Psyllid ID: psy16184


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360---
MTQFLPPNLLALFAPRDPVPYLPPVEKLPHEKKTHGYSGIAAFLNEFEDPKDTPPPTRVETREERLERRRRERAEQVAYKLEQEIALWDPNSFPNATMDPFKTLFIARVNYDTSESKLRREFEVYGPIKKIVMVHNKVTGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVERSRTVKGWLPRRLGGGLGGTRRGGPDVNLKHSGREDNERERERYRLERERELAGGPPRARSGSNDRERERERRRSRSRERKRRTSRSRSRDRRRRRSRERIRDDDIEEVEFRPKDRSDRDRDRDRKRRRERENSEDRNERKRDRKERRKERERNNEEREEKVFIKQEPVDDYQEYDNYEDEASSV
ccccccHHHHHccccccccccccccccccccccccccccHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEcccccccHHHHHHHHHHHccccEEEEEccccccccccEEEEEEccHHHHHHHHHHccccEEccEEEEEEEEcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccc
ccccccHHHHHHHccccccccccccccccccccccccccHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEEcccccHHHHHHHHHHcccEEEEEEEEEcccccccEEEEEEEccHHHHHHHHHHccccEEcccEEEEEEEcccEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccHHHHcccccc
mtqflppnllalfaprdpvpylppveklphekkthgySGIAAFLnefedpkdtppptrveTREERLERRRRERAEQVAYKLEQEIalwdpnsfpnatmdpfKTLFIARVNYDTSESKLRREFEVYGPIKKIVMVHNkvtgkprgyAFIEYEHerdmhsaykhadgkkidgrrVLVDVERsrtvkgwlprrlggglggtrrggpdvnlkhsgredneRERERYRLERERelaggpprarsgsndreRERERRRSRSRErkrrtsrsrsRDRRRRRsrerirdddieevefrpkdrsdrdrdrdRKRRRERENSEDRNERKRDRKERRKERErnneereekvfikqepvddyqeydnyedeassv
mtqflppnllalfaprdpvPYLPPVEKLPHEKKTHGYSGIAAFLnefedpkdtppptrvetreerleRRRRERAEQVAYKLEqeialwdpnsfpNATMDPFKTLFIARVNYdtsesklrrefevygpikkivmvhnkvtgkpRGYAFIEYEHERDMHSaykhadgkkidgrrvlvdversrtvkgwlprrlggglggtrrggpdvnlkhsgrednerereryrlererelaggpprarsgsndrerererrrsrsrerkrrtsrsrsrdrrrrrsrerirdddieevefrpkdrsdrdrdrdrkrrrerensedrnerkrdrkerrkerernneereekvfikqepvddyqeydnyedeassv
MTQflppnllalfapRDPVPYLPPVEKLPHEKKTHGYSGIAAFLNEFEDPKDtppptrvetreerlerrrreraeQVAYKLEQEIALWDPNSFPNATMDPFKTLFIARVNYDTSESKLRREFEVYGPIKKIVMVHNKVTGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVERSRTVKgwlprrlggglggtrrggPDVNLKHSGrednerereryrlerereLAGGPPRArsgsndrerererrrsrsrerkrrtsrsrsrdrrrrrsrerirdddieevefrPkdrsdrdrdrdrkrrrerensedrnerkrdrkerrkerernneereekVFIKQEPVddyqeydnyedeASSV
********LLALFAPRDPVPYL*************GYSGIAAFL********************************VAYKLEQEIALWDPNSFPNATMDPFKTLFIARVNYDTSESKLRREFEVYGPIKKIVMVHNKVTGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVERSRTVKGWLPRRLGG**************************************************************************************************************************************************************************
MTQFLPPNLLALFAPRDPVPYLPPV***********YSGIAAFLNEFE************************************************TMDPFKTLFIARVNYDTSESKLRREFEVYGPIKKIVMVHNKVTGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVER****************************************************************************************************************************************************************************************
MTQFLPPNLLALFAPRDPVPYLPPVEKLPHEKKTHGYSGIAAFLNEFEDP***********************AEQVAYKLEQEIALWDPNSFPNATMDPFKTLFIARVNYDTSESKLRREFEVYGPIKKIVMVHNKVTGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVERSRTVKGWLPRRLGGGLGGTRRGGPDVNLKH************YRLER**************************************************ERIRDDDIEEVEFR************************************************KVFIKQEPVDDYQEYDNYEDEASSV
**QFLPPNLLALFAPRDPVPYLPPVEKLPHEKKTHGYSGIAAFLNEFEDPKDTPPPTRVETREERLERRRRERAEQVAYKLEQEIALWDPNSFPNATMDPFKTLFIARVNYDTSESKLRREFEVYGPIKKIVMVHNKVTGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVERSRTVKGWLPRR*****************************************************************************************************************************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTQFLPPNLLALFAPRDPVPYLPPVEKLPHEKKTHGYSGIAAFLNEFEDPKDTPPPTRVETREERLERRRRERAEQVAYKLEQEIALWDPNSFPNATMDPFKTLFIARVNYDTSESKLRREFEVYGPIKKIVMVHNKVTGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVERSRTVKGWLPRRLGGGLGGTRRGGPDVNLKHSGREDNERERERYRLERERELAGGPPRARSGSNDRERERERRRSRSRERKRRTSRSRSRDRRRRRSRERIRDDDIEEVEFRPKDRSDRDRDRDRKRRRExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPVDDYQEYDNYEDEASSV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query363 2.2.26 [Sep-21-2011]
P17133448 U1 small nuclear ribonucl yes N/A 0.581 0.470 0.800 8e-81
Q62376448 U1 small nuclear ribonucl yes N/A 0.608 0.493 0.761 6e-76
P08621437 U1 small nuclear ribonucl yes N/A 0.608 0.505 0.761 7e-76
Q1RMR2439 U1 small nuclear ribonucl yes N/A 0.608 0.503 0.761 1e-75
Q66II8 471 U1 small nuclear ribonucl yes N/A 0.597 0.460 0.766 2e-75
P09406 471 U1 small nuclear ribonucl N/A N/A 0.597 0.460 0.751 5e-74
Q42404427 U1 small nuclear ribonucl yes N/A 0.710 0.604 0.492 4e-60
Q55FQ0459 U1 small nuclear ribonucl yes N/A 0.575 0.455 0.439 3e-38
O13829261 U1 small nuclear ribonucl yes N/A 0.517 0.720 0.484 4e-37
Q1LZH0245 U11/U12 small nuclear rib no N/A 0.283 0.420 0.476 3e-20
>sp|P17133|RU17_DROME U1 small nuclear ribonucleoprotein 70 kDa OS=Drosophila melanogaster GN=snRNP-U1-70K PE=1 SV=2 Back     alignment and function desciption
 Score =  300 bits (769), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 194/211 (91%)

Query: 1   MTQFLPPNLLALFAPRDPVPYLPPVEKLPHEKKTHGYSGIAAFLNEFEDPKDTPPPTRVE 60
           MTQ+LPPNLLALFA R+P+P++PPV+KLPHEKK+ GY G+A F+ +FEDPKDTP P  VE
Sbjct: 1   MTQYLPPNLLALFAAREPIPFMPPVDKLPHEKKSRGYLGVAKFMADFEDPKDTPLPKTVE 60

Query: 61  TREERLERRRRERAEQVAYKLEQEIALWDPNSFPNATMDPFKTLFIARVNYDTSESKLRR 120
           TR+ERLERRRRE+AEQVAYKLE+EIALWDP    NAT DPF+TLFIAR+NYDTSESKLRR
Sbjct: 61  TRQERLERRRREKAEQVAYKLEREIALWDPTEIKNATEDPFRTLFIARINYDTSESKLRR 120

Query: 121 EFEVYGPIKKIVMVHNKVTGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVERS 180
           EFE YGPIKKIV++H++ +GKP+GYAFIEYEHERDMH+AYKHADGKKID +RVLVDVER+
Sbjct: 121 EFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMHAAYKHADGKKIDSKRVLVDVERA 180

Query: 181 RTVKGWLPRRLGGGLGGTRRGGPDVNLKHSG 211
           RTVKGWLPRRLGGGLGGTRRGG DVN+KHSG
Sbjct: 181 RTVKGWLPRRLGGGLGGTRRGGNDVNIKHSG 211




Mediates the splicing of pre-mRNA by binding to the stem loop I region of U1-snRNA.
Drosophila melanogaster (taxid: 7227)
>sp|Q62376|RU17_MOUSE U1 small nuclear ribonucleoprotein 70 kDa OS=Mus musculus GN=Snrnp70 PE=1 SV=2 Back     alignment and function description
>sp|P08621|RU17_HUMAN U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens GN=SNRNP70 PE=1 SV=2 Back     alignment and function description
>sp|Q1RMR2|RU17_BOVIN U1 small nuclear ribonucleoprotein 70 kDa OS=Bos taurus GN=SNRNP70 PE=2 SV=1 Back     alignment and function description
>sp|Q66II8|RU17_XENTR U1 small nuclear ribonucleoprotein 70 kDa OS=Xenopus tropicalis GN=snrnp70 PE=2 SV=1 Back     alignment and function description
>sp|P09406|RU17_XENLA U1 small nuclear ribonucleoprotein 70 kDa OS=Xenopus laevis GN=snrnp70 PE=2 SV=1 Back     alignment and function description
>sp|Q42404|RU17_ARATH U1 small nuclear ribonucleoprotein 70 kDa OS=Arabidopsis thaliana GN=RNU1 PE=1 SV=1 Back     alignment and function description
>sp|Q55FQ0|RU17_DICDI U1 small nuclear ribonucleoprotein 70 kDa OS=Dictyostelium discoideum GN=snrnp70 PE=3 SV=1 Back     alignment and function description
>sp|O13829|RU17_SCHPO U1 small nuclear ribonucleoprotein 70 kDa homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=usp101 PE=1 SV=1 Back     alignment and function description
>sp|Q1LZH0|U1SBP_BOVIN U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Bos taurus GN=SNRNP35 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query363
193657247397 PREDICTED: u1 small nuclear ribonucleopr 0.922 0.843 0.622 2e-97
156547263402 PREDICTED: U1 small nuclear ribonucleopr 0.581 0.524 0.881 3e-90
91078908408 PREDICTED: similar to AGAP006755-PA isof 0.578 0.514 0.895 4e-90
427788187449 Putative u1 small nuclear ribonucleoprot 0.608 0.492 0.833 3e-89
193662169414 PREDICTED: u1 small nuclear ribonucleopr 0.581 0.509 0.867 8e-89
380019745409 PREDICTED: U1 small nuclear ribonucleopr 0.581 0.515 0.872 2e-87
383866115410 PREDICTED: U1 small nuclear ribonucleopr 0.581 0.514 0.872 2e-87
307173080409 U1 small nuclear ribonucleoprotein 70 kD 0.581 0.515 0.857 5e-87
340715914409 PREDICTED: u1 small nuclear ribonucleopr 0.581 0.515 0.867 7e-87
242003896309 U1 small nuclear ribonucleoprotein 70 kD 0.581 0.682 0.862 9e-87
>gi|193657247|ref|XP_001947021.1| PREDICTED: u1 small nuclear ribonucleoprotein 70 kDa-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  362 bits (929), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 234/376 (62%), Positives = 279/376 (74%), Gaps = 41/376 (10%)

Query: 1   MTQFLPPNLLALFAPRDPVPYLPPVEKLPHEKKTHGYSGIAAFLNEFEDPKDTPPPTRVE 60
           MTQ+LP NLL LFAPRDP+PYLPPV KL HEKK  GYSG+ +F++ FEDPKDTPPPT +E
Sbjct: 1   MTQYLPHNLLTLFAPRDPIPYLPPVSKLSHEKKNRGYSGVGSFMDLFEDPKDTPPPTTIE 60

Query: 61  TREERLERRRRERAEQVAYKLEQEIALWDPNSFPNATMDPFKTLFIARVNYDTSESKLRR 120
           T+E++LERRRRE+AEQVAYKLEQEIA W+P+S  NA  DPFKTLF+AR+NYDTSESKLRR
Sbjct: 61  TKEDKLERRRREKAEQVAYKLEQEIAAWNPHSDANAVTDPFKTLFVARINYDTSESKLRR 120

Query: 121 EFEVYGPIKKIVMVHNKVTGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVERS 180
           EFE+YG IKKIV+  NK+ GKPRGYAFIEYE+ERDM+SAYK+ADGKKIDGRRVLVDVER+
Sbjct: 121 EFELYGLIKKIVVTRNKIDGKPRGYAFIEYENERDMYSAYKYADGKKIDGRRVLVDVERA 180

Query: 181 RTVKGWLPRRLGGGLGGTRRGGPDVNLKHSGREDNERERERYRLERERELAGGPPRARSG 240
           RTVKGWLPRRLGGGLGGTRRGGP+VNL HSGREDNERERERY        A     + S 
Sbjct: 181 RTVKGWLPRRLGGGLGGTRRGGPEVNLIHSGREDNERERERY--------ARKMLISYSR 232

Query: 241 SNDRERERE-------------RRRSRSRERKRRTSRSRSRDRRRRRSRER----IRDDD 283
           + +R RER+             R RSR  ERK   S+S SR     RSR+R    +  D+
Sbjct: 233 TTERNRERDYYDRDGDREREPRRPRSRDHERKHHCSKSGSRKLHICRSRDRGPRDVEYDE 292

Query: 284 IEEVEFRPKDRSDRDRDRDRKRRRERENSEDRNERKRDRKERRKER-----------ERN 332
           +EEV         RD+D DRKR+R+R +S D  ER+++RKER   R           ++N
Sbjct: 293 VEEV----LGSKPRDKDPDRKRKRKRSHSRD-CERRKNRKERDHYRRDKSKDRCEKYDKN 347

Query: 333 NEEREEKVFIKQEPVD 348
           N ER++K+ IK+EPVD
Sbjct: 348 NSERDDKIHIKEEPVD 363




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|156547263|ref|XP_001602052.1| PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|91078908|ref|XP_967303.1| PREDICTED: similar to AGAP006755-PA isoform 1 [Tribolium castaneum] gi|270003669|gb|EFA00117.1| hypothetical protein TcasGA2_TC002933 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|427788187|gb|JAA59545.1| Putative u1 small nuclear ribonucleoprotein 70 kda [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|193662169|ref|XP_001952270.1| PREDICTED: u1 small nuclear ribonucleoprotein 70 kDa-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|380019745|ref|XP_003693763.1| PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like [Apis florea] Back     alignment and taxonomy information
>gi|383866115|ref|XP_003708517.1| PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307173080|gb|EFN64210.1| U1 small nuclear ribonucleoprotein 70 kDa [Camponotus floridanus] Back     alignment and taxonomy information
>gi|340715914|ref|XP_003396452.1| PREDICTED: u1 small nuclear ribonucleoprotein 70 kDa-like [Bombus terrestris] gi|350396793|ref|XP_003484667.1| PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|242003896|ref|XP_002422903.1| U1 small nuclear ribonucleoprotein 70 kDa, putative [Pediculus humanus corporis] gi|212505785|gb|EEB10165.1| U1 small nuclear ribonucleoprotein 70 kDa, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query363
FB|FBgn0016978448 snRNP-U1-70K "small ribonucleo 0.581 0.470 0.582 2.6e-63
UNIPROTKB|Q1RMR2439 SNRNP70 "U1 small nuclear ribo 0.581 0.480 0.556 3.6e-57
UNIPROTKB|E2QRU8386 SNRNP70 "Uncharacterized prote 0.581 0.546 0.556 3.6e-57
UNIPROTKB|F6V5G7439 SNRNP70 "Uncharacterized prote 0.581 0.480 0.556 3.6e-57
UNIPROTKB|P08621437 SNRNP70 "U1 small nuclear ribo 0.581 0.482 0.556 3.6e-57
UNIPROTKB|I3LNE5452 SNRNP70 "Uncharacterized prote 0.581 0.466 0.556 3.6e-57
MGI|MGI:98341448 Snrnp70 "small nuclear ribonuc 0.581 0.470 0.556 3.6e-57
UNIPROTKB|Q66II8 471 snrnp70 "U1 small nuclear ribo 0.581 0.447 0.556 1.6e-56
ZFIN|ZDB-GENE-040825-2 495 snrnp70 "small nuclear ribonuc 0.581 0.426 0.547 6.1e-55
UNIPROTKB|P09406 471 snrnp70 "U1 small nuclear ribo 0.581 0.447 0.544 9.9e-55
FB|FBgn0016978 snRNP-U1-70K "small ribonucleoprotein particle U1 subunit 70K" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 646 (232.5 bits), Expect = 2.6e-63, P = 2.6e-63
 Identities = 123/211 (58%), Positives = 145/211 (68%)

Query:     1 MTQXXXXXXXXXXXXRDPVPYLPPVEKLPHEKKTHGYSGIAAFLNEFEDPKDXXXXXXXX 60
             MTQ            R+P+P++PPV+KLPHEKK+ GY G+A F+ +FEDPKD        
Sbjct:     1 MTQYLPPNLLALFAAREPIPFMPPVDKLPHEKKSRGYLGVAKFMADFEDPKDTPLPKTVE 60

Query:    61 XXXXXXXXXXXXXXXQVAYKLEQEIALWDPNSFPNATMDPFKTLFIARVNYDTSESKLRR 120
                            QVAYKLE+EIALWDP    NAT DPF+TLFIAR+NYDTSESKLRR
Sbjct:    61 TRQERLERRRREKAEQVAYKLEREIALWDPTEIKNATEDPFRTLFIARINYDTSESKLRR 120

Query:   121 EFEVYGPIKKIVMVHNKVTGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVERS 180
             EFE YGPIKKIV++H++ +GKP+GYAFIEYEHERDMH+AYKHADGKKID +RVLVDVER+
Sbjct:   121 EFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMHAAYKHADGKKIDSKRVLVDVERA 180

Query:   181 RTVKXXXXXXXXXXXXXXXXXXPDVNLKHSG 211
             RTVK                   DVN+KHSG
Sbjct:   181 RTVKGWLPRRLGGGLGGTRRGGNDVNIKHSG 211




GO:0005692 "U11 snRNP" evidence=ISS
GO:0030532 "small nuclear ribonucleoprotein complex" evidence=ISS
GO:0030619 "U1 snRNA binding" evidence=NAS
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC;ISS;NAS
GO:0003729 "mRNA binding" evidence=ISS;IDA
GO:0005685 "U1 snRNP" evidence=ISS
GO:0048025 "negative regulation of mRNA splicing, via spliceosome" evidence=IPI
GO:0000166 "nucleotide binding" evidence=IEA
GO:0000381 "regulation of alternative mRNA splicing, via spliceosome" evidence=IMP
GO:0005634 "nucleus" evidence=IC
GO:0005515 "protein binding" evidence=IPI
GO:0007052 "mitotic spindle organization" evidence=IMP
GO:0071011 "precatalytic spliceosome" evidence=IDA
GO:0071013 "catalytic step 2 spliceosome" evidence=IDA
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|Q1RMR2 SNRNP70 "U1 small nuclear ribonucleoprotein 70 kDa" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QRU8 SNRNP70 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6V5G7 SNRNP70 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P08621 SNRNP70 "U1 small nuclear ribonucleoprotein 70 kDa" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LNE5 SNRNP70 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:98341 Snrnp70 "small nuclear ribonucleoprotein 70 (U1)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q66II8 snrnp70 "U1 small nuclear ribonucleoprotein 70 kDa" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040825-2 snrnp70 "small nuclear ribonucleoprotein 70 (U1)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P09406 snrnp70 "U1 small nuclear ribonucleoprotein 70 kDa" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q66II8RU17_XENTRNo assigned EC number0.76600.59770.4607yesN/A
Q62376RU17_MOUSENo assigned EC number0.76120.60880.4933yesN/A
P08621RU17_HUMANNo assigned EC number0.76120.60880.5057yesN/A
P17133RU17_DROMENo assigned EC number0.80090.58120.4709yesN/A
Q42404RU17_ARATHNo assigned EC number0.49260.71070.6042yesN/A
Q1RMR2RU17_BOVINNo assigned EC number0.76120.60880.5034yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query363
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 4e-51
pfam1222094 pfam12220, U1snRNP70_N, U1 small nuclear ribonucle 9e-35
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 1e-32
smart0036073 smart00360, RRM, RNA recognition motif 4e-20
pfam0007670 pfam00076, RRM_1, RNA recognition motif 8e-17
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 2e-16
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 9e-14
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 1e-13
PRK12678 672 PRK12678, PRK12678, transcription termination fact 2e-13
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 3e-13
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 9e-13
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 2e-12
PRK12678 672 PRK12678, PRK12678, transcription termination fact 1e-11
PRK12678 672 PRK12678, PRK12678, transcription termination fact 1e-11
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 1e-11
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 2e-11
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 3e-11
TIGR01642 509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 4e-11
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 5e-11
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 1e-10
pfam1389356 pfam13893, RRM_5, RNA recognition motif 1e-10
TIGR01642 509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 2e-10
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 2e-10
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 2e-10
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 2e-10
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 3e-10
PRK12678 672 PRK12678, PRK12678, transcription termination fact 5e-10
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 5e-10
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 6e-10
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 7e-10
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 8e-10
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 9e-10
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 9e-10
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 1e-09
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 1e-09
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 1e-09
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 2e-09
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 2e-09
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 2e-09
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 3e-09
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 4e-09
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 6e-09
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 6e-09
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 9e-09
PRK12678 672 PRK12678, PRK12678, transcription termination fact 1e-08
PRK12678 672 PRK12678, PRK12678, transcription termination fact 1e-08
PRK12678 672 PRK12678, PRK12678, transcription termination fact 1e-08
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 1e-08
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 2e-08
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 3e-08
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 4e-08
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 1e-07
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 2e-07
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 2e-07
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 2e-07
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 2e-07
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 2e-07
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 3e-07
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 3e-07
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 4e-07
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 4e-07
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 4e-07
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 6e-07
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 6e-07
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 7e-07
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 7e-07
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 8e-07
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 1e-06
PRK10811 1068 PRK10811, rne, ribonuclease E; Reviewed 1e-06
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 1e-06
TIGR01642 509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 2e-06
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 2e-06
cd1255984 cd12559, RRM_SRSF10, RNA recognition motif in seri 2e-06
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 2e-06
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 2e-06
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 2e-06
cd1243180 cd12431, RRM_ALKBH8, RNA recognition motif in alky 2e-06
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 3e-06
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 3e-06
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 3e-06
cd1264677 cd12646, RRM_SRSF7, RNA recognition motif in verte 3e-06
cd1255177 cd12551, RRM_II_PABPN1L, RNA recognition motif in 3e-06
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 4e-06
cd1235074 cd12350, RRM3_SHARP, RNA recognition motif 3 in SM 5e-06
cd1261681 cd12616, RRM1_TIAR, RNA recognition motif 1 in nuc 5e-06
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 6e-06
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 7e-06
cd1239092 cd12390, RRM3_RAVER, RNA recognition motif 3 in ri 1e-05
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 1e-05
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 1e-05
cd1256084 cd12560, RRM_SRSF12, RNA recognition motif in seri 2e-05
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 2e-05
cd1264581 cd12645, RRM_SRSF3, RNA recognition motif in verte 2e-05
cd1258180 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 i 2e-05
cd1252771 cd12527, RRM2_EAR1_like, RNA recognition motif 2 i 2e-05
cd1263287 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 2e-05
cd1259972 cd12599, RRM1_SF2_plant_like, RNA recognition moti 2e-05
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 2e-05
cd1237276 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif 2e-05
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 2e-05
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 3e-05
cd1227884 cd12278, RRM_eIF3B, RNA recognition motif in eukar 3e-05
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 3e-05
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 3e-05
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 3e-05
cd1261574 cd12615, RRM1_TIA1, RNA recognition motif 1 in nuc 3e-05
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 4e-05
cd1258280 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in 4e-05
cd1240477 cd12404, RRM2_NCL, RNA recognition motif 2 in vert 4e-05
cd1240678 cd12406, RRM4_NCL, RNA recognition motif 4 in vert 4e-05
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 5e-05
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 6e-05
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 6e-05
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 7e-05
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 7e-05
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 7e-05
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 7e-05
cd1258077 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in 7e-05
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 9e-05
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 1e-04
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 1e-04
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 1e-04
cd1255076 cd12550, RRM_II_PABPN1, RNA recognition motif in t 1e-04
cd1240572 cd12405, RRM3_NCL, RNA recognition motif 3 in vert 1e-04
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 1e-04
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 1e-04
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 1e-04
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 1e-04
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 2e-04
cd1226777 cd12267, RRM_YRA1_MLO3, RNA recognition motif in y 2e-04
pfam02956 525 pfam02956, TT_ORF1, TT viral orf 1 2e-04
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 3e-04
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 3e-04
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 3e-04
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 3e-04
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 3e-04
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 4e-04
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 4e-04
cd1259670 cd12596, RRM1_SRSF6, RNA recognition motif 1 in ve 4e-04
cd1258480 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in 5e-04
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 5e-04
cd1276381 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in 7e-04
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 7e-04
cd1255685 cd12556, RRM2_RBM15B, RNA recognition motif 2 in p 7e-04
cd1235873 cd12358, RRM1_VICKZ, RNA recognition motif 1 in th 8e-04
cd1276181 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in 8e-04
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 8e-04
pfam02956 525 pfam02956, TT_ORF1, TT viral orf 1 0.001
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 0.001
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 0.001
cd1248279 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in v 0.001
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 0.001
cd1276281 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 i 0.001
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 0.001
cd1236481 cd12364, RRM_RDM1, RNA recognition motif of RAD52 0.001
pfam02724 583 pfam02724, CDC45, CDC45-like protein 0.001
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 0.002
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 0.002
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 0.002
cd1263184 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 0.002
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 0.002
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 0.002
cd1259275 cd12592, RRM_RBM7, RNA recognition motif in verteb 0.002
pfam02956 525 pfam02956, TT_ORF1, TT viral orf 1 0.003
cd1227671 cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti 0.003
cd1236078 cd12360, RRM_cwf2, RNA recognition motif in yeast 0.003
cd1266677 cd12666, RRM2_RAVER2, RNA recognition motif 2 in v 0.003
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 0.003
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 0.003
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.004
cd1248379 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in v 0.004
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 0.004
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 0.004
PRK00247429 PRK00247, PRK00247, putative inner membrane protei 0.004
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 0.004
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 0.004
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
 Score =  165 bits (419), Expect = 4e-51
 Identities = 76/91 (83%), Positives = 85/91 (93%)

Query: 101 FKTLFIARVNYDTSESKLRREFEVYGPIKKIVMVHNKVTGKPRGYAFIEYEHERDMHSAY 160
           FKTLF+AR+NYDT+ESKLRREFE YGPIK+I +V +K TGKPRGYAFIE+EHERDM +AY
Sbjct: 1   FKTLFVARLNYDTTESKLRREFEEYGPIKRIRLVRDKKTGKPRGYAFIEFEHERDMKAAY 60

Query: 161 KHADGKKIDGRRVLVDVERSRTVKGWLPRRL 191
           K+ADGKKIDGRRVLVDVER RTVKGWLPRRL
Sbjct: 61  KYADGKKIDGRRVLVDVERGRTVKGWLPRRL 91


This subfamily corresponds to the RRM of U1-70K, also termed snRNP70, a key component of the U1 snRNP complex, which is one of the key factors facilitating the splicing of pre-mRNA via interaction at the 5' splice site, and is involved in regulation of polyadenylation of some viral and cellular genes, enhancing or inhibiting efficient poly(A) site usage. U1-70K plays an essential role in targeting the U1 snRNP to the 5' splice site through protein-protein interactions with regulatory RNA-binding splicing factors, such as the RS protein ASF/SF2. Moreover, U1-70K protein can specifically bind to stem-loop I of the U1 small nuclear RNA (U1 snRNA) contained in the U1 snRNP complex. It also mediates the binding of U1C, another U1-specific protein, to the U1 snRNP complex. U1-70K contains a conserved RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain), followed by an adjacent glycine-rich region at the N-terminal half, and two serine/arginine-rich (SR) domains at the C-terminal half. The RRM is responsible for the binding of stem-loop I of U1 snRNA molecule. Additionally, the most prominent immunodominant region that can be recognized by auto-antibodies from autoimmune patients may be located within the RRM. The SR domains are involved in protein-protein interaction with SR proteins that mediate 5' splice site recognition. For instance, the first SR domain is necessary and sufficient for ASF/SF2 Binding. The family also includes Drosophila U1-70K that is an essential splicing factor required for viability in flies, but its SR domain is dispensable. The yeast U1-70k doesn't contain easily recognizable SR domains and shows low sequence similarity in the RRM region with other U1-70k proteins and therefore not included in this family. The RRM domain is dispensable for yeast U1-70K function. Length = 91

>gnl|CDD|221466 pfam12220, U1snRNP70_N, U1 small nuclear ribonucleoprotein of 70kDa MW N terminal Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240877 cd12431, RRM_ALKBH8, RNA recognition motif in alkylated DNA repair protein alkB homolog 8 (ALKBH8) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|241090 cd12646, RRM_SRSF7, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 7 (SRSF7) Back     alignment and domain information
>gnl|CDD|240995 cd12551, RRM_II_PABPN1L, RNA recognition motif in vertebrate type II embryonic polyadenylate-binding protein 2 (ePABP-2) Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|241060 cd12616, RRM1_TIAR, RNA recognition motif 1 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241004 cd12560, RRM_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor 12 (SRSF12) and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|241089 cd12645, RRM_SRSF3, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 3 (SRSF3) Back     alignment and domain information
>gnl|CDD|241025 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|240971 cd12527, RRM2_EAR1_like, RNA recognition motif 2 in terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6), pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7), and similar proteins Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240724 cd12278, RRM_eIF3B, RNA recognition motif in eukaryotic translation initiation factor 3 subunit B (eIF-3B) and similar proteins Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|241059 cd12615, RRM1_TIA1, RNA recognition motif 1 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|241026 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|240850 cd12404, RRM2_NCL, RNA recognition motif 2 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240852 cd12406, RRM4_NCL, RNA recognition motif 4 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|241024 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240994 cd12550, RRM_II_PABPN1, RNA recognition motif in type II polyadenylate-binding protein 2 (PABP-2) and similar proteins Back     alignment and domain information
>gnl|CDD|240851 cd12405, RRM3_NCL, RNA recognition motif 3 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240713 cd12267, RRM_YRA1_MLO3, RNA recognition motif in yeast RNA annealing protein YRA1 (Yra1p), yeast mRNA export protein mlo3 and similar proteins Back     alignment and domain information
>gnl|CDD|217301 pfam02956, TT_ORF1, TT viral orf 1 Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|241040 cd12596, RRM1_SRSF6, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 6 (SRSF6) Back     alignment and domain information
>gnl|CDD|241028 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241000 cd12556, RRM2_RBM15B, RNA recognition motif 2 in putative RNA binding motif protein 15B (RBM15B) from vertebrate Back     alignment and domain information
>gnl|CDD|240804 cd12358, RRM1_VICKZ, RNA recognition motif 1 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|217301 pfam02956, TT_ORF1, TT viral orf 1 Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240926 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241206 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240810 cd12364, RRM_RDM1, RNA recognition motif of RAD52 motif-containing protein 1 (RDM1) and similar proteins Back     alignment and domain information
>gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241075 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 1 in CUGBP Elav-like family member CELF-1, CELF-2, Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241036 cd12592, RRM_RBM7, RNA recognition motif in vertebrate RNA-binding protein 7 (RBM7) Back     alignment and domain information
>gnl|CDD|217301 pfam02956, TT_ORF1, TT viral orf 1 Back     alignment and domain information
>gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240806 cd12360, RRM_cwf2, RNA recognition motif in yeast pre-mRNA-splicing factor Cwc2 and similar proteins Back     alignment and domain information
>gnl|CDD|241110 cd12666, RRM2_RAVER2, RNA recognition motif 2 in vertebrate ribonucleoprotein PTB-binding 2 (raver-2) Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|240927 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 363
KOG0113|consensus335 100.0
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.88
KOG0107|consensus195 99.85
KOG0148|consensus321 99.85
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.84
KOG4207|consensus256 99.84
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.84
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.8
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.8
KOG0127|consensus 678 99.75
KOG0415|consensus479 99.74
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.73
KOG0121|consensus153 99.72
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 99.71
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.69
KOG0145|consensus360 99.69
KOG0147|consensus549 99.68
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.68
KOG0117|consensus506 99.67
KOG0122|consensus270 99.66
KOG4205|consensus311 99.66
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.66
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.66
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.64
KOG0149|consensus247 99.62
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.62
KOG0145|consensus360 99.61
KOG0131|consensus203 99.61
KOG0127|consensus 678 99.59
KOG0124|consensus544 99.59
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.58
KOG0126|consensus219 99.58
KOG0105|consensus241 99.58
PLN03120260 nucleic acid binding protein; Provisional 99.57
KOG0130|consensus170 99.57
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.57
KOG0111|consensus298 99.54
PLN03213 759 repressor of silencing 3; Provisional 99.53
KOG0144|consensus 510 99.53
KOG0125|consensus376 99.52
KOG0123|consensus369 99.51
KOG0131|consensus203 99.51
KOG0148|consensus321 99.5
PLN03121243 nucleic acid binding protein; Provisional 99.5
smart0036272 RRM_2 RNA recognition motif. 99.5
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.49
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.48
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.48
KOG0109|consensus346 99.47
KOG0117|consensus 506 99.47
PF1222094 U1snRNP70_N: U1 small nuclear ribonucleoprotein of 99.47
smart0036071 RRM RNA recognition motif. 99.45
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.43
KOG0114|consensus124 99.42
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.41
KOG0108|consensus 435 99.4
KOG0124|consensus 544 99.4
KOG4676|consensus 479 99.39
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.37
KOG0123|consensus369 99.33
smart0036170 RRM_1 RNA recognition motif. 99.32
KOG0110|consensus725 99.31
KOG0146|consensus371 99.31
KOG0144|consensus 510 99.29
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.29
KOG0109|consensus346 99.29
KOG4661|consensus 940 99.25
KOG4212|consensus 608 99.19
KOG4208|consensus214 99.14
KOG4676|consensus479 99.1
KOG4206|consensus221 99.1
KOG0116|consensus419 99.09
KOG4205|consensus311 99.04
KOG0132|consensus 894 99.04
KOG0153|consensus377 98.96
KOG0106|consensus216 98.95
KOG0110|consensus725 98.93
KOG1548|consensus382 98.93
KOG4209|consensus231 98.91
KOG4212|consensus608 98.89
KOG0226|consensus290 98.87
KOG0147|consensus549 98.87
KOG0533|consensus243 98.86
KOG0106|consensus216 98.86
KOG0146|consensus371 98.78
KOG1457|consensus284 98.77
KOG4454|consensus267 98.75
KOG0151|consensus 877 98.68
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.66
KOG1995|consensus351 98.61
KOG4660|consensus 549 98.61
KOG0120|consensus500 98.57
KOG4206|consensus221 98.48
KOG4210|consensus285 98.44
KOG4211|consensus 510 98.31
COG5175480 MOT2 Transcriptional repressor [Transcription] 98.26
KOG4849|consensus 498 98.26
KOG0120|consensus500 98.23
KOG1190|consensus492 98.22
KOG1548|consensus382 98.22
KOG2416|consensus718 98.2
KOG1457|consensus284 98.18
KOG2202|consensus260 98.09
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.04
KOG4211|consensus 510 97.91
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.9
KOG0129|consensus520 97.86
KOG0128|consensus881 97.84
KOG1365|consensus508 97.76
KOG0112|consensus 975 97.7
KOG2314|consensus 698 97.63
KOG3152|consensus278 97.63
KOG0105|consensus241 97.62
KOG1855|consensus484 97.52
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.49
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 97.41
KOG1190|consensus492 97.39
KOG4307|consensus944 97.36
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.32
KOG1456|consensus494 97.32
KOG0129|consensus520 97.27
KOG1456|consensus 494 97.19
COG0724306 RNA-binding proteins (RRM domain) [General functio 97.13
KOG2068|consensus327 96.97
KOG1996|consensus378 96.94
KOG2253|consensus 668 96.77
KOG2193|consensus 584 96.63
KOG4368|consensus757 96.61
KOG0112|consensus 975 96.51
KOG0115|consensus275 96.49
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 96.46
KOG0128|consensus881 96.43
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 96.3
KOG4207|consensus256 96.27
KOG0113|consensus335 96.15
KOG1365|consensus508 96.06
KOG4454|consensus267 95.82
PF15023166 DUF4523: Protein of unknown function (DUF4523) 95.79
KOG4307|consensus 944 95.65
KOG2135|consensus526 95.6
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 95.06
KOG0149|consensus247 95.02
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 95.01
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 94.96
KOG2548|consensus 653 94.83
KOG4574|consensus 1007 94.83
KOG4285|consensus350 94.54
KOG4660|consensus549 94.42
KOG2888|consensus453 94.23
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 94.17
KOG4210|consensus285 93.7
KOG0122|consensus270 93.65
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 93.62
KOG2591|consensus 684 93.61
KOG2548|consensus 653 93.4
PLN03213 759 repressor of silencing 3; Provisional 93.18
KOG2318|consensus 650 92.76
KOG2888|consensus453 92.39
KOG0151|consensus877 92.19
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 92.05
KOG0125|consensus376 91.68
KOG0108|consensus435 91.58
KOG2193|consensus 584 91.28
KOG0804|consensus 493 90.3
KOG0111|consensus298 89.56
KOG0126|consensus219 88.47
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 88.02
smart0036170 RRM_1 RNA recognition motif. 87.33
KOG0835|consensus367 86.6
KOG4483|consensus528 83.96
KOG0107|consensus195 80.84
>KOG0113|consensus Back     alignment and domain information
Probab=100.00  E-value=5.4e-44  Score=314.31  Aligned_cols=200  Identities=73%  Similarity=1.239  Sum_probs=194.6

Q ss_pred             CCCCCChhhhhcCCCCCCCCCCCCCCCCCCCCCCCCCccccccccccCCCCCCCCCCCcccHHHHHHHHHHHHHHHHHHH
Q psy16184          1 MTQFLPPNLLALFAPRDPVPYLPPVEKLPHEKKTHGYSGIAAFLNEFEDPKDTPPPTRVETREERLERRRRERAEQVAYK   80 (363)
Q Consensus         1 ~~~~~p~~l~~~f~~~~pi~~~~p~~~~p~t~~s~g~~g~v~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (363)
                      ||++|||+|+.||+|.|||+++||+..+|+.+++..|+||..|+..++.+.++++++.++.....++.....+.++...+
T Consensus         1 M~~~lp~nllaLF~pRpPl~y~pP~d~~p~kr~~~~~tGvA~~~~~~~~~~d~p~~~p~~t~~e~~er~~~~k~e~~~~~   80 (335)
T KOG0113|consen    1 MTQFLPPNLLALFAPRPPLPYLPPTDKLPHKRKTNPYTGVAQYLSTFEDPKDAPPKFPVETPEEPLERGRREKTEKIPHK   80 (335)
T ss_pred             CCccCCccHHHhcCCCCCcccCCccccChhhccCCCcccHHHHHHhhcCcccCCCcCcccchhhHHHhhhhhhhhhhHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999989


Q ss_pred             HHHHHhhcCCCCCCCCCCCCCCeEEEcCCCCCCCHHHHHHHHHhhCCccEEEEeccCCCCCcceEEEEEecCHHHHHHHH
Q psy16184         81 LEQEIALWDPNSFPNATMDPFKTLFIARVNYDTSESKLRREFEVYGPIKKIVMVHNKVTGKPRGYAFIEYEHERDMHSAY  160 (363)
Q Consensus        81 ~~~~~~~~~p~~~~~~~~~~~~~l~V~nL~~~~t~~~L~~~F~~~G~i~~v~i~~d~~t~~~~g~afV~f~~~~~a~~Ai  160 (363)
                      +...++.|+|..++++..+|.+||||+-|+++++|..|+..|..||.|+.|.|+.|+.||+++|||||+|+++.++..|+
T Consensus        81 ~~~~l~~wdP~~dp~a~gDPy~TLFv~RLnydT~EskLrreF~~YG~IkrirlV~d~vTgkskGYAFIeye~erdm~~AY  160 (335)
T KOG0113|consen   81 LERRLKLWDPNNDPNAIGDPYKTLFVARLNYDTSESKLRREFEKYGPIKRIRLVRDKVTGKSKGYAFIEYEHERDMKAAY  160 (335)
T ss_pred             HHHHHHhcCCCCCCcccCCccceeeeeeccccccHHHHHHHHHhcCcceeEEEeeecccCCccceEEEEeccHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhCCceeCCEEEEEEeecccCCCCCCCCCCCCCCCCCCC
Q psy16184        161 KHADGKKIDGRRVLVDVERSRTVKGWLPRRLGGGLGGTRR  200 (363)
Q Consensus       161 ~~l~g~~i~g~~i~V~~a~~~~~~~~~~~~~~g~~g~~~~  200 (363)
                      ...+|..|+|+.|.|.+....++++|.|++.|||.||...
T Consensus       161 K~adG~~Idgrri~VDvERgRTvkgW~PRRLGGGLGg~r~  200 (335)
T KOG0113|consen  161 KDADGIKIDGRRILVDVERGRTVKGWLPRRLGGGLGGRRY  200 (335)
T ss_pred             HhccCceecCcEEEEEecccccccccccccccCCcCCccc
Confidence            9999999999999999999999999999999999998764



>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>PF12220 U1snRNP70_N: U1 small nuclear ribonucleoprotein of 70kDa MW N terminal; InterPro: IPR022023 This domain is found in eukaryotes Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>KOG2253|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG4368|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG2548|consensus Back     alignment and domain information
>KOG4574|consensus Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG2888|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>KOG2548|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG2318|consensus Back     alignment and domain information
>KOG2888|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0835|consensus Back     alignment and domain information
>KOG4483|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query363
3pgw_S437 Crystal Structure Of Human U1 Snrnp Length = 437 5e-59
3cw1_K216 Crystal Structure Of Human Spliceosomal U1 Snrnp Le 7e-59
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 1e-09
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 1e-09
2rrb_A96 Refinement Of Rna Binding Domain In Human Tra2 Beta 3e-09
2kxn_B129 Nmr Structure Of Human Tra2beta1 Rrm In Complex Wit 6e-09
2rra_A99 Solution Structure Of Rna Binding Domain In Human T 8e-09
2fc8_A102 Solution Structure Of The Rrm_1 Domain Of Ncl Prote 2e-08
2dnm_A103 Solution Structure Of Rna Binding Domain In Srp46 S 2e-08
2cqc_A95 Solution Structure Of The Rna Recognition Motif In 3e-08
2fy1_A116 A Dual Mode Of Rna Recognition By The Rbmy Protein 4e-08
2lea_A135 Solution Structure Of Human Srsf2 (Sc35) Rrm Length 3e-07
2kn4_A158 The Structure Of The Rrm Domain Of Sc35 Length = 15 3e-07
2cjk_A167 Structure Of The Rna Binding Domain Of Hrp1 In Comp 8e-07
2hvz_A101 Solution Structure Of The Rrm Domain Of Sr Rich Fac 8e-07
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 2e-06
1whw_A99 Solution Structure Of The N-Terminal Rna Binding Do 2e-06
2i2y_A150 Solution Structure Of The Rrm Of Srp20 Bound To The 2e-06
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 2e-06
2i38_A150 Solution Structure Of The Rrm Of Srp20 Length = 150 2e-06
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 3e-06
1h2t_Z156 Structure Of The Human Nuclear Cap-Binding-Complex 1e-05
2cqd_A116 Solution Structure Of The Rna Recognition Motif In 1e-05
2cq0_A103 Solution Structure Of Rna Binding Domain In Eukaryo 1e-05
1u6f_A139 Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit 1e-05
1hl6_A165 A Novel Mode Of Rbd-Protein Recognition In The Y14- 2e-05
1oo0_B110 Crystal Structure Of The Drosophila Mago Nashi-Y14 3e-05
2dnz_A95 Solution Structure Of The Second Rna Binding Domain 4e-05
2dgs_A99 Solution Structure Of The Second Rna Binding Domain 4e-05
2j0q_D109 The Crystal Structure Of The Exon Junction Complex 4e-05
2jwn_A124 Solution Nmr Structure Of The Protease-Resistent Do 5e-05
1p27_B106 Crystal Structure Of The Human Y14MAGOH COMPLEX Len 5e-05
2xb2_D90 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 5e-05
2j0s_D89 The Crystal Structure Of The Exon Junction Complex 6e-05
3ex7_B126 The Crystal Structure Of Ejc In Its Transition Stat 6e-05
1h6k_Z98 Nuclear Cap Binding Complex Length = 98 7e-05
2jrs_A108 Solution Nmr Structure Of Caper Rrm2 Domain. Northe 7e-05
2hyi_B91 Structure Of The Human Exon Junction Complex With A 8e-05
4a8x_A88 Structure Of The Core Asap Complex Length = 88 1e-04
1pgz_A195 Crystal Structure Of Up1 Complexed With D(Ttagggtta 1e-04
1l3k_A196 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 1e-04
2lyv_A197 Solution Structure Of The Two Rrm Domains Of Hnrnp 1e-04
1ha1_A184 Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 1e-04
2up1_A183 Structure Of Up1-Telomeric Dna Complex Length = 183 1e-04
1up1_A182 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 1e-04
2x1a_A97 Structure Of Rna15 Rrm With Rna Bound (G) Length = 1e-04
1x4b_A116 Solution Structure Of Rrm Domain In Heterogeneous N 1e-04
2x1f_A96 Structure Of Rna15 Rrm With Bound Rna (Gu) Length = 1e-04
2do4_A100 Solution Structure Of The Rna Binding Domain Of Squ 2e-04
2km8_B84 Interdomain Rrm Packing Contributes To Rna Recognit 3e-04
3md3_A166 Crystal Structure Of The First Two Rrm Domains Of Y 3e-04
2dh7_A105 Solution Structure Of The Second Rna Binding Domain 4e-04
2fc9_A101 Solution Structure Of The Rrm_1 Domain Of Ncl Prote 4e-04
>pdb|3PGW|S Chain S, Crystal Structure Of Human U1 Snrnp Length = 437 Back     alignment and structure

Iteration: 1

Score = 224 bits (571), Expect = 5e-59, Method: Compositional matrix adjust. Identities = 118/212 (55%), Positives = 138/212 (65%), Gaps = 1/212 (0%) Query: 1 MTQXXXXXXXXXXXXRDPVPYLPPVEKLPHEKK-THGYSGIAAFLNEFEDPKDXXXXXXX 59 MTQ RDP+PYLPP+EKLPHEK Y GIA ++ EFEDP+D Sbjct: 1 MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRA 60 Query: 60 XXXXXXXXXXXXXXXXQVAYKLEQEIALWDPNSFPNATMDPFKTLFIARVNYDTSESKLR 119 + ++E E+ +WDP++ PNA D FKTLF+ARVNYDT+ESKLR Sbjct: 61 ETREERMERKRREKIERRQQEVETELKMWDPHNDPNAQGDAFKTLFVARVNYDTTESKLR 120 Query: 120 REFEVYGPIKKIVMVHNKVTGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVER 179 REFEVYGPIK+I MV++K +GKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVER Sbjct: 121 REFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVER 180 Query: 180 SRTVKXXXXXXXXXXXXXXXXXXPDVNLKHSG 211 RTVK DVN++HSG Sbjct: 181 GRTVKGWRPRRLGGGLGGTRRGGADVNIRHSG 212
>pdb|3CW1|K Chain K, Crystal Structure Of Human Spliceosomal U1 Snrnp Length = 216 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|2RRB|A Chain A, Refinement Of Rna Binding Domain In Human Tra2 Beta Protein Length = 96 Back     alignment and structure
>pdb|2KXN|B Chain B, Nmr Structure Of Human Tra2beta1 Rrm In Complex With Aagaac Rna Length = 129 Back     alignment and structure
>pdb|2RRA|A Chain A, Solution Structure Of Rna Binding Domain In Human Tra2 Beta Protein In Complex With Rna (Gaagaa) Length = 99 Back     alignment and structure
>pdb|2FC8|A Chain A, Solution Structure Of The Rrm_1 Domain Of Ncl Protein Length = 102 Back     alignment and structure
>pdb|2DNM|A Chain A, Solution Structure Of Rna Binding Domain In Srp46 Splicing Factor Length = 103 Back     alignment and structure
>pdb|2CQC|A Chain A, Solution Structure Of The Rna Recognition Motif In ArginineSERINE-Rich Splicing Factor 10 Length = 95 Back     alignment and structure
>pdb|2FY1|A Chain A, A Dual Mode Of Rna Recognition By The Rbmy Protein Length = 116 Back     alignment and structure
>pdb|2LEA|A Chain A, Solution Structure Of Human Srsf2 (Sc35) Rrm Length = 135 Back     alignment and structure
>pdb|2KN4|A Chain A, The Structure Of The Rrm Domain Of Sc35 Length = 158 Back     alignment and structure
>pdb|2CJK|A Chain A, Structure Of The Rna Binding Domain Of Hrp1 In Complex With Rna Length = 167 Back     alignment and structure
>pdb|2HVZ|A Chain A, Solution Structure Of The Rrm Domain Of Sr Rich Factor 9g8 Length = 101 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|1WHW|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain From Hypothetical Protein Bab23448 Length = 99 Back     alignment and structure
>pdb|2I2Y|A Chain A, Solution Structure Of The Rrm Of Srp20 Bound To The Rna Cauc Length = 150 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|2I38|A Chain A, Solution Structure Of The Rrm Of Srp20 Length = 150 Back     alignment and structure
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|1H2T|Z Chain Z, Structure Of The Human Nuclear Cap-Binding-Complex (Cbc) In Complex With A Cap Analogue M7gpppg Length = 156 Back     alignment and structure
>pdb|2CQD|A Chain A, Solution Structure Of The Rna Recognition Motif In Rna- Binding Region Containing Protein 1 Length = 116 Back     alignment and structure
>pdb|2CQ0|A Chain A, Solution Structure Of Rna Binding Domain In Eukaryotic Translation Initiation Factor 3 Subunit 4 Length = 103 Back     alignment and structure
>pdb|1U6F|A Chain A, Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit From Trypanosoma Cruzi Length = 139 Back     alignment and structure
>pdb|1HL6|A Chain A, A Novel Mode Of Rbd-Protein Recognition In The Y14-Mago Complex Length = 165 Back     alignment and structure
>pdb|1OO0|B Chain B, Crystal Structure Of The Drosophila Mago Nashi-Y14 Complex Length = 110 Back     alignment and structure
>pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 Back     alignment and structure
>pdb|2DGS|A Chain A, Solution Structure Of The Second Rna Binding Domain In Daz- Associated Protein 1 Length = 99 Back     alignment and structure
>pdb|2J0Q|D Chain D, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 109 Back     alignment and structure
>pdb|2JWN|A Chain A, Solution Nmr Structure Of The Protease-Resistent Domain Of Xenopus Laevis Epabp2 Length = 124 Back     alignment and structure
>pdb|1P27|B Chain B, Crystal Structure Of The Human Y14MAGOH COMPLEX Length = 106 Back     alignment and structure
>pdb|2XB2|D Chain D, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 90 Back     alignment and structure
>pdb|2J0S|D Chain D, The Crystal Structure Of The Exon Junction Complex At 2.2 A Resolution Length = 89 Back     alignment and structure
>pdb|3EX7|B Chain B, The Crystal Structure Of Ejc In Its Transition State Length = 126 Back     alignment and structure
>pdb|1H6K|Z Chain Z, Nuclear Cap Binding Complex Length = 98 Back     alignment and structure
>pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 Back     alignment and structure
>pdb|2HYI|B Chain B, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 91 Back     alignment and structure
>pdb|4A8X|A Chain A, Structure Of The Core Asap Complex Length = 88 Back     alignment and structure
>pdb|1PGZ|A Chain A, Crystal Structure Of Up1 Complexed With D(Ttagggttag(6-Mi) G); A Human Telomeric Repeat Containing 6-Methyl-8-(2- Deoxy-Beta-Ribofuranosyl)isoxanthopteridine (6-Mi) Length = 195 Back     alignment and structure
>pdb|1L3K|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 196 Back     alignment and structure
>pdb|2LYV|A Chain A, Solution Structure Of The Two Rrm Domains Of Hnrnp A1 (up1) Using Segmental Isotope Labeling Length = 197 Back     alignment and structure
>pdb|1HA1|A Chain A, Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 Back     alignment and structure
>pdb|2UP1|A Chain A, Structure Of Up1-Telomeric Dna Complex Length = 183 Back     alignment and structure
>pdb|1UP1|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 182 Back     alignment and structure
>pdb|2X1A|A Chain A, Structure Of Rna15 Rrm With Rna Bound (G) Length = 97 Back     alignment and structure
>pdb|1X4B|A Chain A, Solution Structure Of Rrm Domain In Heterogeneous Nuclear Ribonucleaoproteins A2B1 Length = 116 Back     alignment and structure
>pdb|2X1F|A Chain A, Structure Of Rna15 Rrm With Bound Rna (Gu) Length = 96 Back     alignment and structure
>pdb|2DO4|A Chain A, Solution Structure Of The Rna Binding Domain Of Squamous Cell Carcinoma Antigen Recognized By T Cells 3 Length = 100 Back     alignment and structure
>pdb|2KM8|B Chain B, Interdomain Rrm Packing Contributes To Rna Recognition In The Rna15, Hrp1, Anchor Rna 3' Processing Ternary Complex Length = 84 Back     alignment and structure
>pdb|3MD3|A Chain A, Crystal Structure Of The First Two Rrm Domains Of Yeast Poly Binding Protein (Pub1) Length = 166 Back     alignment and structure
>pdb|2DH7|A Chain A, Solution Structure Of The Second Rna Binding Domain In Nucleolysin Tiar Length = 105 Back     alignment and structure
>pdb|2FC9|A Chain A, Solution Structure Of The Rrm_1 Domain Of Ncl Protein Length = 101 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query363
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 6e-28
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 7e-24
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 1e-23
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 2e-21
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 2e-20
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 1e-19
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 6e-19
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 7e-18
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 1e-17
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 7e-17
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 1e-16
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 2e-16
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 3e-16
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 3e-16
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 4e-16
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 7e-16
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 7e-16
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 1e-15
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 2e-15
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 2e-15
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 2e-15
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-15
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 8e-12
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 2e-15
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 3e-15
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 3e-15
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 3e-15
2i2y_A150 Fusion protein consists of immunoglobin G- binding 3e-15
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 4e-15
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 5e-15
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 5e-15
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 7e-15
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 7e-15
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 7e-15
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 7e-15
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 2e-14
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 3e-14
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 1e-08
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 5e-14
2cqd_A116 RNA-binding region containing protein 1; RNA recog 6e-14
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 1e-13
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 1e-13
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 1e-13
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 4e-08
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-13
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-08
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 8e-07
2krb_A81 Eukaryotic translation initiation factor 3 subunit 2e-13
1x4e_A85 RNA binding motif, single-stranded interacting pro 2e-13
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 2e-13
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 3e-13
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 3e-13
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 3e-13
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 8e-08
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 4e-13
3q2s_C229 Cleavage and polyadenylation specificity factor S; 4e-13
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 5e-13
2la6_A99 RNA-binding protein FUS; structural genomics, nort 5e-13
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 9e-13
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 9e-13
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-12
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 1e-12
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 1e-12
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 2e-12
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 2e-12
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 8e-10
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 3e-12
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 3e-12
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-11
3n9u_C156 Cleavage and polyadenylation specificity factor S; 3e-12
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 3e-12
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 3e-12
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 3e-09
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 4e-08
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 4e-12
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 4e-12
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 5e-12
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 8e-12
2cph_A107 RNA binding motif protein 19; RNA recognition moti 7e-12
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 8e-12
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 8e-12
2cpj_A99 Non-POU domain-containing octamer-binding protein; 9e-12
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 1e-11
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 7e-06
3p5t_L90 Cleavage and polyadenylation specificity factor S; 2e-11
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 2e-11
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 2e-11
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 2e-11
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 2e-11
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 2e-11
2dis_A109 Unnamed protein product; structural genomics, RRM 3e-11
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 3e-11
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 3e-11
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 3e-11
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 5e-11
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 3e-11
2div_A99 TRNA selenocysteine associated protein; structural 3e-11
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 3e-11
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 3e-11
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 3e-11
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-11
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-07
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 4e-11
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 5e-11
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 5e-11
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 9e-07
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 5e-11
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 6e-11
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 6e-11
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 8e-11
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 9e-11
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 1e-10
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 1e-10
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 1e-10
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 2e-10
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 2e-10
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 2e-10
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 2e-10
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 2e-10
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 2e-10
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 2e-10
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-10
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 4e-10
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 5e-10
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 6e-10
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 6e-10
1x5p_A97 Negative elongation factor E; structure genomics, 7e-10
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 7e-10
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 9e-10
2kt5_A124 RNA and export factor-binding protein 2; chaperone 1e-09
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 1e-09
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 5e-07
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 2e-09
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 2e-09
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 3e-09
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 3e-09
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 4e-09
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 4e-09
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 4e-09
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 4e-09
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 5e-09
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 6e-09
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 1e-05
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 9e-09
1x5o_A114 RNA binding motif, single-stranded interacting pro 1e-08
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 2e-08
2f3j_A177 RNA and export factor binding protein 2; RRM domai 2e-08
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 3e-08
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 3e-08
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 4e-08
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 4e-08
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 5e-07
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 4e-08
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 5e-08
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 1e-07
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 7e-08
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 8e-08
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 9e-08
2dnl_A114 Cytoplasmic polyadenylation element binding protei 1e-07
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 1e-07
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 2e-07
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 2e-05
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 3e-07
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 3e-07
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 7e-07
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 8e-07
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 9e-07
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 9e-07
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 2e-06
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 2e-06
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 2e-06
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 3e-06
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 3e-06
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 4e-06
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 5e-06
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 8e-06
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 8e-06
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 2e-05
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 3e-05
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 3e-05
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 4e-05
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 4e-05
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 2e-04
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 3e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 4e-05
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 1e-04
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 2e-04
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 3e-04
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 4e-04
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 6e-04
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 7e-04
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
 Score =  104 bits (261), Expect = 6e-28
 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 4/101 (3%)

Query: 90  PNSFPNATMDPFKTLFIARVNYDTSESKLRREFEVYGPIKKIVMVHNKVTGKPRGYAFIE 149
            +S  +      KTL ++ ++Y  +E  L+  FE    IK    V     GK +GYAFIE
Sbjct: 4   GSSGNSTWSGESKTLVLSNLSYSATEETLQEVFEKATFIK----VPQNQNGKSKGYAFIE 59

Query: 150 YEHERDMHSAYKHADGKKIDGRRVLVDVERSRTVKGWLPRR 190
           +    D   A    + ++I+GR + ++++  R      P  
Sbjct: 60  FASFEDAKEALNSCNKREIEGRAIRLELQGPRGSPNSGPSS 100


>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query363
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 100.0
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.87
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.85
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.84
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.84
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.84
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.84
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.84
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.84
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.83
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.83
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.83
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.83
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.83
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.83
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.83
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.83
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.83
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.82
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.82
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.82
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.82
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.82
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.82
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.82
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.82
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.82
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.82
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.82
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.82
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.82
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.82
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.82
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.81
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.81
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.81
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.81
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.81
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.81
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.81
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.81
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.81
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.81
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.81
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.81
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.81
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.81
2div_A99 TRNA selenocysteine associated protein; structural 99.8
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.8
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.8
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.8
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.8
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.8
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.8
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.8
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.8
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.8
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.8
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.8
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.79
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.79
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.79
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.79
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.79
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.79
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.79
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.79
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.79
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.79
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.79
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.79
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.79
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.79
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.79
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.79
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.78
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.78
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.78
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.78
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.78
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.78
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.78
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.78
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.77
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.77
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.77
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.77
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.77
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.77
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.77
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.77
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.77
2dis_A109 Unnamed protein product; structural genomics, RRM 99.77
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.77
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.77
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.77
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.77
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.77
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.77
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.77
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.76
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.76
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.76
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.76
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.76
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.76
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.76
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.76
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.76
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.76
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.76
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.76
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.76
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.76
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.75
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.75
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.75
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.75
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.75
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.75
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.61
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.75
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.75
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.75
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.74
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.74
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.74
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.74
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.74
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.74
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.74
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.74
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.74
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.74
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.74
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.73
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.73
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.73
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.73
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.73
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.73
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.73
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.73
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.73
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.73
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.73
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.73
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.73
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.72
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.72
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.72
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.72
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.72
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.72
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.72
1x5p_A97 Negative elongation factor E; structure genomics, 99.71
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.7
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.7
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.7
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.7
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.69
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.69
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.69
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.69
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.69
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.69
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.68
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.68
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.68
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.68
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.68
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.67
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.66
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.66
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.66
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.66
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.65
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.65
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.65
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.65
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.64
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.64
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.64
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.63
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.62
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.62
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.6
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.59
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.59
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.58
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.58
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.57
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.56
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.54
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.53
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.51
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.51
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.51
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.5
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.44
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.43
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.43
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 99.42
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.38
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.22
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.22
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.19
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 99.08
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.88
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.59
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.87
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.54
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.54
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.51
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.2
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 97.16
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 97.11
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 96.81
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 96.43
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 95.88
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 95.74
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 94.46
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 95.37
2i2y_A150 Fusion protein consists of immunoglobin G- binding 95.14
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 94.93
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 94.83
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 94.7
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 94.65
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 94.57
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 94.33
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 94.01
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 93.96
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 93.95
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 93.85
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 93.51
3n9u_C156 Cleavage and polyadenylation specificity factor S; 92.99
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 92.78
3q2s_C229 Cleavage and polyadenylation specificity factor S; 92.75
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 92.65
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 92.56
1x4e_A85 RNA binding motif, single-stranded interacting pro 92.53
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 92.43
2krb_A81 Eukaryotic translation initiation factor 3 subunit 92.4
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 92.29
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 92.2
3p5t_L90 Cleavage and polyadenylation specificity factor S; 92.14
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 92.07
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 91.92
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 91.89
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 91.71
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 91.68
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 91.59
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 91.37
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 91.19
2dnl_A114 Cytoplasmic polyadenylation element binding protei 91.18
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 90.96
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 90.84
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 90.76
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 90.66
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 90.65
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 90.62
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 90.59
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 90.18
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 90.06
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 89.96
2div_A99 TRNA selenocysteine associated protein; structural 89.92
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 89.88
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 89.85
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 89.77
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 89.71
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 89.64
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 89.63
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 89.53
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 89.48
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 89.47
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 89.41
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 89.38
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 89.17
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 89.04
2cqd_A116 RNA-binding region containing protein 1; RNA recog 88.81
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 88.74
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 88.62
2cph_A107 RNA binding motif protein 19; RNA recognition moti 88.58
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 88.57
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 88.42
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 88.35
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 87.71
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 87.54
2la6_A99 RNA-binding protein FUS; structural genomics, nort 87.47
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 87.28
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 86.96
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 86.61
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 86.58
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 86.14
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 86.0
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 85.84
2dis_A109 Unnamed protein product; structural genomics, RRM 85.83
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 85.46
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 85.43
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 85.36
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 84.97
2kt5_A124 RNA and export factor-binding protein 2; chaperone 84.93
1x5o_A114 RNA binding motif, single-stranded interacting pro 84.67
2g0c_A76 ATP-dependent RNA helicase DBPA; RNA recognition m 84.36
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 84.16
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 83.88
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 82.87
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 82.67
2f3j_A177 RNA and export factor binding protein 2; RRM domai 82.25
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 82.03
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 81.92
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 81.05
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 80.59
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 80.49
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 80.19
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 80.13
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 80.1
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 80.04
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
Probab=100.00  E-value=9.1e-47  Score=368.45  Aligned_cols=212  Identities=78%  Similarity=1.322  Sum_probs=181.1

Q ss_pred             CCCCCChhhhhcCCCCCCCCCCCCCCCCCCCC-CCCCCccccccccccCCCCCCCCCCCcccHHHHHHHHHHHHHHHHHH
Q psy16184          1 MTQFLPPNLLALFAPRDPVPYLPPVEKLPHEK-KTHGYSGIAAFLNEFEDPKDTPPPTRVETREERLERRRRERAEQVAY   79 (363)
Q Consensus         1 ~~~~~p~~l~~~f~~~~pi~~~~p~~~~p~t~-~s~g~~g~v~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   79 (363)
                      ||++|||+|+.||+|.|||++|+|+...|... ...+|+||..|+..++....++....++...+..+.++.++.++.+.
T Consensus         1 mt~~lPp~L~~lF~p~pPl~~~~P~~~~p~~~~~~~~~~gia~~~~~f~~~~~~~~~~~~e~~~~~~~~~~~~k~~~~~~   80 (437)
T 3pgw_S            1 MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERKRREKIERRQQ   80 (437)
T ss_pred             CCCcCCccHHHhcCCCCCCcCCCCcccccccccCCCCcccHHHHHHhhcCcccccccccccCHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999988777544 78889899989888887766666666777777666666667777777


Q ss_pred             HHHHHHhhcCCCCCCCCCCCCCCeEEEcCCCCCCCHHHHHHHHHhhCCccEEEEeccCCCCCcceEEEEEecCHHHHHHH
Q psy16184         80 KLEQEIALWDPNSFPNATMDPFKTLFIARVNYDTSESKLRREFEVYGPIKKIVMVHNKVTGKPRGYAFIEYEHERDMHSA  159 (363)
Q Consensus        80 ~~~~~~~~~~p~~~~~~~~~~~~~l~V~nL~~~~t~~~L~~~F~~~G~i~~v~i~~d~~t~~~~g~afV~f~~~~~a~~A  159 (363)
                      ++...+..|.|...+.....+.++|||+|||+.||+++|..+|.+||.|..|.|+.++.|++++|||||+|.+.++|.+|
T Consensus        81 ~~~~~~~~~~p~~~~~~~~~~~~~lfV~nL~~~~te~~L~~~F~~~G~I~~v~i~~d~~tg~~kG~aFV~F~~~e~A~~A  160 (437)
T 3pgw_S           81 EVETELKMWDPHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSA  160 (437)
T ss_pred             HHHHhhhhcCCcccccccCCCCCEEEEeCCCCCCCHHHHHHHHHHcCCeeEEEeeccCCCCCccceEEEeeccHHHHHHH
Confidence            77778888888888888888899999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhCCceeCCEEEEEEeecccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q psy16184        160 YKHADGKKIDGRRVLVDVERSRTVKGWLPRRLGGGLGGTRRGGPDVNLKHSGR  212 (363)
Q Consensus       160 i~~l~g~~i~g~~i~V~~a~~~~~~~~~~~~~~g~~g~~~~~~~~~~~~~~~~  212 (363)
                      |..|||+.|+|+.|.|.|+.+.....|.+...+||.|++.+++...+....++
T Consensus       161 i~~lng~~i~gr~i~V~~a~~~~~~~~~~~~~ggG~gg~~~gg~~~~~~~~gr  213 (437)
T 3pgw_S          161 YKHADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGLGGTRRGGADVNIRHSGR  213 (437)
T ss_pred             HHHcCCCEECCEEEEEEEeCCCCCCCCCCCCcCCCCCCCCCCCCccccccccc
Confidence            99999999999999999999999888988777776666555554444333333



>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2g0c_A ATP-dependent RNA helicase DBPA; RNA recognition motif, hydrolase; 1.70A {Bacillus subtilis} PDB: 3moj_B Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 363
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 1e-13
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 3e-13
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 5e-13
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 3e-12
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 3e-12
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 4e-12
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 9e-12
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 1e-11
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 2e-11
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 4e-11
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 5e-11
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 6e-11
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 7e-11
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 7e-11
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 1e-10
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 1e-10
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 1e-10
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 2e-10
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 2e-10
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 3e-10
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 3e-10
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 6e-10
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 9e-10
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 1e-09
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 1e-09
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-09
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 1e-09
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 2e-09
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 3e-09
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 5e-09
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 6e-09
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 7e-09
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 1e-08
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 1e-08
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 1e-08
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 1e-08
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 1e-08
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 2e-08
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 3e-08
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 3e-08
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 3e-08
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 4e-08
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 5e-08
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 5e-08
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 5e-08
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 5e-08
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 5e-08
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 8e-08
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 8e-08
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 1e-07
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 1e-07
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 1e-07
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 1e-07
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 2e-07
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 2e-07
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-07
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 2e-07
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 3e-07
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 5e-07
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 6e-07
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 1e-06
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 1e-06
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 2e-06
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 3e-06
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 5e-06
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 1e-05
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 2e-05
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 2e-05
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 5e-05
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 6e-05
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 6e-05
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 8e-05
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1e-04
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 5e-04
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 0.002
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 0.002
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Poly(A)-binding protein
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 63.8 bits (155), Expect = 1e-13
 Identities = 18/74 (24%), Positives = 37/74 (50%)

Query: 103 TLFIARVNYDTSESKLRREFEVYGPIKKIVMVHNKVTGKPRGYAFIEYEHERDMHSAYKH 162
           +L++  ++ D +E+ L  +F   GPI  I +  + +T +  GYA++ ++   D   A   
Sbjct: 2   SLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDT 61

Query: 163 ADGKKIDGRRVLVD 176
            +   I G+ V + 
Sbjct: 62  MNFDVIKGKPVRIM 75


>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query363
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.87
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.87
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.86
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.86
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.86
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.86
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.86
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.86
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.85
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.85
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.85
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.84
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.84
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.84
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.84
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.84
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.83
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.83
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.83
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.83
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.83
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.83
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.83
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.83
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.83
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.83
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.83
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.82
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.82
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.82
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.82
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.82
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.82
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.81
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.8
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.8
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.8
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.8
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.8
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.8
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.79
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.79
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.78
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.78
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.78
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.77
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.77
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.77
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.76
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.76
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.76
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.76
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.76
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.76
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.76
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.76
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.75
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.75
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.75
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.75
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.75
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.75
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.75
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.74
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.74
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.74
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.74
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.74
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.73
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.72
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.72
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.71
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.7
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.69
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.69
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.68
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.66
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.65
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.64
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.62
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.57
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.54
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.48
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.48
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.46
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.4
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.38
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.98
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.56
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.53
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 96.65
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 96.22
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 95.99
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 95.43
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 95.42
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 95.33
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 95.21
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 94.69
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 94.54
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 94.52
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 94.15
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 93.91
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 93.85
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 93.83
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 93.15
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 93.08
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 93.0
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 92.84
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 92.68
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 92.15
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 92.07
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 92.0
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 91.86
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 91.78
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 91.65
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 91.02
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 91.0
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 90.89
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 90.65
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 90.6
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 90.33
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 89.88
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 89.66
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 89.15
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 88.74
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 88.66
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 88.5
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 87.34
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 86.33
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 85.65
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 85.11
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 84.54
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 83.98
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 83.94
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 80.52
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 80.06
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 80.02
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: RNA-binding protein UBP1
species: Trypanosoma cruzi [TaxId: 5693]
Probab=99.87  E-value=6.9e-22  Score=161.21  Aligned_cols=87  Identities=26%  Similarity=0.500  Sum_probs=81.3

Q ss_pred             CCCCeEEEcCCCCCCCHHHHHHHHHhhCCccEEEEeccCCCCCcceEEEEEecCHHHHHHHHHHhCCceeCCEEEEEEee
Q psy16184         99 DPFKTLFIARVNYDTSESKLRREFEVYGPIKKIVMVHNKVTGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVE  178 (363)
Q Consensus        99 ~~~~~l~V~nL~~~~t~~~L~~~F~~~G~i~~v~i~~d~~t~~~~g~afV~f~~~~~a~~Ai~~l~g~~i~g~~i~V~~a  178 (363)
                      ...++|||+|||+++|+++|.++|++||.|..|.|+.++.||.++|||||+|.+.++|..||..|||+.|+|+.|.|.+|
T Consensus        40 ~~~~~l~V~nLp~~~te~~l~~~F~~~G~i~~v~i~~d~~t~~~rg~afV~f~~~~~A~~Ai~~lng~~~~gr~l~V~~a  119 (139)
T d1u6fa1          40 DVLRNLMVNYIPTTVDEVQLRQLFERYGPIESVKIVCDRETRQSRGYGFVKFQSGSSAQQAIAGLNGFNILNKRLKVALA  119 (139)
T ss_dssp             TTTSEEEEESCSTTCCHHHHHHHHHHHSCEEEEEEEEETTTTEEEEEEEEEESSHHHHHHHHHHTTTEECSSCEEEEEES
T ss_pred             CCCCEEEEeCCCCCCCHHHHHHHHHhhccccccccccccccccccceeeEEECCHHHHHHHHHHhCCCEECCEEEEEEEc
Confidence            34578999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccCCCC
Q psy16184        179 RSRTVKG  185 (363)
Q Consensus       179 ~~~~~~~  185 (363)
                      .....+.
T Consensus       120 ~~~~~~p  126 (139)
T d1u6fa1         120 ASGHQRP  126 (139)
T ss_dssp             SCCCCCC
T ss_pred             CCCCCCC
Confidence            8765543



>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure