiens} Back     alignment and structure
>3rqc_A Probable lipoamide acyltransferase; alpha beta fold; 4.01A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Back     alignment and structure
>2eq9_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 2.09A {Thermus thermophilus} Back     alignment and structure
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Back     alignment and structure
>2eq7_C 2-oxoglutarate dehydrogenase E2 component; protein-protein complex, oxidoreductase; HET: FAD NAD; 1.80A {Thermus thermophilus} Back     alignment and structure
>3rnm_E Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex,...; protein-protein interaction, redox protein; HET: FAD NHE; 2.40A {Homo sapiens} SCOP: a.9.1.0 PDB: 1zwv_A Back     alignment and structure
>2eq8_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 1.94A {Thermus thermophilus} Back     alignment and structure
>2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Back     alignment and structure
>1w85_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: a.9.1.1 PDB: 1w88_I* 1w4g_A 1w4e_A 1w4f_A 2pdd_A 2pde_A 1ebd_C* Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A Back     alignment and structure
>1bal_A Dihydrolipoamide succinyltransferase; glycolysis; NMR {Escherichia coli} SCOP: a.9.1.1 PDB: 1bbl_A 1w4h_A 2wav_A 2wxc_A 2btg_A 2bth_A 2cyu_A Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
>2coo_A Lipoamide acyltransferase component of branched- chain alpha-keto acid dehydrogenase...; E3_binding domain; NMR {Homo sapiens} Back     alignment and structure
>2f60_K Pyruvate dehydrogenase protein X component; protein-binding protein, E3BD, protein binding; 1.55A {Homo sapiens} PDB: 2f5z_K Back     alignment and structure
>1w4i_A Pyruvate dehydrogenase E2; transferase, peripheral-subunit binding domain, ultrafast folding, homologues,; NMR {Pyrobaculum aerophilum} PDB: 1w4j_A 1w4k_A Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>1zko_A Glycine cleavage system H protein; TM0212, structural genomi center for structural genomics, JCSG, protein structure INI PSI; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* Back     alignment and structure
>1q23_A Chloramphenicol acetyltransferase; CAT I, trimer, fusidic acid; HET: FUA; 2.18A {Escherichia coli} SCOP: c.43.1.1 PDB: 1noc_B 1pd5_A* 3u9b_A 3u9f_A* Back     alignment and structure
>1onl_A Glycine cleavage system H protein; hybrid barrel-sandwich structure, structural genomics, riken structural genomics/proteomics initiative; 2.50A {Thermus thermophilus} SCOP: b.84.1.1 Back     alignment and structure
>1hpc_A H protein of the glycine cleavage system; transit peptide; HET: LPA; 2.00A {Pisum sativum} SCOP: b.84.1.1 PDB: 1dxm_A* 1htp_A* Back     alignment and structure
>3a7l_A H-protein, glycine cleavage system H protein; lipoic acid, lipoyl, transport protein; 1.30A {Escherichia coli} PDB: 3a7a_B 3ab9_A* 3a8i_E* 3a8j_E* 3a8k_E* Back     alignment and structure
>3cla_A Type III chloramphenicol acetyltransferase; transferase (acyltransferase); HET: CLM; 1.75A {Escherichia coli} SCOP: c.43.1.1 PDB: 1cla_A* 2cla_A 4cla_A* 1cia_A 1qca_A* Back     alignment and structure
>2i9d_A Chloramphenicol acetyltransferase; structural genomics, PSI- protein structure initiative, midwest center for structural genomics; 2.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} Back     alignment and structure
>3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} Back     alignment and structure
>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} Back     alignment and structure
>3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B Back     alignment and structure
>3klr_A Glycine cleavage system H protein; antiparallel beta sheet, beta sandwich, oxidoreductase; HET: GOL; 0.88A {Bos taurus} SCOP: b.84.1.0 PDB: 2edg_A Back     alignment and structure
>3mxu_A Glycine cleavage system H protein; seattle structural genomics center for infectious disease, S CAT-scratch disease, bacteremia; HET: CIT; 1.80A {Bartonella henselae} Back     alignment and structure
>3tzu_A GCVH, glycine cleavage system H protein 1; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Mycobacterium marinum} Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A Back     alignment and structure
>3hgb_A Glycine cleavage system H protein; ssgcid, niaid, decode, UW, SBRI, lipoyl; 1.75A {Mycobacterium tuberculosis} PDB: 3ift_A Back     alignment and structure
>4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A Back     alignment and structure
>2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Back     alignment and structure
>3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} Back     alignment and structure
>3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} Back     alignment and structure
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Back     alignment and structure
>2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Back     alignment and structure
>1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Back     alignment and structure
>3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} Back     alignment and structure
>2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Back     alignment and structure
>2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 Back     alignment and structure
>1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A Back     alignment and structure
>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Back     alignment and structure
>2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Back     alignment and structure
>3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B Back     alignment and structure
>1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
>2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} Back     alignment and structure
>4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 426
d1y8ob1102 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoa 9e-27
d1scza_233 c.43.1.1 (A:) Dihydrolipoamide succinyltransferase 1e-20
d1scza_233 c.43.1.1 (A:) Dihydrolipoamide succinyltransferase 2e-05
d1pmra_80 b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate 5e-20
d1k8ma_87 b.84.1.1 (A:) Lipoyl domain of the mitochondrial b 7e-20
d1ghja_79 b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate 8e-18
d1laba_80 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 1e-17
d1q23a_214 c.43.1.1 (A:) Chloramphenicol acetyltransferase, C 3e-15
d1q23a_214 c.43.1.1 (A:) Chloramphenicol acetyltransferase, C 3e-05
d3claa_213 c.43.1.1 (A:) Chloramphenicol acetyltransferase, C 2e-14
d1gjxa_81 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 4e-14
d1b5sa_242 c.43.1.1 (A:) Dihydrolipoamide acetyltransferase { 1e-13
d1qjoa_80 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 2e-13
d1iyua_79 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 2e-12
d1dcza_77 b.84.1.1 (A:) Biotin carboxyl carrier domain of tr 2e-10
d1dpba_243 c.43.1.1 (A:) Dihydrolipoamide acetyltransferase { 4e-09
d1w85i_42 a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl 1e-08
d2cyua139 a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoa 2e-06
d2gqba1130 a.282.1.1 (A:1-130) Hypothetical protein RPA2825 { 0.002
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure

class: All beta proteins
fold: Barrel-sandwich hybrid
superfamily: Single hybrid motif
family: Biotinyl/lipoyl-carrier proteins and domains
domain: Lipoyl domain of dihydrolipoamide acetyltransferase
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  101 bits (252), Expect = 9e-27
 Identities = 61/87 (70%), Positives = 74/87 (85%)

Query: 85  VALPALSPTMEMGTIVSWAKKEGDKLNEGDLLAEIETDKATMGFETPEEGYLAKILVPAG 144
           V LPALSPTM MGT+  W KK G+KL+EGDLLAEIETDKAT+GFE  EEGYLAKILVP G
Sbjct: 8   VLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG 67

Query: 145 SKDVPIGKLVCIIVENESDVAAFKDFK 171
           ++DVP+G  +CIIVE E+D++AF D++
Sbjct: 68  TRDVPLGTPLCIIVEKEADISAFADYR 94


>d1scza_ c.43.1.1 (A:) Dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Length = 233 Back     information, alignment and structure
>d1scza_ c.43.1.1 (A:) Dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Length = 233 Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Length = 79 Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 80 Back     information, alignment and structure
>d1q23a_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Length = 214 Back     information, alignment and structure
>d1q23a_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Length = 214 Back     information, alignment and structure
>d3claa_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Length = 213 Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Length = 81 Back     information, alignment and structure
>d1b5sa_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 242 Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 79 Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Length = 77 Back     information, alignment and structure
>d1dpba_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 243 Back     information, alignment and structure
>d1w85i_ a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 42 Back     information, alignment and structure
>d2cyua1 a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Length = 39 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query426
d1scza_233 Dihydrolipoamide succinyltransferase {Escherichia 99.97
d1dpba_243 Dihydrolipoamide acetyltransferase {Azotobacter vi 99.96
d1b5sa_242 Dihydrolipoamide acetyltransferase {Bacillus stear 99.96
d1y8ob1102 Lipoyl domain of dihydrolipoamide acetyltransferas 99.81
d1ghja_79 Lipoyl domain of the 2-oxoglutarate dehydrogenase 99.78
d1k8ma_87 Lipoyl domain of the mitochondrial branched-chain 99.76
d1pmra_80 Lipoyl domain of the 2-oxoglutarate dehydrogenase 99.75
d1laba_80 Lipoyl domain of dihydrolipoamide acetyltransferas 99.74
d1gjxa_81 Lipoyl domain of dihydrolipoamide acetyltransferas 99.67
d1qjoa_80 Lipoyl domain of dihydrolipoamide acetyltransferas 99.66
d1iyua_79 Lipoyl domain of dihydrolipoamide acetyltransferas 99.65
d1q23a_214 Chloramphenicol acetyltransferase, CAT {Escherichi 99.63
d3claa_213 Chloramphenicol acetyltransferase, CAT {Escherichi 99.63
d1dpba_243 Dihydrolipoamide acetyltransferase {Azotobacter vi 99.58
d1scza_233 Dihydrolipoamide succinyltransferase {Escherichia 99.53
d1b5sa_242 Dihydrolipoamide acetyltransferase {Bacillus stear 99.48
d1dcza_77 Biotin carboxyl carrier domain of transcarboxylase 99.47
d1w85i_42 E3/E1 binding domain of dihydrolipoyl acetyltransf 99.42
d1bdoa_80 Biotinyl domain of acetyl-CoA carboxylase {Escheri 99.34
d2cyua139 E3-binding domain of dihydrolipoamide succinyltran 99.33
d1q23a_214 Chloramphenicol acetyltransferase, CAT {Escherichi 97.34
d3claa_213 Chloramphenicol acetyltransferase, CAT {Escherichi 96.59
d1dcza_77 Biotin carboxyl carrier domain of transcarboxylase 96.31
d1onla_127 Protein H of glycine cleavage system {Thermus ther 95.74
d1hpca_131 Protein H of glycine cleavage system {Pea (Pisum s 95.58
d1iyua_79 Lipoyl domain of dihydrolipoamide acetyltransferas 94.01
d1vf7a_237 Multidrug resistance protein MexA domain {Pseudomo 93.61
d1bdoa_80 Biotinyl domain of acetyl-CoA carboxylase {Escheri 93.57
d1qjoa_80 Lipoyl domain of dihydrolipoamide acetyltransferas 92.41
d1gjxa_81 Lipoyl domain of dihydrolipoamide acetyltransferas 92.14
d1y8ob1102 Lipoyl domain of dihydrolipoamide acetyltransferas 92.11
d1k8ma_87 Lipoyl domain of the mitochondrial branched-chain 91.57
d1laba_80 Lipoyl domain of dihydrolipoamide acetyltransferas 90.44
d1ghja_79 Lipoyl domain of the 2-oxoglutarate dehydrogenase 90.2
d1pmra_80 Lipoyl domain of the 2-oxoglutarate dehydrogenase 88.63
d1brwa3103 Pyrimidine nucleoside phosphorylase {Bacillus stea 85.22
d1uoua3105 Thymidine phosphorylase {Human (Homo sapiens) [Tax 82.88
>d1scza_ c.43.1.1 (A:) Dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: CoA-dependent acyltransferases
superfamily: CoA-dependent acyltransferases
family: CAT-like
domain: Dihydrolipoamide succinyltransferase
species: Escherichia coli [TaxId: 562]
Probab=99.97  E-value=4.6e-31  Score=249.41  Aligned_cols=128  Identities=35%  Similarity=0.555  Sum_probs=121.5

Q ss_pred             CceeecCCchhhHHHHHHHhhHHH---------------HHHHHHHHHHHH-HhCCcccHHHHHHHHHHHHhhhcccccc
Q psy16142        279 PFTDLPVSGVRGVIAKRLLQSKQV---------------IKLREQMNKALE-KRGAKLSINDFIIKATALASRRVPEANS  342 (426)
Q Consensus       279 ~~~~~~ls~~Rk~iA~~m~~S~~~---------------~~lr~~~~~~~~-~~~~~~s~~~~~~ka~~~al~~~p~~n~  342 (426)
                      .++++||++|||+||++|++||++               +++|+++++... +.|.++|+++||+||++.||++||.+|+
T Consensus         3 ~ee~vpls~~rk~ia~~m~~S~~~iP~~~~~~evd~t~l~~~r~~~~~~~~~~~~~klt~~~~likA~a~aL~~~P~~Na   82 (233)
T d1scza_           3 SEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKAVVEALKRYPEVNA   82 (233)
T ss_dssp             SCCCCCCCHHHHHHHHHHHHHHTTSCEEEEEEEEECHHHHHHHHHHHHHHHHHHSSCCCSHHHHHHHHHHHHHHCTTTTC
T ss_pred             CCcccCCcHHHHHHHHHHHHHhccCCeEEEEEEEEHHHHHHHHHHHHHhhHhhcCCccCHHHHHHHHHHHHHHhCchhhe
Confidence            356789999999999999999987               789999887664 4699999999999999999999999999


Q ss_pred             eeeCCceEEcCCCcEEEEeecCCceEeecccCcCCCCHHHHHhccccccccccCcCCccchHHHHHHHHHHHcCCCCccc
Q psy16142        343 SWQDTFIREYHSVDVSVAVNTDKGLFTPIVFDADKKGLVDISNDSRSLISFRRPVKFSEESNDVKTLAAKAKEGKLQPHE  422 (426)
Q Consensus       343 ~~~~~~i~~~~~v~i~iAv~~~~GL~~pvi~~a~~~~l~~i~~~~~~~~~~~~~~~~~~~~~~~~~l~~~a~~~~l~~~e  422 (426)
                      +|+++.|++++++||||||++++||+||||+|+|+||+.||++                   ++++|++|||+|+|+++|
T Consensus        83 ~~~~~~i~~~~~vnIgiAv~~~~GL~vPvI~~a~~~sl~eia~-------------------~~~~l~~~ar~~~L~~~d  143 (233)
T d1scza_          83 SIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEK-------------------KIKELAVKGRDGKLTVED  143 (233)
T ss_dssp             EEETTEEECCSSCCEEECEEETTEEECCEETTGGGCCHHHHHH-------------------HHHHHHHHTTTTCCCHHH
T ss_pred             EEcCCeEEEeccceEEEEEEcCCCeEEeEeeccccCCHHHHHH-------------------HHHHHHHHhhcCCCCHHH
Confidence            9999999999999999999999999999999999999999999                   999999999999999999


Q ss_pred             ccC
Q psy16142        423 FQV  425 (426)
Q Consensus       423 ~~~  425 (426)
                      |+|
T Consensus       144 ~~g  146 (233)
T d1scza_         144 LTG  146 (233)
T ss_dssp             HSC
T ss_pred             hCC
Confidence            998



>d1dpba_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1b5sa_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1q23a_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3claa_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dpba_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1scza_ c.43.1.1 (A:) Dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b5sa_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1w85i_ a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cyua1 a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q23a_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3claa_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1onla_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hpca_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1brwa3 d.41.3.1 (A:331-433) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uoua3 d.41.3.1 (A:374-480) Thymidine phosphorylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure