Psyllid ID: psy16304


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------
MCYKLYKVHIICRTCFGNLNPVVNLESLFTEKPPSLKMNLEKFGGISKNSSICATSYKVHIICRIRTFANSIEPIEMVEHKMLRDVVLYNMYKAEIWAILRLQKNIHNIACKDMNMQNVPNFQTSSVLSDDPAPTFEVCIVSLLVHLMRGILMGIQNVPNFQTSSVLSDDPAPTFENFLDLRVLLPTHLSLFDFRSVPILVLGLDNAGKSSIIKRILGEPIISLVPTVGFNRARVEYGNKYEVFLYDLGGSEDFRTIWKQYLGTVSQTPLGRPDSRTCQVYLIMCGVHQVSGIPDELTSATHLPLVDFRSVPILVLGLDNAGKSSIIKRILGEPIISLVPTVGFNRARVEYGNKYEVFLYDLGGSEDFRTIWKQYLGTVSQTLLVSHSLSGRPDDRCQVYLMSCNCQVYLISAKNLSNGFKKSERDETNISNFQIKNSSENLQDNNTSDNHDSKKKQPRKRKKKVAPLNTDDETELSLPPLRLLGRNVTHTDSNQEQRCLNLSSDPLGTGAFNVLHAIATDAARRNPNQRDWEDRIG
cccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHccccccccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHcccccccccEEEEccccccHHHHHHHHHccccccccccccEEEEEEEEccEEEEEEEEEccccccccccccccccccEEEEEEEccccHHHHHHHHcccccccccccccccccccccccccccEEEcccccccHHHHHHHHHccccccccccccEEEEEEEEccEEEEEEEEEccccccccccccccccccEEEEEEEccccccHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHccccccccccccHHHHHHccccccccccccccccccccccccccEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccHHHHcc
cccEEEEEEEEEEcccccccccEEHHHHcccccccHHHHHHHcccccccccEEHcccEEEEEEEEEHcHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccEccccccccHHHHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHcccccccccccccEEEEEEEEcccEEEEEEEccccccHHHHHHHHHHccccccccccccccEEEEEEEcccccccccccHHHHHHHHHHccccEEEEEEEccccccHHHHHHHccccccccccccccEEEEEccEcccEEEEEEEccccccHcHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHHHHcHHHHHHHEEHHHHccccccccccHHHHHHHcccHHHHHcccccccccccccccccccccccccccccccccccccHHcccccccccccccHHHcccccccccHHHHHHHHHHHHHHHHHccccccHHHccc
MCYKLYKVHIICRtcfgnlnpvvnleslftekppslkmnlekfggisknssicaTSYKVHIICRIRtfansiepIEMVEHKMLRDVVLYNMYKAEIWAILRLQKNIHNIAckdmnmqnvpnfqtssvlsddpaptFEVCIVSLLVHLMRGILMGiqnvpnfqtssvlsddpaptfenFLDLRVLLPthlslfdfrsvpILVLgldnagksSIIKRIlgepiislvptvgfnrarveygnKYEVFLYDLGGSEDFRTIWKQYLGtvsqtplgrpdsrtCQVYLIMCGvhqvsgipdeltsathlplvdfrsvpILVLGLDNAGKSSIIKRIlgepiislvptvgfnrarveygnKYEVFLYDLGGSEDFRTIWKQYLGTVSQTLLVShslsgrpddrcQVYLMSCNCQVYLISAKnlsngfkkserdetnisnfqiknssenlqdnntsdnhdskkkqprkrkkkvaplntddetelslpplrllgrnvthtdsnqeqrclnlssdplgtgaFNVLHAIATdaarrnpnqrdwedrig
MCYKLYKVHIICRTCFGNLNPVVNLESLFTEKPPSLKMNLEKFGGISKNSSICATSYKVHIICRIRTFANSIEPIEMVEHKMLRDVVLYNMYKAEIWAILRLQKNIHNIACKDMNMQNVPNFQTSSVLSDDPAPTFEVCIVSLLVHLMRGILMGIQNVPNFQTSSVLSDDPAPTFENFLDLRVLLPTHLSLFDFRSVPILVLGLDNAGKSSIIKrilgepiislvptvgfNRARVEYGNKYEVFLYDLGGSEDFRTIWKQYLGtvsqtplgrpDSRTCQVYLIMCGVHQVSGIPDELTSATHLPLVDFRSVPILVLGLDNAGKSSIIKrilgepiislvptvgfNRARVEYGNKYEVFLYDLGGSEDFRTIWKQYLGTVSQTLLVSHSLSGRPDDRCQVYLMSCNCQVYLISAKNLSNGFKKSERDETNISNFqiknssenlqdnntsdnhdskkkqprkrkkkvaplntddetelslpplrlLGRNVTHTDSNQEQRCLNLSSDPLGTGAFNVLHAIAtdaarrnpnqrdwedrig
MCYKLYKVHIICRTCFGNLNPVVNLESLFTEKPPSLKMNLEKFGGISKNSSICATSYKVHIICRIRTFANSIEPIEMVEHKMLRDVVLYNMYKAEIWAILRLQKNIHNIACKDMNMQNVPNFQTSSVLSDDPAPTFEVCIVSLLVHLMRGILMGIQNVPNFQTSSVLSDDPAPTFENFLDLRVLLPTHLSLFDFRSVPILVLGLDNAGKSSIIKRILGEPIISLVPTVGFNRARVEYGNKYEVFLYDLGGSEDFRTIWKQYLGTVSQTPLGRPDSRTCQVYLIMCGVHQVSGIPDELTSATHLPLVDFRSVPILVLGLDNAGKSSIIKRILGEPIISLVPTVGFNRARVEYGNKYEVFLYDLGGSEDFRTIWKQYLGTVSQTLLVSHSLSGRPDDRCQVYLMSCNCQVYLISAKNLSNGFKKSERDETNISNFQIKNSSENLQDNNTSDNHDSkkkqprkrkkkVAPLNTDDETELSLPPLRLLGRNVTHTDSNQEQRCLNLSSDPLGTGAFNVLHAIATDAARRNPNQRDWEDRIG
*CYKLYKVHIICRTCFGNLNPVVNLESLFTEKPPSLKMNLEKFGGISKNSSICATSYKVHIICRIRTFANSIEPIEMVEHKMLRDVVLYNMYKAEIWAILRLQKNIHNIACKDMNMQNVPNFQTSSVLSDDPAPTFEVCIVSLLVHLMRGILMGIQNVPNFQTSSVLSDDPAPTFENFLDLRVLLPTHLSLFDFRSVPILVLGLDNAGKSSIIKRILGEPIISLVPTVGFNRARVEYGNKYEVFLYDLGGSEDFRTIWKQYLGTVSQTPLGRPDSRTCQVYLIMCGVHQVSGIPDELTSATHLPLVDFRSVPILVLGLDNAGKSSIIKRILGEPIISLVPTVGFNRARVEYGNKYEVFLYDLGGSEDFRTIWKQYLGTVSQTLLVSHSLSGRPDDRCQVYLMSCNCQVYLISAKNL******************************************************************************************LGTGAFNVLHAIA******************
**YKLYKVHIICRTCFGNLNPVVNLESLFTEKPPSLKMNLE******KNSSICATSYKVHIICRIRTFANSIEPIEMVEHKMLRDVVLYNMYKAEIWAILRLQKN*********NMQNVPNFQTSSVLSDDPAPTFEVCIVSLLVHLMRGILMGIQNV************PAPTFENFLDLRVLLPTHLSLFDFRSVPILVLGLDNAGKSSIIKRILGEPIISLVPTVGFNRARVEYGNKYEVFLYDLGGSEDFRTIWKQYLGTVSQTPLGRPDSRTCQVYLIMCGVHQVSGIPDELTSATHLPLVDFRSVPILVLGLDNAGKSSIIKRILGEPIISLVPTVGFNRARVEYGNKYEVFLYDLGGSEDFRTIWKQYLGTVSQTLLVSHSLSGRPDDRCQVYLMSCNCQVYLISAKNLSNGFKKSERDETNISN*QIKNSSENLQDNNTSDNHDSKK************************PLRLLGRNVTHT********LNLSSDPLGTGAFNVLHAIAT*****************
MCYKLYKVHIICRTCFGNLNPVVNLESLFTEKPPSLKMNLEKFGGISKNSSICATSYKVHIICRIRTFANSIEPIEMVEHKMLRDVVLYNMYKAEIWAILRLQKNIHNIACKDMNMQNVPNFQTSSVLSDDPAPTFEVCIVSLLVHLMRGILMGIQNVPNFQTSSVLSDDPAPTFENFLDLRVLLPTHLSLFDFRSVPILVLGLDNAGKSSIIKRILGEPIISLVPTVGFNRARVEYGNKYEVFLYDLGGSEDFRTIWKQYLGTVSQTPLGRPDSRTCQVYLIMCGVHQVSGIPDELTSATHLPLVDFRSVPILVLGLDNAGKSSIIKRILGEPIISLVPTVGFNRARVEYGNKYEVFLYDLGGSEDFRTIWKQYLGTVSQTLLVSHSLSGRPDDRCQVYLMSCNCQVYLISAKNLSNGFKKSERDETNISNFQIKNSSENL********************************ELSLPPLRLLGRNVTHTDSNQEQRCLNLSSDPLGTGAFNVLHAIATDAARR************
MCYKLYKVHIICRTCFGNLNPVVNLESLFTEKPPSLKMNLEKFGGISKNSSICATSYKVHIICRIRTFANSIEPIEMVEHKMLRDVVLYNMYKAEIWAILRLQKNIHNIACKDMNMQNVPNFQTSSVLSDDPAPTFEVCIVSLLVHLMRGILMGIQNVPNFQTSSVLSDDPAPTFENFLDLRVLLPTHLSLFDFRSVPILVLGLDNAGKSSIIKRILGEPIISLVPTVGFNRARVEYGNKYEVFLYDLGGSEDFRTIWKQYLGTVSQTPLGRPDSRTCQVYLIMCGVHQVSGIPDELTSATHLPLVDFRSVPILVLGLDNAGKSSIIKRILGEPIISLVPTVGFNRARVEYGNKYEVFLYDLGGSEDFRTIWKQYLGTVSQTLLVSHSLSGRPDDRCQVYLMSCNCQVYLISAKNLSNGFKKSE*DETNISNFQ**N***NL**N*****************************ELSLPPLRLLGRNVTHT**NQEQRCLNLSSDPLGTGAFNVLHAIATDAARRN***********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCYKLYKVHIICRTCFGNLNPVVNLESLFTEKPPSLKMNLEKFGGISKNSSICATSYKVHIICRIRTFANSIEPIEMVEHKMLRDVVLYNMYKAEIWAILRLQKNIHNIACKDMNMQNVPNFQTSSVLSDDPAPTFEVCIVSLLVHLMRGILMGIQNVPNFQTSSVLSDDPAPTFENFLDLRVLLPTHLSLFDFRSVPILVLGLDNAGKSSIIKRILGEPIISLVPTVGFNRARVEYGNKYEVFLYDLGGSEDFRTIWKQYLGTVSQTPLGRPDSRTCQVYLIMCGVHQVSGIPDELTSATHLPLVDFRSVPILVLGLDNAGKSSIIKRILGEPIISLVPTVGFNRARVEYGNKYEVFLYDLGGSEDFRTIWKQYLGTVSQTLLVSHSLSGRPDDRCQVYLMSCNCQVYLISAKNLSNGFKKSERDETNISNFQIKNSSENLQDNNTSDNHDSKKKQPRKRKKKVAPLNTDDETELSLPPLRLLGRNVTHTDSNQEQRCLNLSSDPLGTGAFNVLHAIATDAARRNPNQRDWEDRIG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query537 2.2.26 [Sep-21-2011]
Q06849184 ADP-ribosylation factor-l yes N/A 0.147 0.429 0.425 1e-11
Q8JHI3407 ADP-ribosylation factor-l yes N/A 0.122 0.162 0.447 7e-11
Q627K4184 ADP-ribosylation factor-l N/A N/A 0.147 0.429 0.375 2e-10
O08697184 ADP-ribosylation factor-l yes N/A 0.193 0.565 0.333 2e-10
Q19705184 ADP-ribosylation factor-l yes N/A 0.147 0.429 0.375 3e-10
P36404184 ADP-ribosylation factor-l yes N/A 0.193 0.565 0.333 4e-10
Q9D0J4184 ADP-ribosylation factor-l yes N/A 0.193 0.565 0.323 5e-10
Q2TA37184 ADP-ribosylation factor-l no N/A 0.193 0.565 0.323 9e-10
Q20758180 ADP-ribosylation factor-l no N/A 0.130 0.388 0.438 9e-10
Q3SXY8 428 ADP-ribosylation factor-l no N/A 0.147 0.184 0.425 1e-09
>sp|Q06849|ARL2_DROME ADP-ribosylation factor-like protein 2 OS=Drosophila melanogaster GN=Arf84F PE=2 SV=2 Back     alignment and function desciption
 Score = 72.0 bits (175), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 53/80 (66%), Gaps = 1/80 (1%)

Query: 309 RSVPILVLGLDNAGKSSIIKRILGEPIISLVPTVGFNRARVEYGNKYEVFLYDLGGSEDF 368
           R + IL+LGLDNAGK++I+KR  GEPI ++ PT+GFN   +E+ N Y + ++D+GG +  
Sbjct: 15  REMRILLLGLDNAGKTTILKRFNGEPIDTISPTLGFNIKTLEH-NGYTLNMWDVGGQKSL 73

Query: 369 RTIWKQYLGTVSQTLLVSHS 388
           R+ W+ Y  +    + V  S
Sbjct: 74  RSYWRNYFESTDGLVWVVDS 93




Does not act as an allosteric activator of the cholera toxin catalytic subunit.
Drosophila melanogaster (taxid: 7227)
>sp|Q8JHI3|AR13B_DANRE ADP-ribosylation factor-like protein 13B OS=Danio rerio GN=arl13b PE=2 SV=1 Back     alignment and function description
>sp|Q627K4|ARL2_CAEBR ADP-ribosylation factor-like protein 2 OS=Caenorhabditis briggsae GN=evl-20.1 PE=3 SV=1 Back     alignment and function description
>sp|O08697|ARL2_RAT ADP-ribosylation factor-like protein 2 OS=Rattus norvegicus GN=Arl2 PE=1 SV=1 Back     alignment and function description
>sp|Q19705|ARL2_CAEEL ADP-ribosylation factor-like protein 2 OS=Caenorhabditis elegans GN=evl-20 PE=2 SV=2 Back     alignment and function description
>sp|P36404|ARL2_HUMAN ADP-ribosylation factor-like protein 2 OS=Homo sapiens GN=ARL2 PE=1 SV=4 Back     alignment and function description
>sp|Q9D0J4|ARL2_MOUSE ADP-ribosylation factor-like protein 2 OS=Mus musculus GN=Arl2 PE=1 SV=1 Back     alignment and function description
>sp|Q2TA37|ARL2_BOVIN ADP-ribosylation factor-like protein 2 OS=Bos taurus GN=ARL2 PE=1 SV=1 Back     alignment and function description
>sp|Q20758|ARL1_CAEEL ADP-ribosylation factor-like protein 1 OS=Caenorhabditis elegans GN=arl-1 PE=3 SV=2 Back     alignment and function description
>sp|Q3SXY8|AR13B_HUMAN ADP-ribosylation factor-like protein 13B OS=Homo sapiens GN=ARL13B PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query537
124809432183 ADP-ribosylation factor-like protein [Pl 0.147 0.431 0.475 2e-11
156551615184 PREDICTED: ADP-ribosylation factor-like 0.158 0.461 0.418 5e-11
145346428184 predicted protein [Ostreococcus lucimari 0.163 0.478 0.393 2e-10
380024845184 PREDICTED: ADP-ribosylation factor-like 0.163 0.478 0.393 4e-10
170029695184 ADP-ribosylation factor [Culex quinquefa 0.158 0.461 0.418 4e-10
332020155184 ADP-ribosylation factor-like protein 2 [ 0.163 0.478 0.393 5e-10
390338106246 PREDICTED: ADP-ribosylation factor-like 0.353 0.772 0.288 5e-10
48095928184 PREDICTED: ADP-ribosylation factor-like 0.163 0.478 0.393 5e-10
357601952184 putative ADP-ribosylation factor-like 2- 0.175 0.510 0.389 5e-10
307206910184 ADP-ribosylation factor-like protein 2 [ 0.163 0.478 0.393 7e-10
>gi|124809432|ref|XP_001348573.1| ADP-ribosylation factor-like protein [Plasmodium falciparum 3D7] gi|23497469|gb|AAN37012.1| ADP-ribosylation factor-like protein [Plasmodium falciparum 3D7] Back     alignment and taxonomy information
 Score = 77.4 bits (189), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 53/80 (66%), Gaps = 1/80 (1%)

Query: 309 RSVPILVLGLDNAGKSSIIKRILGEPIISLVPTVGFNRARVEYGNKYEVFLYDLGGSEDF 368
           R++ IL+LGLDNAGK++IIKR+LGE I S+ PT GFN   +E+GN   + ++D+GG +  
Sbjct: 15  RNLRILILGLDNAGKTTIIKRLLGEDIYSVSPTFGFNIETLEFGNNI-LNIWDIGGQKSI 73

Query: 369 RTIWKQYLGTVSQTLLVSHS 388
           R  WK Y   V   + V  S
Sbjct: 74  RHFWKNYYEDVDGIIFVVDS 93




Source: Plasmodium falciparum 3D7

Species: Plasmodium falciparum

Genus: Plasmodium

Family:

Order: Haemosporida

Class: Aconoidasida

Phylum: Apicomplexa

Superkingdom: Eukaryota

>gi|156551615|ref|XP_001600714.1| PREDICTED: ADP-ribosylation factor-like protein 2-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|145346428|ref|XP_001417689.1| predicted protein [Ostreococcus lucimarinus CCE9901] gi|144577917|gb|ABO95982.1| predicted protein [Ostreococcus lucimarinus CCE9901] Back     alignment and taxonomy information
>gi|380024845|ref|XP_003696200.1| PREDICTED: ADP-ribosylation factor-like protein 2-like [Apis florea] Back     alignment and taxonomy information
>gi|170029695|ref|XP_001842727.1| ADP-ribosylation factor [Culex quinquefasciatus] gi|167864046|gb|EDS27429.1| ADP-ribosylation factor [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|332020155|gb|EGI60599.1| ADP-ribosylation factor-like protein 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|390338106|ref|XP_783520.2| PREDICTED: ADP-ribosylation factor-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|48095928|ref|XP_394559.1| PREDICTED: ADP-ribosylation factor-like protein 2-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|357601952|gb|EHJ63207.1| putative ADP-ribosylation factor-like 2-like protein [Danaus plexippus] Back     alignment and taxonomy information
>gi|307206910|gb|EFN84756.1| ADP-ribosylation factor-like protein 2 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query537
GENEDB_PFALCIPARUM|PF14_0399183 PF14_0399 "ADP-ribosylation-li 0.147 0.431 0.475 9.2e-14
UNIPROTKB|Q8IL50183 PF14_0399 "ADP-ribosylation fa 0.147 0.431 0.475 9.2e-14
FB|FBgn0004908184 Arl2 "ADP ribosylation factor- 0.214 0.625 0.378 8.6e-13
TAIR|locus:2827399182 ARF3 "ADP-ribosylation factor 0.221 0.653 0.352 1.7e-11
GENEDB_PFALCIPARUM|PF10_0337178 PF10_0337 "ADP-ribosylation fa 0.128 0.387 0.472 5.9e-11
UNIPROTKB|Q8IJ63178 PF10_0337 "ADP-ribosylation fa 0.128 0.387 0.472 5.9e-11
DICTYBASE|DDB_G0281307184 arl2 "ARF-like protein" [Dicty 0.171 0.5 0.365 5.9e-11
RGD|69326184 Arl2 "ADP-ribosylation factor- 0.175 0.510 0.347 5.9e-11
UNIPROTKB|O08697184 Arl2 "ADP-ribosylation factor- 0.175 0.510 0.347 5.9e-11
WB|WBGene00000187180 arl-1 [Caenorhabditis elegans 0.126 0.377 0.465 7.6e-11
GENEDB_PFALCIPARUM|PF14_0399 PF14_0399 "ADP-ribosylation-like factor, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
 Score = 187 (70.9 bits), Expect = 9.2e-14, P = 9.2e-14
 Identities = 38/80 (47%), Positives = 53/80 (66%)

Query:   309 RSVPILVLGLDNAGKSSIIKRILGEPIISLVPTVGFNRARVEYGNKYEVFLYDLGGSEDF 368
             R++ IL+LGLDNAGK++IIKR+LGE I S+ PT GFN   +E+GN   + ++D+GG +  
Sbjct:    15 RNLRILILGLDNAGKTTIIKRLLGEDIYSVSPTFGFNIETLEFGNNI-LNIWDIGGQKSI 73

Query:   369 RTIWKQYLGTVSQTLLVSHS 388
             R  WK Y   V   + V  S
Sbjct:    74 RHFWKNYYEDVDGIIFVVDS 93


GO:0003924 "GTPase activity" evidence=ISS
GO:0006471 "protein ADP-ribosylation" evidence=ISS
UNIPROTKB|Q8IL50 PF14_0399 "ADP-ribosylation factor-like protein" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
FB|FBgn0004908 Arl2 "ADP ribosylation factor-like 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TAIR|locus:2827399 ARF3 "ADP-ribosylation factor 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF10_0337 PF10_0337 "ADP-ribosylation factor-like protein" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IJ63 PF10_0337 "ADP-ribosylation factor-like protein" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0281307 arl2 "ARF-like protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
RGD|69326 Arl2 "ADP-ribosylation factor-like 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O08697 Arl2 "ADP-ribosylation factor-like protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
WB|WBGene00000187 arl-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query537
cd00878158 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf 1e-17
cd00878158 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf 1e-17
pfam00025174 pfam00025, Arf, ADP-ribosylation factor family 1e-15
pfam00025174 pfam00025, Arf, ADP-ribosylation factor family 1e-15
cd04154173 cd04154, Arl2, Arf-like 2 (Arl2) GTPase 1e-15
cd04154173 cd04154, Arl2, Arf-like 2 (Arl2) GTPase 1e-15
cd04162164 cd04162, Arl9_Arfrp2_like, Arf-like 9 (Arl9)/Arfrp 5e-13
cd04162164 cd04162, Arl9_Arfrp2_like, Arf-like 9 (Arl9)/Arfrp 5e-13
cd04151158 cd04151, Arl1, ADP ribosylation factor 1 (Arf1) 6e-13
cd04151158 cd04151, Arl1, ADP ribosylation factor 1 (Arf1) 6e-13
cd04161167 cd04161, Arl2l1_Arl13_like, Arl2-like protein 1 (A 7e-13
cd04161167 cd04161, Arl2l1_Arl13_like, Arl2-like protein 1 (A 7e-13
cd04156160 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 8e-13
cd04156160 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 8e-13
PTZ00133182 PTZ00133, PTZ00133, ADP-ribosylation factor; Provi 7e-12
cd04149168 cd04149, Arf6, ADP ribosylation factor 6 (Arf6) 7e-12
cd04160168 cd04160, Arfrp1, Arf-related protein 1 (Arfrp1) 2e-11
cd04160168 cd04160, Arfrp1, Arf-related protein 1 (Arfrp1) 2e-11
cd04150159 cd04150, Arf1_5_like, ADP-ribosylation factor-1 (A 3e-11
cd04150159 cd04150, Arf1_5_like, ADP-ribosylation factor-1 (A 3e-11
cd00879191 cd00879, Sar1, Sar1 is an essential component of C 3e-11
cd04149168 cd04149, Arf6, ADP ribosylation factor 6 (Arf6) 4e-11
cd04155174 cd04155, Arl3, Arf-like 3 (Arl3) GTPase 5e-11
cd04155174 cd04155, Arl3, Arf-like 3 (Arl3) GTPase 5e-11
smart00177175 smart00177, ARF, ARF-like small GTPases; ARF, ADP- 5e-11
cd00879191 cd00879, Sar1, Sar1 is an essential component of C 6e-11
PLN00223181 PLN00223, PLN00223, ADP-ribosylation factor; Provi 6e-11
cd04153174 cd04153, Arl5_Arl8, Arf-like 5 (Arl5) and 8 (Arl8) 6e-11
PTZ00133182 PTZ00133, PTZ00133, ADP-ribosylation factor; Provi 8e-11
cd04153174 cd04153, Arl5_Arl8, Arf-like 5 (Arl5) and 8 (Arl8) 1e-10
smart00177175 smart00177, ARF, ARF-like small GTPases; ARF, ADP- 2e-10
PLN00223181 PLN00223, PLN00223, ADP-ribosylation factor; Provi 3e-10
cd04152183 cd04152, Arl4_Arl7, Arf-like 4 (Arl4) and 7 (Arl7) 3e-10
cd04152183 cd04152, Arl4_Arl7, Arf-like 4 (Arl4) and 7 (Arl7) 3e-10
cd04157162 cd04157, Arl6, Arf-like 6 (Arl6) GTPase 4e-10
cd04157162 cd04157, Arl6, Arf-like 6 (Arl6) GTPase 4e-10
cd04158169 cd04158, ARD1, (ADP-ribosylation factor domain pro 2e-09
cd04158169 cd04158, ARD1, (ADP-ribosylation factor domain pro 2e-09
cd04159159 cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl 4e-09
cd04159159 cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl 4e-09
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 7e-08
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 3e-07
COG1100219 COG1100, COG1100, GTPase SAR1 and related small G 3e-07
COG1100219 COG1100, COG1100, GTPase SAR1 and related small G 3e-07
smart00178184 smart00178, SAR, Sar1p-like members of the Ras-fam 3e-06
smart00178184 smart00178, SAR, Sar1p-like members of the Ras-fam 8e-06
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 2e-05
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 2e-05
cd04111211 cd04111, Rab39, Rab GTPase family 39 (Rab39) 0.001
cd04111211 cd04111, Rab39, Rab GTPase family 39 (Rab39) 0.002
>gnl|CDD|206644 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf-like (Arl) small GTPases Back     alignment and domain information
 Score = 79.5 bits (197), Expect = 1e-17
 Identities = 26/63 (41%), Positives = 43/63 (68%), Gaps = 1/63 (1%)

Query: 199 ILVLGLDNAGKSSIIKRILGEPIISLVPTVGFNRARVEYGNKYEVFLYDLGGSEDFRTIW 258
           IL+LGLD AGK++I+ ++    +++ +PT+GFN   VEY N  +  ++D+GG +  R +W
Sbjct: 2   ILMLGLDGAGKTTILYKLKLGEVVTTIPTIGFNVETVEYKN-VKFTVWDVGGQDKIRPLW 60

Query: 259 KQY 261
           K Y
Sbjct: 61  KHY 63


Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases. Arf proteins are activators of phospholipase D isoforms. Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated. Arfs are N-terminally myristoylated. Members of the Arf family are regulators of vesicle formation in intracellular traffic that interact reversibly with membranes of the secretory and endocytic compartments in a GTP-dependent manner. They depart from other small GTP-binding proteins by a unique structural device, interswitch toggle, that implements front-back communication from N-terminus to the nucleotide binding site. Arf-like (Arl) proteins are close relatives of the Arf, but only Arl1 has been shown to function in membrane traffic like the Arf proteins. Arl2 has an unrelated function in the folding of native tubulin, and Arl4 may function in the nucleus. Most other Arf family proteins are so far relatively poorly characterized. Thus, despite their significant sequence homologies, Arf family proteins may regulate unrelated functions. Length = 158

>gnl|CDD|206644 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf-like (Arl) small GTPases Back     alignment and domain information
>gnl|CDD|200938 pfam00025, Arf, ADP-ribosylation factor family Back     alignment and domain information
>gnl|CDD|200938 pfam00025, Arf, ADP-ribosylation factor family Back     alignment and domain information
>gnl|CDD|206720 cd04154, Arl2, Arf-like 2 (Arl2) GTPase Back     alignment and domain information
>gnl|CDD|206720 cd04154, Arl2, Arf-like 2 (Arl2) GTPase Back     alignment and domain information
>gnl|CDD|133362 cd04162, Arl9_Arfrp2_like, Arf-like 9 (Arl9)/Arfrp2-like GTPase Back     alignment and domain information
>gnl|CDD|133362 cd04162, Arl9_Arfrp2_like, Arf-like 9 (Arl9)/Arfrp2-like GTPase Back     alignment and domain information
>gnl|CDD|206718 cd04151, Arl1, ADP ribosylation factor 1 (Arf1) Back     alignment and domain information
>gnl|CDD|206718 cd04151, Arl1, ADP ribosylation factor 1 (Arf1) Back     alignment and domain information
>gnl|CDD|133361 cd04161, Arl2l1_Arl13_like, Arl2-like protein 1 (Arl2l1) and Arl13 Back     alignment and domain information
>gnl|CDD|133361 cd04161, Arl2l1_Arl13_like, Arl2-like protein 1 (Arl2l1) and Arl13 Back     alignment and domain information
>gnl|CDD|133356 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 (ARLTS1 or Arl11) Back     alignment and domain information
>gnl|CDD|133356 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 (ARLTS1 or Arl11) Back     alignment and domain information
>gnl|CDD|173423 PTZ00133, PTZ00133, ADP-ribosylation factor; Provisional Back     alignment and domain information
>gnl|CDD|206716 cd04149, Arf6, ADP ribosylation factor 6 (Arf6) Back     alignment and domain information
>gnl|CDD|206725 cd04160, Arfrp1, Arf-related protein 1 (Arfrp1) Back     alignment and domain information
>gnl|CDD|206725 cd04160, Arfrp1, Arf-related protein 1 (Arfrp1) Back     alignment and domain information
>gnl|CDD|206717 cd04150, Arf1_5_like, ADP-ribosylation factor-1 (Arf1) and ADP-ribosylation factor-5 (Arf5) Back     alignment and domain information
>gnl|CDD|206717 cd04150, Arf1_5_like, ADP-ribosylation factor-1 (Arf1) and ADP-ribosylation factor-5 (Arf5) Back     alignment and domain information
>gnl|CDD|206645 cd00879, Sar1, Sar1 is an essential component of COPII vesicle coats Back     alignment and domain information
>gnl|CDD|206716 cd04149, Arf6, ADP ribosylation factor 6 (Arf6) Back     alignment and domain information
>gnl|CDD|206721 cd04155, Arl3, Arf-like 3 (Arl3) GTPase Back     alignment and domain information
>gnl|CDD|206721 cd04155, Arl3, Arf-like 3 (Arl3) GTPase Back     alignment and domain information
>gnl|CDD|128474 smart00177, ARF, ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>gnl|CDD|206645 cd00879, Sar1, Sar1 is an essential component of COPII vesicle coats Back     alignment and domain information
>gnl|CDD|165788 PLN00223, PLN00223, ADP-ribosylation factor; Provisional Back     alignment and domain information
>gnl|CDD|133353 cd04153, Arl5_Arl8, Arf-like 5 (Arl5) and 8 (Arl8) GTPases Back     alignment and domain information
>gnl|CDD|173423 PTZ00133, PTZ00133, ADP-ribosylation factor; Provisional Back     alignment and domain information
>gnl|CDD|133353 cd04153, Arl5_Arl8, Arf-like 5 (Arl5) and 8 (Arl8) GTPases Back     alignment and domain information
>gnl|CDD|128474 smart00177, ARF, ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>gnl|CDD|165788 PLN00223, PLN00223, ADP-ribosylation factor; Provisional Back     alignment and domain information
>gnl|CDD|206719 cd04152, Arl4_Arl7, Arf-like 4 (Arl4) and 7 (Arl7) GTPases Back     alignment and domain information
>gnl|CDD|206719 cd04152, Arl4_Arl7, Arf-like 4 (Arl4) and 7 (Arl7) GTPases Back     alignment and domain information
>gnl|CDD|206722 cd04157, Arl6, Arf-like 6 (Arl6) GTPase Back     alignment and domain information
>gnl|CDD|206722 cd04157, Arl6, Arf-like 6 (Arl6) GTPase Back     alignment and domain information
>gnl|CDD|206723 cd04158, ARD1, (ADP-ribosylation factor domain protein 1 (ARD1) Back     alignment and domain information
>gnl|CDD|206723 cd04158, ARD1, (ADP-ribosylation factor domain protein 1 (ARD1) Back     alignment and domain information
>gnl|CDD|206724 cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl10) GTPases Back     alignment and domain information
>gnl|CDD|206724 cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl10) GTPases Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|197556 smart00178, SAR, Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>gnl|CDD|197556 smart00178, SAR, Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|133311 cd04111, Rab39, Rab GTPase family 39 (Rab39) Back     alignment and domain information
>gnl|CDD|133311 cd04111, Rab39, Rab GTPase family 39 (Rab39) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 537
COG1126240 GlnQ ABC-type polar amino acid transport system, A 99.94
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 99.94
COG0488 530 Uup ATPase components of ABC transporters with dup 99.93
COG1127263 Ttg2A ABC-type transport system involved in resist 99.93
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 99.92
COG3842352 PotA ABC-type spermidine/putrescine transport syst 99.91
COG1136226 SalX ABC-type antimicrobial peptide transport syst 99.91
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 99.9
COG2884223 FtsE Predicted ATPase involved in cell division [C 99.9
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 99.9
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 99.9
KOG0058|consensus716 99.89
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.89
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 99.89
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 99.89
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.88
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 99.88
PRK13537306 nodulation ABC transporter NodI; Provisional 99.88
COG4175386 ProV ABC-type proline/glycine betaine transport sy 99.87
COG0411250 LivG ABC-type branched-chain amino acid transport 99.87
COG3638258 ABC-type phosphate/phosphonate transport system, A 99.87
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 99.87
COG4152300 ABC-type uncharacterized transport system, ATPase 99.87
PRK13536340 nodulation factor exporter subunit NodI; Provision 99.87
COG4988559 CydD ABC-type transport system involved in cytochr 99.87
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.86
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.86
COG4586325 ABC-type uncharacterized transport system, ATPase 99.86
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 99.86
COG4181228 Predicted ABC-type transport system involved in ly 99.85
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 99.85
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 99.85
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 99.85
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 99.85
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 99.85
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 99.85
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 99.85
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 99.85
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 99.85
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 99.85
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 99.85
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 99.84
PRK11153343 metN DL-methionine transporter ATP-binding subunit 99.84
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 99.84
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 99.84
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 99.84
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 99.84
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 99.84
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 99.84
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 99.84
PRK11607377 potG putrescine transporter ATP-binding subunit; P 99.84
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 99.84
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 99.84
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 99.84
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 99.83
COG0410237 LivF ABC-type branched-chain amino acid transport 99.83
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 99.83
PRK10070400 glycine betaine transporter ATP-binding subunit; P 99.83
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 99.83
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 99.83
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 99.83
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 99.83
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 99.83
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 99.83
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 99.83
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 99.83
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 99.83
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 99.83
KOG0059|consensus885 99.83
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 99.82
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 99.82
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 99.82
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 99.82
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 99.82
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 99.82
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 99.82
KOG0057|consensus591 99.82
PRK10790592 putative multidrug transporter membrane\ATP-bindin 99.82
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 99.82
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 99.82
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 99.82
KOG0055|consensus 1228 99.82
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 99.82
PRK11147 635 ABC transporter ATPase component; Reviewed 99.82
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 99.82
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 99.82
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 99.82
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 99.82
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 99.81
KOG0056|consensus790 99.81
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 99.81
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 99.81
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.81
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 99.81
PRK10908222 cell division protein FtsE; Provisional 99.81
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 99.81
PRK10619257 histidine/lysine/arginine/ornithine transporter su 99.81
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 99.81
PRK09473330 oppD oligopeptide transporter ATP-binding componen 99.81
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 99.81
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 99.81
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 99.81
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 99.81
KOG0055|consensus1228 99.81
COG4559259 ABC-type hemin transport system, ATPase component 99.81
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 99.81
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 99.81
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 99.81
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 99.81
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 99.81
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 99.81
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 99.81
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 99.81
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 99.81
cd03269210 ABC_putative_ATPase This subfamily is involved in 99.81
COG1123539 ATPase components of various ABC-type transport sy 99.81
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 99.81
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 99.8
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 99.8
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 99.8
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 99.8
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 99.8
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 99.8
PRK10253265 iron-enterobactin transporter ATP-binding protein; 99.8
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 99.8
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 99.8
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 99.8
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 99.8
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 99.8
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 99.8
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 99.8
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 99.8
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 99.8
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 99.8
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 99.8
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 99.8
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 99.8
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 99.8
KOG0062|consensus 582 99.8
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 99.8
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 99.8
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 99.8
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 99.8
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 99.8
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 99.79
COG1117253 PstB ABC-type phosphate transport system, ATPase c 99.79
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 99.79
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 99.79
COG4987573 CydC ABC-type transport system involved in cytochr 99.79
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 99.79
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 99.79
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 99.79
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 99.79
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 99.79
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 99.79
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 99.79
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 99.79
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 99.79
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 99.79
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 99.79
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 99.79
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 99.79
COG4598256 HisP ABC-type histidine transport system, ATPase c 99.79
PRK10789569 putative multidrug transporter membrane\ATP-bindin 99.79
PLN032321495 ABC transporter C family member; Provisional 99.79
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 99.79
PLN03073 718 ABC transporter F family; Provisional 99.79
PRK09984262 phosphonate/organophosphate ester transporter subu 99.78
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 99.78
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 99.78
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 99.78
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 99.78
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 99.78
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 99.78
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 99.78
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 99.78
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 99.78
COG4148352 ModC ABC-type molybdate transport system, ATPase c 99.78
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 99.78
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 99.78
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 99.78
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 99.78
PTZ002651466 multidrug resistance protein (mdr1); Provisional 99.78
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 99.78
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 99.78
PRK10261623 glutathione transporter ATP-binding protein; Provi 99.78
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 99.78
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 99.78
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 99.77
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 99.77
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 99.77
PLN031301622 ABC transporter C family member; Provisional 99.77
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 99.77
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 99.77
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 99.77
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 99.77
COG1123 539 ATPase components of various ABC-type transport sy 99.77
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 99.77
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 99.77
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 99.77
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 99.77
PRK10261 623 glutathione transporter ATP-binding protein; Provi 99.77
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 99.77
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 99.77
PRK14242253 phosphate transporter ATP-binding protein; Provisi 99.77
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 99.77
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 99.77
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 99.76
PRK10938 490 putative molybdenum transport ATP-binding protein 99.76
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 99.76
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 99.76
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 99.76
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 99.76
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.76
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.76
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 99.76
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 99.76
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 99.76
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 99.76
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 99.76
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 99.76
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.76
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 99.76
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 99.76
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.76
PRK14239252 phosphate transporter ATP-binding protein; Provisi 99.76
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 99.76
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 99.76
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 99.76
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 99.76
PRK10522547 multidrug transporter membrane component/ATP-bindi 99.75
PRK14235267 phosphate transporter ATP-binding protein; Provisi 99.75
PRK15064 530 ABC transporter ATP-binding protein; Provisional 99.75
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 99.75
COG4161242 ArtP ABC-type arginine transport system, ATPase co 99.75
COG1101263 PhnK ABC-type uncharacterized transport system, AT 99.75
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 99.75
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 99.75
PTZ002431560 ABC transporter; Provisional 99.75
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 99.75
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 99.75
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 99.75
PRK14241258 phosphate transporter ATP-binding protein; Provisi 99.75
KOG0927|consensus 614 99.75
PRK14240250 phosphate transporter ATP-binding protein; Provisi 99.75
COG4172534 ABC-type uncharacterized transport system, duplica 99.75
PRK09580248 sufC cysteine desulfurase ATPase component; Review 99.75
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 99.75
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 99.74
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 99.74
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 99.74
PRK11147635 ABC transporter ATPase component; Reviewed 99.74
COG4619223 ABC-type uncharacterized transport system, ATPase 99.74
PRK10636638 putative ABC transporter ATP-binding protein; Prov 99.74
cd03216163 ABC_Carb_Monos_I This family represents the domain 99.74
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 99.74
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 99.74
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.74
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.74
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 99.74
COG4525259 TauB ABC-type taurine transport system, ATPase com 99.74
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.74
cd03299235 ABC_ModC_like Archeal protein closely related to M 99.74
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 99.74
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 99.74
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 99.74
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 99.74
cd03246173 ABCC_Protease_Secretion This family represents the 99.74
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.74
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 99.74
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 99.74
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 99.74
PRK03695248 vitamin B12-transporter ATPase; Provisional 99.74
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 99.73
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 99.73
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 99.73
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 99.73
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.73
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 99.73
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.73
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 99.73
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 99.73
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 99.73
PRK14237267 phosphate transporter ATP-binding protein; Provisi 99.73
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 99.73
COG4674249 Uncharacterized ABC-type transport system, ATPase 99.73
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 99.73
cd03234226 ABCG_White The White subfamily represents ABC tran 99.73
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 99.73
PRK14236272 phosphate transporter ATP-binding protein; Provisi 99.73
cd03215182 ABC_Carb_Monos_II This family represents domain II 99.73
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 99.73
COG4618580 ArpD ABC-type protease/lipase transport system, AT 99.73
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 99.73
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 99.73
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.73
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 99.73
PRK14238271 phosphate transporter ATP-binding protein; Provisi 99.72
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.72
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 99.72
PRK14243264 phosphate transporter ATP-binding protein; Provisi 99.72
PRK10938490 putative molybdenum transport ATP-binding protein 99.72
COG0488530 Uup ATPase components of ABC transporters with dup 99.72
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 99.72
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 99.72
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 99.72
COG3845 501 ABC-type uncharacterized transport systems, ATPase 99.72
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 99.72
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 99.72
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 99.72
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 99.71
PLN03211 659 ABC transporter G-25; Provisional 99.71
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 99.71
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.71
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 99.71
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 99.71
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.71
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 99.71
COG1119257 ModF ABC-type molybdenum transport system, ATPase 99.71
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 99.71
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 99.71
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 99.71
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 99.71
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 99.7
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 99.7
COG4167267 SapF ABC-type antimicrobial peptide transport syst 99.7
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 99.7
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 99.7
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 99.7
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 99.69
PRK13546264 teichoic acids export protein ATP-binding subunit; 99.69
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 99.69
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 99.69
PLN03232 1495 ABC transporter C family member; Provisional 99.68
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 99.68
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 99.68
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 99.67
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.67
PLN03130 1622 ABC transporter C family member; Provisional 99.67
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.67
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 99.66
PLN03073718 ABC transporter F family; Provisional 99.65
PRK10535 648 macrolide transporter ATP-binding /permease protei 99.65
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 99.65
PRK13409590 putative ATPase RIL; Provisional 99.64
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 99.64
KOG0054|consensus1381 99.63
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 99.62
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 99.62
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 99.61
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 99.61
KOG0066|consensus 807 99.6
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 99.6
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 99.6
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 99.58
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.58
PLN03140 1470 ABC transporter G family member; Provisional 99.58
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.58
PRK13409 590 putative ATPase RIL; Provisional 99.58
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 99.56
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 99.54
COG1160444 Predicted GTPases [General function prediction onl 99.54
COG4172 534 ABC-type uncharacterized transport system, duplica 99.54
KOG0061|consensus 613 99.53
KOG0054|consensus 1381 99.52
KOG0927|consensus614 99.51
PLN03140 1470 ABC transporter G family member; Provisional 99.51
COG4615546 PvdE ABC-type siderophore export system, fused ATP 99.51
PRK03003472 GTP-binding protein Der; Reviewed 99.51
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 99.5
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 99.5
PF00005137 ABC_tran: ABC transporter This structure is on hol 99.5
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 99.46
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.44
PTZ00243 1560 ABC transporter; Provisional 99.44
COG4133209 CcmA ABC-type transport system involved in cytochr 99.43
KOG0066|consensus807 99.41
COG4136213 ABC-type uncharacterized transport system, ATPase 99.39
PRK00093435 GTP-binding protein Der; Reviewed 99.39
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.37
KOG0073|consensus185 99.3
KOG0070|consensus181 99.29
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 99.28
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 99.26
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 99.24
KOG0084|consensus205 99.22
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 99.21
KOG0071|consensus180 99.2
KOG0065|consensus 1391 99.2
KOG0062|consensus582 99.19
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.18
KOG0074|consensus185 99.17
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.17
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 99.13
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.12
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 99.11
COG4178604 ABC-type uncharacterized transport system, permeas 99.07
KOG0094|consensus221 99.06
KOG2355|consensus291 99.06
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.01
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.01
KOG0080|consensus209 99.0
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 98.99
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 98.99
PLN00223181 ADP-ribosylation factor; Provisional 98.99
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 98.99
KOG0078|consensus207 98.98
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 98.98
PTZ00133182 ADP-ribosylation factor; Provisional 98.98
smart00178184 SAR Sar1p-like members of the Ras-family of small 98.97
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 98.96
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 98.96
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 98.96
KOG0092|consensus200 98.95
KOG0098|consensus216 98.95
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 98.95
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 98.95
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 98.94
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 98.94
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 98.94
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 98.92
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 98.92
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 98.92
COG4170330 SapD ABC-type antimicrobial peptide transport syst 98.91
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 98.91
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 98.9
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 98.9
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 98.9
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 98.88
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 98.88
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 98.88
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 98.88
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 98.88
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 98.88
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 98.88
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 98.88
KOG0079|consensus198 98.88
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 98.88
KOG0084|consensus205 98.87
KOG0087|consensus222 98.87
KOG0394|consensus210 98.87
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 98.86
PLN03071219 GTP-binding nuclear protein Ran; Provisional 98.85
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 98.85
KOG0095|consensus213 98.84
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 98.84
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 98.84
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 98.84
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 98.84
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 98.83
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 98.83
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 98.83
KOG0060|consensus659 98.83
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 98.83
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 98.83
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 98.82
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 98.82
PTZ00369189 Ras-like protein; Provisional 98.81
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 98.81
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 98.81
KOG0075|consensus186 98.81
KOG0070|consensus181 98.81
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 98.81
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 98.8
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 98.8
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 98.8
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 98.8
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 98.8
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 98.8
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 98.79
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 98.79
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 98.78
KOG0086|consensus214 98.78
PLN00023334 GTP-binding protein; Provisional 98.78
PLN03110216 Rab GTPase; Provisional 98.78
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 98.78
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 98.78
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 98.78
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 98.78
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 98.77
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 98.77
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 98.77
PRK00635 1809 excinuclease ABC subunit A; Provisional 98.77
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 98.76
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 98.76
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 98.76
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 98.76
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 98.75
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 98.75
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 98.74
KOG0092|consensus200 98.74
PLN03108210 Rab family protein; Provisional 98.74
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 98.74
PLN03118211 Rab family protein; Provisional 98.73
KOG0073|consensus185 98.73
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 98.73
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 98.72
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 98.72
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 98.7
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 98.7
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
Probab=99.94  E-value=1.7e-28  Score=232.76  Aligned_cols=210  Identities=14%  Similarity=0.121  Sum_probs=158.7

Q ss_pred             hcccccCCCcccCCCCCCCCCcchhhcccccccccccccccCCCCCeEEEEeCCCCcHHHHHHHHhCCCCccccCceeee
Q psy16304        152 LMGIQNVPNFQTSSVLSDDPAPTFENFLDLRVLLPTHLSLFDFRSVPILVLGLDNAGKSSIIKRILGEPIISLVPTVGFN  231 (537)
Q Consensus       152 li~~~~l~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~G~~vgLVG~NGAGKSTLL~~L~G~~~~~~~Pt~G~t  231 (537)
                      ++.++++.|+||...+..+                  +++.+.+|++++|+||+||||||||++|.++    ..|++|  
T Consensus         2 mi~i~~l~K~fg~~~VLkg------------------i~l~v~~Gevv~iiGpSGSGKSTlLRclN~L----E~~~~G--   57 (240)
T COG1126           2 MIEIKNLSKSFGDKEVLKG------------------ISLSVEKGEVVVIIGPSGSGKSTLLRCLNGL----EEPDSG--   57 (240)
T ss_pred             eEEEEeeeEEeCCeEEecC------------------cceeEcCCCEEEEECCCCCCHHHHHHHHHCC----cCCCCc--
Confidence            5778999999987665554                  4577889999999999999999999999999    999999  


Q ss_pred             eEEEEECCcEEEEEeecCCCchhhHHHHhhhhccccCCCCCCCccceeeEEeecCcccccCCcccccccCcCC---cccc
Q psy16304        232 RARVEYGNKYEVFLYDLGGSEDFRTIWKQYLGTVSQTPLGRPDSRTCQVYLIMCGVHQVSGIPDELTSATHLP---LVDF  308 (537)
Q Consensus       232 ~~~i~i~g~~~i~~~D~~G~~~~r~~~~~~i~~v~Q~~~l~~~~~~~il~v~Ds~~~~~~~l~~~l~~~~~l~---~~~~  308 (537)
                        .|.++| ..+..-.      .....++.+|+|||.+.+|+.++.            .+++...........   ....
T Consensus        58 --~I~i~g-~~~~~~~------~~~~~R~~vGmVFQ~fnLFPHlTv------------leNv~lap~~v~~~~k~eA~~~  116 (240)
T COG1126          58 --SITVDG-EDVGDKK------DILKLRRKVGMVFQQFNLFPHLTV------------LENVTLAPVKVKKLSKAEAREK  116 (240)
T ss_pred             --eEEECC-Eeccchh------hHHHHHHhcCeecccccccccchH------------HHHHHhhhHHHcCCCHHHHHHH
Confidence              999987 3332111      123345889999999999999877            333332222222221   2223


Q ss_pred             CCccEEEeccCccCccchhhhhcCCCceeeecccccccceeccCCceEEEEEe--cCch--hhHHHHH---HHHHhcCCE
Q psy16304        309 RSVPILVLGLDNAGKSSIIKRILGEPIISLVPTVGFNRARVEYGNKYEVFLYD--LGGS--EDFRTIW---KQYLGTVSQ  381 (537)
Q Consensus       309 ~~~~L~llGl~~~gKs~li~~LSgG~rqrvs~ti~la~all~~~e~p~lllLD--T~Gl--~~~~~l~---~~~~~~~~~  381 (537)
                      +...+..+|+.+.. +.++.+|||||+||+    ++||++.. +  |+++++|  |+.+  +...+++   ..+.+++ -
T Consensus       117 A~~lL~~VGL~~ka-~~yP~qLSGGQqQRV----AIARALaM-~--P~vmLFDEPTSALDPElv~EVL~vm~~LA~eG-m  187 (240)
T COG1126         117 ALELLEKVGLADKA-DAYPAQLSGGQQQRV----AIARALAM-D--PKVMLFDEPTSALDPELVGEVLDVMKDLAEEG-M  187 (240)
T ss_pred             HHHHHHHcCchhhh-hhCccccCcHHHHHH----HHHHHHcC-C--CCEEeecCCcccCCHHHHHHHHHHHHHHHHcC-C
Confidence            34556689998886 667999999999999    99999996 5  8999999  9999  3334444   5555554 4


Q ss_pred             EEEEEeCCCcchhhhhh--hhhhcCCcEEEEecccch
Q psy16304        382 TLLVSHSLSGRPDDRCQ--VYLMSCNCQVYLISAKNL  416 (537)
Q Consensus       382 vIlVvdshd~~~~~~~~--i~ll~~G~ii~~g~nkdl  416 (537)
                      +++++ +|++.++..+.  +++|++|+++..++++++
T Consensus       188 TMivV-THEM~FAr~VadrviFmd~G~iie~g~p~~~  223 (240)
T COG1126         188 TMIIV-THEMGFAREVADRVIFMDQGKIIEEGPPEEF  223 (240)
T ss_pred             eEEEE-echhHHHHHhhheEEEeeCCEEEEecCHHHH
Confidence            56666 79999888766  999999999999988877



>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0058|consensus Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>KOG0059|consensus Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>KOG0057|consensus Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>KOG0055|consensus Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>KOG0056|consensus Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>KOG0055|consensus Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0062|consensus Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0927|consensus Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0054|consensus Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>KOG0066|consensus Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>KOG0061|consensus Back     alignment and domain information
>KOG0054|consensus Back     alignment and domain information
>KOG0927|consensus Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0066|consensus Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>KOG0073|consensus Back     alignment and domain information
>KOG0070|consensus Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>KOG0084|consensus Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>KOG0071|consensus Back     alignment and domain information
>KOG0065|consensus Back     alignment and domain information
>KOG0062|consensus Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>KOG0074|consensus Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>KOG0094|consensus Back     alignment and domain information
>KOG2355|consensus Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>KOG0080|consensus Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>KOG0078|consensus Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>KOG0092|consensus Back     alignment and domain information
>KOG0098|consensus Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>KOG0079|consensus Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>KOG0084|consensus Back     alignment and domain information
>KOG0087|consensus Back     alignment and domain information
>KOG0394|consensus Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>KOG0095|consensus Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>KOG0060|consensus Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>KOG0075|consensus Back     alignment and domain information
>KOG0070|consensus Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>KOG0086|consensus Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>KOG0092|consensus Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>KOG0073|consensus Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query537
3doe_A192 Complex Of Arl2 And Bart, Crystal Form 1 Length = 1 2e-11
1ksh_A186 Complex Of Arl2 And Pde Delta, Crystal Form 2 (Nati 3e-11
1ksg_A186 Complex Of Arl2 And Pde Delta, Crystal Form 1 Lengt 3e-11
4gok_B169 The Crystal Structure Of Arl2gppnhp In Complex With 4e-10
1r4a_A165 Crystal Structure Of Gtp-Bound Adp-Ribosylation Fac 2e-09
3o47_A329 Crystal Structure Of Arfgap1-Arf1 Fusion Protein Le 2e-09
3o47_A329 Crystal Structure Of Arfgap1-Arf1 Fusion Protein Le 1e-08
4dcn_A166 Crystal Structure Analysis Of The Arfaptin2 Bar Dom 3e-09
1rrg_A181 Non-Myristoylated Rat Adp-Ribosylation Factor-1 Com 4e-09
1rrg_A181 Non-Myristoylated Rat Adp-Ribosylation Factor-1 Com 1e-08
1hur_A180 Human Adp-Ribosylation Factor 1 Complexed With Gdp, 4e-09
1hur_A180 Human Adp-Ribosylation Factor 1 Complexed With Gdp, 1e-08
3aq4_A184 Molecular Insights Into Plant Cell Proliferation Di 5e-09
3aq4_A184 Molecular Insights Into Plant Cell Proliferation Di 2e-08
1upt_A171 Structure Of A Complex Of The Golgin-245 Grip Domai 5e-09
3rd1_A178 Structure Of An Adp Ribosylation Factor From Entamo 5e-09
1z6x_A180 Structure Of Human Adp-Ribosylation Factor 4 Length 6e-09
1z6x_A180 Structure Of Human Adp-Ribosylation Factor 4 Length 2e-08
3lrp_A181 Crystal Structure Of Plasmodium Falciparum Adp-Ribo 7e-09
3lrp_A181 Crystal Structure Of Plasmodium Falciparum Adp-Ribo 2e-08
2k5u_A181 Solution Structure Of Myirstoylated Yeast Arf1 Prot 7e-09
2k5u_A181 Solution Structure Of Myirstoylated Yeast Arf1 Prot 2e-08
1mr3_F181 Saccharomyces Cerevisiae Adp-Ribosylation Factor 2 8e-09
1mr3_F181 Saccharomyces Cerevisiae Adp-Ribosylation Factor 2 3e-08
2ksq_A181 The Myristoylated Yeast Arf1 In A Gtp And Bicelle B 1e-08
2ksq_A181 The Myristoylated Yeast Arf1 In A Gtp And Bicelle B 5e-08
1j2j_A166 Crystal Structure Of Gga1 Gat N-terminal Region In 2e-08
1ksj_A186 Complex Of Arl2 And Pde Delta, Crystal Form 2 (Seme 2e-08
1re0_A164 Structure Of Arf1-Gdp Bound To Sec7 Domain Complexe 2e-08
2b6h_A192 Structure Of Human Adp-Ribosylation Factor 5 Length 2e-08
2b6h_A192 Structure Of Human Adp-Ribosylation Factor 5 Length 4e-08
4goj_A189 The Crystal Structure Of Full Length Arl3gppnhp In 2e-08
4goj_A189 The Crystal Structure Of Full Length Arl3gppnhp In 2e-08
1fzq_A181 Crystal Structure Of Murine Arl3-Gdp Length = 181 2e-08
1fzq_A181 Crystal Structure Of Murine Arl3-Gdp Length = 181 2e-08
3bh7_A164 Crystal Structure Of The Rp2-Arl3 Complex Bound To 4e-08
3bh7_A164 Crystal Structure Of The Rp2-Arl3 Complex Bound To 4e-08
3tjz_A164 Crystal Structure Of Arf1 Bound To The GammaZETA-Co 4e-08
2a5d_A175 Structural Basis For The Activation Of Cholera Toxi 7e-08
2a5d_A175 Structural Basis For The Activation Of Cholera Toxi 1e-07
1e0s_A174 Small G Protein Arf6-Gdp Length = 174 8e-08
1e0s_A174 Small G Protein Arf6-Gdp Length = 174 1e-07
3bh6_A164 Crystal Structure Of The Rp2-Arl3 Complex Bound To 8e-08
3bh6_A164 Crystal Structure Of The Rp2-Arl3 Complex Bound To 8e-08
1moz_A183 Adp-Ribosylation Factor-Like 1 (Arl1) From Saccharo 1e-07
3lvr_E497 The Crystal Structure Of Asap3 In Complex With Arf6 1e-07
3pcr_B162 Structure Of Espg-Arf6 Complex Length = 162 1e-07
2a5g_A175 Cholera Toxin A1 Subunit Bound To Arf6(Q67l) Length 2e-07
2a5g_A175 Cholera Toxin A1 Subunit Bound To Arf6(Q67l) Length 2e-07
4fme_C160 Espg-Rab1-Arf6 Complex Length = 160 2e-07
3n5c_A162 Crystal Structure Of Arf6delta13 Complexed With Gdp 2e-07
2w83_A165 Crystal Structure Of The Arf6 Gtpase In Complex Wit 3e-07
3vhx_A172 The Crystal Structure Of Arf6-Mklp1 (Mitotic Kinesi 3e-07
1yzg_A179 Structure Of Human Adp-ribosylation Factor-like 8 L 4e-07
1yzg_A179 Structure Of Human Adp-ribosylation Factor-like 8 L 5e-07
2h18_A193 Structure Of Human Adp-Ribosylation Factor-Like 10b 5e-07
2h18_A193 Structure Of Human Adp-Ribosylation Factor-Like 10b 2e-05
1z6y_A179 Structure Of Human Adp-Ribosylation Factor-Like 5 L 1e-06
1z6y_A179 Structure Of Human Adp-Ribosylation Factor-Like 5 L 1e-05
1zj6_A187 Crystal Structure Of Human Arl5 Length = 187 1e-06
1zj6_A187 Crystal Structure Of Human Arl5 Length = 187 1e-05
1zd9_A188 Structure Of Human Adp-Ribosylation Factor-Like 10b 2e-06
1zd9_A188 Structure Of Human Adp-Ribosylation Factor-Like 10b 2e-05
2al7_A186 Structure Of Human Adp-Ribosylation Factor-Like 10c 5e-06
2al7_A186 Structure Of Human Adp-Ribosylation Factor-Like 10c 4e-05
2h16_A183 Structure Of Human Adp-Ribosylation Factor-Like 5 ( 2e-05
2h17_A181 Structure Of Human Adp-Ribosylation Factor-Like 5 ( 2e-05
2h17_A181 Structure Of Human Adp-Ribosylation Factor-Like 5 ( 2e-05
4bas_A199 Structure Of The Arl6 Bbs3 Small Gtpase From Trypan 3e-05
2qtv_B167 Structure Of Sec23-Sar1 Complexed With The Active F 2e-04
1m2o_B190 Crystal Structure Of The Sec23-Sar1 Complex Length 4e-04
2h57_A190 Crystal Structure Of Human Adp-Ribosylation Factor- 5e-04
2h57_A190 Crystal Structure Of Human Adp-Ribosylation Factor- 5e-04
2gao_A208 Crystal Structure Of Human Sar1a In Complex With Gd 5e-04
>pdb|3DOE|A Chain A, Complex Of Arl2 And Bart, Crystal Form 1 Length = 192 Back     alignment and structure

Iteration: 1

Score = 67.0 bits (162), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 35/105 (33%), Positives = 60/105 (57%), Gaps = 1/105 (0%) Query: 309 RSVPILVLGLDNAGKSSIIKRILGEPIISLVPTVGFNRARVEYGNKYEVFLYDLGGSEDF 368 R + +L+LGLDNAGK++I+K+ GE I ++ PT+GFN +E+ +++ ++D+GG + Sbjct: 15 RELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEH-RGFKLNIWDVGGQKSL 73 Query: 369 RTIWKQYLGTVSQTLLVSHSLSGRPDDRCQVYLMSCNCQVYLISA 413 R+ W+ Y + + V S + CQ L S + L A Sbjct: 74 RSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGA 118
>pdb|1KSH|A Chain A, Complex Of Arl2 And Pde Delta, Crystal Form 2 (Native) Length = 186 Back     alignment and structure
>pdb|1KSG|A Chain A, Complex Of Arl2 And Pde Delta, Crystal Form 1 Length = 186 Back     alignment and structure
>pdb|4GOK|B Chain B, The Crystal Structure Of Arl2gppnhp In Complex With Unc119a Length = 169 Back     alignment and structure
>pdb|1R4A|A Chain A, Crystal Structure Of Gtp-Bound Adp-Ribosylation Factor Like Protein 1 (Arl1) And Grip Domain Of Golgin245 Complex Length = 165 Back     alignment and structure
>pdb|3O47|A Chain A, Crystal Structure Of Arfgap1-Arf1 Fusion Protein Length = 329 Back     alignment and structure
>pdb|3O47|A Chain A, Crystal Structure Of Arfgap1-Arf1 Fusion Protein Length = 329 Back     alignment and structure
>pdb|4DCN|A Chain A, Crystal Structure Analysis Of The Arfaptin2 Bar Domain In Complex With Arl1 Length = 166 Back     alignment and structure
>pdb|1RRG|A Chain A, Non-Myristoylated Rat Adp-Ribosylation Factor-1 Complexed With Gdp, Dimeric Crystal Form Length = 181 Back     alignment and structure
>pdb|1RRG|A Chain A, Non-Myristoylated Rat Adp-Ribosylation Factor-1 Complexed With Gdp, Dimeric Crystal Form Length = 181 Back     alignment and structure
>pdb|1HUR|A Chain A, Human Adp-Ribosylation Factor 1 Complexed With Gdp, Full Length = 180 Back     alignment and structure
>pdb|1HUR|A Chain A, Human Adp-Ribosylation Factor 1 Complexed With Gdp, Full Length = 180 Back     alignment and structure
>pdb|3AQ4|A Chain A, Molecular Insights Into Plant Cell Proliferation Disturbance By Agrobacterium Protein 6b Length = 184 Back     alignment and structure
>pdb|3AQ4|A Chain A, Molecular Insights Into Plant Cell Proliferation Disturbance By Agrobacterium Protein 6b Length = 184 Back     alignment and structure
>pdb|1UPT|A Chain A, Structure Of A Complex Of The Golgin-245 Grip Domain With Arl1 Length = 171 Back     alignment and structure
>pdb|3RD1|A Chain A, Structure Of An Adp Ribosylation Factor From Entamoeba Histolytica Hm- 1:imss Bound To Mg-Gdp Length = 178 Back     alignment and structure
>pdb|1Z6X|A Chain A, Structure Of Human Adp-Ribosylation Factor 4 Length = 180 Back     alignment and structure
>pdb|1Z6X|A Chain A, Structure Of Human Adp-Ribosylation Factor 4 Length = 180 Back     alignment and structure
>pdb|3LRP|A Chain A, Crystal Structure Of Plasmodium Falciparum Adp-Ribosylation Factor 1 Length = 181 Back     alignment and structure
>pdb|3LRP|A Chain A, Crystal Structure Of Plasmodium Falciparum Adp-Ribosylation Factor 1 Length = 181 Back     alignment and structure
>pdb|2K5U|A Chain A, Solution Structure Of Myirstoylated Yeast Arf1 Protein, Gdp- Bound Length = 181 Back     alignment and structure
>pdb|2K5U|A Chain A, Solution Structure Of Myirstoylated Yeast Arf1 Protein, Gdp- Bound Length = 181 Back     alignment and structure
>pdb|1MR3|F Chain F, Saccharomyces Cerevisiae Adp-Ribosylation Factor 2 (Scarf2) Complexed With Gdp-3'p At 1.6a Resolution Length = 181 Back     alignment and structure
>pdb|1MR3|F Chain F, Saccharomyces Cerevisiae Adp-Ribosylation Factor 2 (Scarf2) Complexed With Gdp-3'p At 1.6a Resolution Length = 181 Back     alignment and structure
>pdb|2KSQ|A Chain A, The Myristoylated Yeast Arf1 In A Gtp And Bicelle Bound Conformation Length = 181 Back     alignment and structure
>pdb|2KSQ|A Chain A, The Myristoylated Yeast Arf1 In A Gtp And Bicelle Bound Conformation Length = 181 Back     alignment and structure
>pdb|1J2J|A Chain A, Crystal Structure Of Gga1 Gat N-terminal Region In Complex With Arf1 Gtp Form Length = 166 Back     alignment and structure
>pdb|1KSJ|A Chain A, Complex Of Arl2 And Pde Delta, Crystal Form 2 (Semet) Length = 186 Back     alignment and structure
>pdb|1RE0|A Chain A, Structure Of Arf1-Gdp Bound To Sec7 Domain Complexed With Brefeldin A Length = 164 Back     alignment and structure
>pdb|2B6H|A Chain A, Structure Of Human Adp-Ribosylation Factor 5 Length = 192 Back     alignment and structure
>pdb|2B6H|A Chain A, Structure Of Human Adp-Ribosylation Factor 5 Length = 192 Back     alignment and structure
>pdb|4GOJ|A Chain A, The Crystal Structure Of Full Length Arl3gppnhp In Complex With Unc119a Length = 189 Back     alignment and structure
>pdb|4GOJ|A Chain A, The Crystal Structure Of Full Length Arl3gppnhp In Complex With Unc119a Length = 189 Back     alignment and structure
>pdb|1FZQ|A Chain A, Crystal Structure Of Murine Arl3-Gdp Length = 181 Back     alignment and structure
>pdb|1FZQ|A Chain A, Crystal Structure Of Murine Arl3-Gdp Length = 181 Back     alignment and structure
>pdb|3BH7|A Chain A, Crystal Structure Of The Rp2-Arl3 Complex Bound To Gdp-Alf4 Length = 164 Back     alignment and structure
>pdb|3BH7|A Chain A, Crystal Structure Of The Rp2-Arl3 Complex Bound To Gdp-Alf4 Length = 164 Back     alignment and structure
>pdb|3TJZ|A Chain A, Crystal Structure Of Arf1 Bound To The GammaZETA-Cop Core Complex Length = 164 Back     alignment and structure
>pdb|2A5D|A Chain A, Structural Basis For The Activation Of Cholera Toxin By Human Arf6-Gtp Length = 175 Back     alignment and structure
>pdb|2A5D|A Chain A, Structural Basis For The Activation Of Cholera Toxin By Human Arf6-Gtp Length = 175 Back     alignment and structure
>pdb|1E0S|A Chain A, Small G Protein Arf6-Gdp Length = 174 Back     alignment and structure
>pdb|1E0S|A Chain A, Small G Protein Arf6-Gdp Length = 174 Back     alignment and structure
>pdb|3BH6|A Chain A, Crystal Structure Of The Rp2-Arl3 Complex Bound To Gppnhp Length = 164 Back     alignment and structure
>pdb|3BH6|A Chain A, Crystal Structure Of The Rp2-Arl3 Complex Bound To Gppnhp Length = 164 Back     alignment and structure
>pdb|1MOZ|A Chain A, Adp-Ribosylation Factor-Like 1 (Arl1) From Saccharomyces Cerevisiae Length = 183 Back     alignment and structure
>pdb|3LVR|E Chain E, The Crystal Structure Of Asap3 In Complex With Arf6 In Trans State Soaked With Calcium Length = 497 Back     alignment and structure
>pdb|3PCR|B Chain B, Structure Of Espg-Arf6 Complex Length = 162 Back     alignment and structure
>pdb|2A5G|A Chain A, Cholera Toxin A1 Subunit Bound To Arf6(Q67l) Length = 175 Back     alignment and structure
>pdb|2A5G|A Chain A, Cholera Toxin A1 Subunit Bound To Arf6(Q67l) Length = 175 Back     alignment and structure
>pdb|4FME|C Chain C, Espg-Rab1-Arf6 Complex Length = 160 Back     alignment and structure
>pdb|3N5C|A Chain A, Crystal Structure Of Arf6delta13 Complexed With Gdp Length = 162 Back     alignment and structure
>pdb|2W83|A Chain A, Crystal Structure Of The Arf6 Gtpase In Complex With A Specific Effector, Jip4 Length = 165 Back     alignment and structure
>pdb|3VHX|A Chain A, The Crystal Structure Of Arf6-Mklp1 (Mitotic Kinesin-Like Protein 1) Complex Length = 172 Back     alignment and structure
>pdb|1YZG|A Chain A, Structure Of Human Adp-ribosylation Factor-like 8 Length = 179 Back     alignment and structure
>pdb|1YZG|A Chain A, Structure Of Human Adp-ribosylation Factor-like 8 Length = 179 Back     alignment and structure
>pdb|2H18|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10b (Arl10b) Length = 193 Back     alignment and structure
>pdb|2H18|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10b (Arl10b) Length = 193 Back     alignment and structure
>pdb|1Z6Y|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 5 Length = 179 Back     alignment and structure
>pdb|1Z6Y|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 5 Length = 179 Back     alignment and structure
>pdb|1ZJ6|A Chain A, Crystal Structure Of Human Arl5 Length = 187 Back     alignment and structure
>pdb|1ZJ6|A Chain A, Crystal Structure Of Human Arl5 Length = 187 Back     alignment and structure
>pdb|1ZD9|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10b Length = 188 Back     alignment and structure
>pdb|1ZD9|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10b Length = 188 Back     alignment and structure
>pdb|2AL7|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10c Length = 186 Back     alignment and structure
>pdb|2AL7|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10c Length = 186 Back     alignment and structure
>pdb|2H16|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 5 (Arl5) Length = 183 Back     alignment and structure
>pdb|2H17|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 5 (Arl5) (Casp Target) Length = 181 Back     alignment and structure
>pdb|2H17|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 5 (Arl5) (Casp Target) Length = 181 Back     alignment and structure
>pdb|4BAS|A Chain A, Structure Of The Arl6 Bbs3 Small Gtpase From Trypanosoma Brucei With Bound Nucleotide Analogue Gppnp Length = 199 Back     alignment and structure
>pdb|2QTV|B Chain B, Structure Of Sec23-Sar1 Complexed With The Active Fragment Of Sec31 Length = 167 Back     alignment and structure
>pdb|1M2O|B Chain B, Crystal Structure Of The Sec23-Sar1 Complex Length = 190 Back     alignment and structure
>pdb|2H57|A Chain A, Crystal Structure Of Human Adp-Ribosylation Factor-Like 6 Length = 190 Back     alignment and structure
>pdb|2H57|A Chain A, Crystal Structure Of Human Adp-Ribosylation Factor-Like 6 Length = 190 Back     alignment and structure
>pdb|2GAO|A Chain A, Crystal Structure Of Human Sar1a In Complex With Gdp Length = 208 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query537
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 1e-19
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 1e-18
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 2e-19
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 3e-18
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 5e-19
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 5e-19
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 5e-19
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 2e-18
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 7e-19
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 7e-19
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 7e-19
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 7e-19
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 8e-19
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 6e-18
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 8e-19
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 8e-19
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 1e-18
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 2e-18
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 4e-18
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 4e-18
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 6e-18
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 6e-18
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 6e-18
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 6e-18
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 8e-17
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 8e-17
1nrj_B218 SR-beta, signal recognition particle receptor beta 1e-13
1nrj_B218 SR-beta, signal recognition particle receptor beta 3e-11
2fh5_B214 SR-beta, signal recognition particle receptor beta 1e-13
2fh5_B214 SR-beta, signal recognition particle receptor beta 3e-13
2ged_A193 SR-beta, signal recognition particle receptor beta 3e-13
2ged_A193 SR-beta, signal recognition particle receptor beta 1e-11
3t1o_A198 Gliding protein MGLA; G domain containing protein, 5e-13
3t1o_A198 Gliding protein MGLA; G domain containing protein, 7e-12
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 7e-12
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 1e-10
3llu_A196 RAS-related GTP-binding protein C; structural geno 1e-11
3llu_A196 RAS-related GTP-binding protein C; structural geno 2e-11
3o47_A329 ADP-ribosylation factor GTPase-activating protein 8e-11
3o47_A329 ADP-ribosylation factor GTPase-activating protein 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 4e-08
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 4e-08
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 4e-04
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 6e-04
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 8e-04
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 187 Back     alignment and structure
 Score = 85.8 bits (213), Expect = 1e-19
 Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 189 LSLFDFRSVPILVLGLDNAGKSSIIKRILGEPIISLVPTVGFNRARVEYGNKYEVFLYDL 248
             LF+ +   ++++GLDNAGK++I+ +     ++   PT+G N   +   N     ++D+
Sbjct: 9   WRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINN-TRFLMWDI 67

Query: 249 GGSEDFRTIWKQY 261
           GG E  R+ W  Y
Sbjct: 68  GGQESLRSSWNTY 80


>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 187 Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Length = 192 Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Length = 192 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Length = 186 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Length = 186 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Length = 171 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Length = 171 Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Length = 181 Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Length = 181 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Length = 181 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Length = 181 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Length = 189 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Length = 189 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Length = 164 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Length = 164 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Length = 188 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Length = 188 Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Length = 190 Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Length = 190 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Length = 198 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Length = 198 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 183 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 183 Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Length = 190 Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Length = 190 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 218 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 218 Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Length = 214 Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Length = 214 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Length = 193 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Length = 193 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Length = 198 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Length = 198 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Length = 196 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Length = 196 Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Length = 329 Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Length = 329 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} Length = 307 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} Length = 307 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Length = 413 Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} Length = 331 Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} Length = 331 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query537
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 99.9
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 99.9
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 99.89
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 99.89
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 99.89
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 99.89
1b0u_A262 Histidine permease; ABC transporter, transport pro 99.89
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 99.89
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 99.88
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 99.88
1g6h_A257 High-affinity branched-chain amino acid transport 99.88
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 99.88
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 99.88
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 99.88
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 99.88
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 99.87
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 99.87
1ji0_A240 ABC transporter; ATP binding protein, structural g 99.87
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 99.87
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 99.87
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 99.86
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 99.86
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 99.85
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 99.85
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 99.85
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 99.85
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 99.85
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 99.85
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 99.84
1sgw_A214 Putative ABC transporter; structural genomics, P p 99.84
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 99.84
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 99.84
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 99.83
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 99.83
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 99.83
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 99.83
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 99.82
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 99.82
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 99.82
2ghi_A260 Transport protein; multidrug resistance protein, M 99.82
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 99.81
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 99.8
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 99.79
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 99.79
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.77
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.76
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 99.74
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 99.67
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 99.67
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.67
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.65
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 99.63
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 99.61
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 99.6
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.59
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 99.55
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.55
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.52
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.51
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 99.5
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 99.49
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 99.47
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.42
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.36
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 99.33
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.27
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 99.26
4aby_A415 DNA repair protein RECN; hydrolase, double strand 99.24
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 99.23
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 99.22
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 99.19
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 99.18
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 99.18
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.15
2og2_A359 Putative signal recognition particle receptor; nuc 99.12
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.09
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 99.08
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.08
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.04
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.02
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 98.99
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 98.99
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 98.99
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 98.98
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 98.97
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 98.97
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 98.96
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 98.95
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 98.94
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 98.94
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 98.93
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 98.92
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 98.92
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 98.92
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 98.91
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 98.91
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 98.91
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 98.9
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 98.9
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 98.88
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 98.87
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 98.87
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 98.86
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 98.84
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 98.83
1e69_A322 Chromosome segregation SMC protein; structural mai 98.83
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 98.83
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 98.82
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 98.81
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 98.8
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 98.8
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 98.79
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 98.78
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 98.78
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 98.78
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 98.77
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 98.77
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 98.77
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 98.76
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 98.76
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 98.76
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 98.75
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 98.75
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 98.75
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 98.75
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 98.74
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 98.74
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 98.74
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 98.74
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 98.74
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 98.74
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 98.74
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 98.74
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 98.74
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 98.74
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 98.74
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 98.73
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 98.73
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 98.73
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 98.73
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 98.72
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 98.72
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 98.72
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 98.72
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 98.72
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 98.72
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 98.72
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 98.71
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 98.71
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 98.71
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 98.71
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 98.7
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 98.7
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 98.7
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 98.69
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 98.69
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 98.68
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 98.68
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 98.68
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 98.68
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 98.68
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 98.67
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 98.67
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 98.67
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 98.67
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 98.67
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 98.67
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 98.66
3t1o_A198 Gliding protein MGLA; G domain containing protein, 98.66
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 98.66
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 98.66
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 98.65
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 98.65
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 98.65
3o47_A329 ADP-ribosylation factor GTPase-activating protein 98.65
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 98.64
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 98.64
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 98.63
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 98.63
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 98.63
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 98.62
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 98.62
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 98.6
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 98.6
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 98.6
2wji_A165 Ferrous iron transport protein B homolog; membrane 98.59
2fh5_B214 SR-beta, signal recognition particle receptor beta 98.58
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 98.58
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 98.58
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 98.56
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 98.55
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 98.54
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 98.54
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 98.54
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 98.53
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 98.53
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 98.52
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 98.5
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 98.49
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 98.48
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 98.48
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 98.48
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 98.47
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 98.47
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 98.47
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 98.46
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 98.46
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 98.45
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 98.44
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 98.44
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 98.43
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 97.8
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 98.43
3llu_A196 RAS-related GTP-binding protein C; structural geno 98.42
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 98.41
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 98.41
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 98.4
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 98.4
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 98.4
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 98.37
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 98.37
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 98.36
3lxx_A239 GTPase IMAP family member 4; structural genomics c 98.35
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 98.35
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 98.35
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 98.34
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 98.32
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 98.32
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 98.31
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 98.31
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 98.29
3iby_A256 Ferrous iron transport protein B; G protein, G dom 98.28
3lxw_A247 GTPase IMAP family member 1; immunity, structural 98.28
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 98.27
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 98.26
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 98.26
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 98.24
1nrj_B218 SR-beta, signal recognition particle receptor beta 98.23
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 98.23
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 98.23
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 98.21
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 98.2
2ged_A193 SR-beta, signal recognition particle receptor beta 98.19
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 98.19
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 98.18
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 98.18
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 98.17
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 98.16
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 98.16
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 98.15
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 98.15
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 98.15
1jal_A363 YCHF protein; nucleotide-binding fold, structural 98.14
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 98.13
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 98.13
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 98.12
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 98.12
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 98.1
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 98.1
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 98.1
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 98.09
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 98.08
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 98.08
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 98.07
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 98.06
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 98.05
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 98.04
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 98.03
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 98.02
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 98.01
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 98.01
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 98.01
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 98.01
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 98.0
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 97.99
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 97.99
3o47_A329 ADP-ribosylation factor GTPase-activating protein 97.98
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 97.97
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 97.97
2eyu_A261 Twitching motility protein PILT; pilus retraction 97.96
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 97.96
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 97.96
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 97.95
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 97.94
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 97.93
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 97.93
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 97.89
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 97.89
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 97.88
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 97.88
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 97.87
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 97.87
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 97.87
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 97.86
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 97.86
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 97.86
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 97.85
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 97.85
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 97.85
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 97.84
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 97.84
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 97.84
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 97.84
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 97.84
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 97.83
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 97.83
3t1o_A198 Gliding protein MGLA; G domain containing protein, 97.83
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 97.82
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 97.82
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 97.82
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 97.81
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 97.81
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 97.8
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 97.79
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 97.78
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 97.78
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 97.78
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 97.77
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 97.77
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 97.76
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 97.76
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 97.76
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 97.76
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 97.75
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 97.75
1wxq_A397 GTP-binding protein; structural genomics, riken st 97.75
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 97.75
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 97.74
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 97.74
4a74_A231 DNA repair and recombination protein RADA; hydrola 97.74
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 97.74
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 97.73
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 97.73
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 97.73
2fh5_B214 SR-beta, signal recognition particle receptor beta 97.72
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 97.71
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 97.7
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 97.7
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 97.69
2oap_1511 GSPE-2, type II secretion system protein; hexameri 97.69
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 97.69
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 97.69
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 97.68
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 97.67
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 97.67
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 97.66
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 97.66
3cnl_A262 YLQF, putative uncharacterized protein; circular p 97.66
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 97.66
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 97.65
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 97.65
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 97.65
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 97.64
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 97.64
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 97.64
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 97.63
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 97.63
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 97.62
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 97.62
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 97.61
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 97.61
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 97.61
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 97.61
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 97.61
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 97.61
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 97.61
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 97.6
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 97.6
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 97.6
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 97.6
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 97.6
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 97.58
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 97.58
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 97.58
3llu_A196 RAS-related GTP-binding protein C; structural geno 97.57
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 97.56
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 97.55
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 97.55
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 97.55
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 97.55
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 97.53
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 97.53
2elf_A370 Protein translation elongation factor 1A; tRNA, py 97.52
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 97.52
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 97.52
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 97.52
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 97.51
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 97.51
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 97.5
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 97.5
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 97.49
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 97.49
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 97.49
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 97.48
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 97.48
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 97.47
2ewv_A372 Twitching motility protein PILT; pilus retraction 97.47
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 97.47
1wb1_A 482 Translation elongation factor SELB; selenocysteine 97.47
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 97.45
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 97.45
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 97.45
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 97.45
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 97.44
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 97.43
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 97.43
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.42
1p9r_A418 General secretion pathway protein E; bacterial typ 97.42
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 97.42
1f60_A458 Elongation factor EEF1A; protein-protein complex, 97.41
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 97.4
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 97.39
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 97.39
3kta_A182 Chromosome segregation protein SMC; structural mai 97.39
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 97.37
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 97.37
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 97.37
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 97.37
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 97.36
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 97.36
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 97.35
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 97.35
2wji_A165 Ferrous iron transport protein B homolog; membrane 97.35
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 97.34
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 97.34
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 97.33
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 97.33
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 97.33
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 97.31
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 97.3
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 97.29
1nrj_B218 SR-beta, signal recognition particle receptor beta 97.28
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 97.28
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 97.27
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 97.27
3iby_A256 Ferrous iron transport protein B; G protein, G dom 97.26
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 97.22
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 97.21
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 97.21
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 97.2
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 97.18
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 97.17
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 97.16
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 97.16
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.15
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 97.14
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.13
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.12
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 97.11
2ged_A193 SR-beta, signal recognition particle receptor beta 97.09
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 97.07
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 96.14
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 97.07
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 97.07
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 97.06
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.06
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 97.04
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 97.03
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 97.02
2www_A349 Methylmalonic aciduria type A protein, mitochondri 97.02
3lxw_A247 GTPase IMAP family member 1; immunity, structural 97.02
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 97.01
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.01
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 97.0
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 96.97
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 96.96
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 96.93
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 96.92
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 96.89
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.89
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.88
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 96.87
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 96.86
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 96.85
1vma_A306 Cell division protein FTSY; TM0570, structural gen 96.83
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 96.82
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 96.8
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 96.78
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 96.77
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 96.76
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 96.71
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 96.7
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 96.7
2cvh_A220 DNA repair and recombination protein RADB; filamen 96.69
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 96.69
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 96.67
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 96.66
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 96.64
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 96.62
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 96.6
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 96.6
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 96.59
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 96.51
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 96.51
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 96.5
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 96.5
3lxx_A239 GTPase IMAP family member 4; structural genomics c 96.49
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 96.47
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 96.47
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 96.46
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
Probab=99.90  E-value=2e-25  Score=231.86  Aligned_cols=213  Identities=14%  Similarity=0.140  Sum_probs=150.0

Q ss_pred             hcccccCCCcccCCCCCCCCCcchhhcccccccccccccccCCCCCeEEEEeCCCCcHHHHHHHHhCCCCccccCceeee
Q psy16304        152 LMGIQNVPNFQTSSVLSDDPAPTFENFLDLRVLLPTHLSLFDFRSVPILVLGLDNAGKSSIIKRILGEPIISLVPTVGFN  231 (537)
Q Consensus       152 li~~~~l~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~G~~vgLVG~NGAGKSTLL~~L~G~~~~~~~Pt~G~t  231 (537)
                      ++.++++.+.|++..                  +...++|.+.+|++++|+||||||||||+++|+|.    ..|++|  
T Consensus         4 ~l~i~~ls~~y~~~~------------------~L~~vsl~i~~Ge~~~llGpsGsGKSTLLr~iaGl----~~p~~G--   59 (359)
T 3fvq_A            4 ALHIGHLSKSFQNTP------------------VLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGF----EQPDSG--   59 (359)
T ss_dssp             CEEEEEEEEEETTEE------------------EEEEEEEEECTTCEEEEEESTTSSHHHHHHHHHTS----SCCSEE--
T ss_pred             EEEEEeEEEEECCEE------------------EEEeeEEEEcCCCEEEEECCCCchHHHHHHHHhcC----CCCCCc--
Confidence            567888888876432                  23345678889999999999999999999999999    999999  


Q ss_pred             eEEEEECCcEEEEEeecCCCchhhHHHHhhhhccccCCCCCCCccceeeEEeecCcccccCCcccccccCcC--CccccC
Q psy16304        232 RARVEYGNKYEVFLYDLGGSEDFRTIWKQYLGTVSQTPLGRPDSRTCQVYLIMCGVHQVSGIPDELTSATHL--PLVDFR  309 (537)
Q Consensus       232 ~~~i~i~g~~~i~~~D~~G~~~~r~~~~~~i~~v~Q~~~l~~~~~~~il~v~Ds~~~~~~~l~~~l~~~~~l--~~~~~~  309 (537)
                        +|.++| .++...+. ....    .++.+++|||++.+++.++.            .+++...+......  ....+.
T Consensus        60 --~I~i~G-~~i~~~~~-~~~~----~~r~ig~vfQ~~~l~p~ltV------------~eni~~~l~~~~~~~~~~~~~v  119 (359)
T 3fvq_A           60 --EISLSG-KTIFSKNT-NLPV----RERRLGYLVQEGVLFPHLTV------------YRNIAYGLGNGKGRTAQERQRI  119 (359)
T ss_dssp             --EEEETT-EEEESSSC-BCCG----GGSCCEEECTTCCCCTTSCH------------HHHHHTTSTTSSCCSHHHHHHH
T ss_pred             --EEEECC-EECccccc-ccch----hhCCEEEEeCCCcCCCCCCH------------HHHHHHHHHHcCCChHHHHHHH
Confidence              999997 55532111 1111    23679999999988876554            11111111100000  011123


Q ss_pred             CccEEEeccCccCccchhhhhcCCCceeeecccccccceeccCCceEEEEEe--cCchhhH--HHHH---HHHHhcCCEE
Q psy16304        310 SVPILVLGLDNAGKSSIIKRILGEPIISLVPTVGFNRARVEYGNKYEVFLYD--LGGSEDF--RTIW---KQYLGTVSQT  382 (537)
Q Consensus       310 ~~~L~llGl~~~gKs~li~~LSgG~rqrvs~ti~la~all~~~e~p~lllLD--T~Gl~~~--~~l~---~~~~~~~~~v  382 (537)
                      ...+..+|+.+.. .+.+.+|||||+||+    ++|++++. +  |++++||  |++++..  ..++   ..+.++.+.+
T Consensus       120 ~~~l~~~gL~~~~-~r~~~~LSGGq~QRV----alArAL~~-~--P~lLLLDEPts~LD~~~r~~l~~~l~~~~~~~g~t  191 (359)
T 3fvq_A          120 EAMLELTGISELA-GRYPHELSGGQQQRA----ALARALAP-D--PELILLDEPFSALDEQLRRQIREDMIAALRANGKS  191 (359)
T ss_dssp             HHHHHHHTCGGGT-TSCGGGSCHHHHHHH----HHHHHHTT-C--CSEEEEESTTTTSCHHHHHHHHHHHHHHHHHTTCE
T ss_pred             HHHHHHcCCchHh-cCChhhCCHHHHHHH----HHHHHHHc-C--CCEEEEeCCcccCCHHHHHHHHHHHHHHHHhCCCE
Confidence            3445578887765 455999999999999    99999996 4  8999999  9999322  2233   3444455567


Q ss_pred             EEEEeCCCcchhhhhh--hhhhcCCcEEEEecccchh
Q psy16304        383 LLVSHSLSGRPDDRCQ--VYLMSCNCQVYLISAKNLS  417 (537)
Q Consensus       383 IlVvdshd~~~~~~~~--i~ll~~G~ii~~g~nkdl~  417 (537)
                      ++++ +||..++...+  +++|++|+++..|++.++.
T Consensus       192 vi~v-THd~~ea~~~aDri~vl~~G~i~~~g~~~el~  227 (359)
T 3fvq_A          192 AVFV-SHDREEALQYADRIAVMKQGRILQTASPHELY  227 (359)
T ss_dssp             EEEE-CCCHHHHHHHCSEEEEEETTEEEEEECHHHHH
T ss_pred             EEEE-eCCHHHHHHHCCEEEEEECCEEEEEeCHHHHH
Confidence            7777 89998876543  9999999999999998874



>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 537
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 1e-09
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 2e-09
d1azta2221 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha sub 2e-09
d1azta2221 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha sub 6e-08
d1moza_182 c.37.1.8 (A:) ADP-ribosylation factor {Baker's yea 2e-09
d1moza_182 c.37.1.8 (A:) ADP-ribosylation factor {Baker's yea 8e-08
d2fh5b1207 c.37.1.8 (B:63-269) Signal recognition particle re 2e-09
d2fh5b1207 c.37.1.8 (B:63-269) Signal recognition particle re 5e-06
d2bcgy1194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 3e-09
d2bcgy1194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 9e-09
d1zcba2200 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha sub 2e-08
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 3e-08
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 3e-08
d2ew1a1171 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta 3e-08
d2ew1a1171 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta 4e-08
d1ksha_165 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 1e-07
d1ksha_165 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 1e-07
d1e0sa_173 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 2e-07
d1e0sa_173 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 3e-06
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 2e-07
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 5e-07
d2f7sa1186 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [T 2e-07
d2f7sa1186 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [T 1e-06
d1zj6a1177 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human 2e-07
d1zj6a1177 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human 5e-07
d1r8sa_160 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 4e-07
d1r8sa_160 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 1e-06
d2qtvb1166 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom 6e-07
d2qtvb1166 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom 2e-06
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 2e-06
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 2e-06
d1nrjb_209 c.37.1.8 (B:) Signal recognition particle receptor 2e-06
d1nrjb_209 c.37.1.8 (B:) Signal recognition particle receptor 2e-04
d2bcjq2200 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha sub 2e-06
d2bcjq2200 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha sub 2e-06
d2g6ba1170 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T 3e-06
d2g6ba1170 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T 3e-06
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 4e-06
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 6e-06
d1f6ba_186 c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus gr 5e-06
d1f6ba_186 c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus gr 3e-05
d1svsa1195 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha sub 6e-06
d1svsa1195 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha sub 6e-06
d1fzqa_176 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 7e-06
d1fzqa_176 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 1e-04
d1ek0a_170 c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces 1e-05
d1ek0a_170 c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces 9e-04
d2f9la1175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 4e-05
d2f9la1175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 5e-05
d1upta_169 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 5e-05
d1upta_169 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 1e-04
d1r2qa_170 c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 8e-05
d1r2qa_170 c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 6e-04
d1z0fa1166 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [Ta 8e-05
d1z0fa1166 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [Ta 2e-04
d1yzqa1164 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [Ta 1e-04
d1yzqa1164 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [Ta 1e-04
d1z2aa1164 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [Ta 3e-04
d1z0ja1167 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [ 7e-04
d1z08a1167 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [T 0.001
d2ngra_191 c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 0.002
d2ngra_191 c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 0.002
d1z06a1165 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) 0.002
d1ky3a_175 c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y 0.002
d1lnza2185 c.37.1.8 (A:158-342) Obg GTP-binding protein middl 0.002
d1kmqa_177 c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9 0.002
d1kmqa_177 c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9 0.002
d1zd9a1164 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human 0.002
d1zd9a1164 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human 0.002
d1wmsa_174 c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 0.002
d1wmsa_174 c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 0.003
d1vg8a_184 c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId 0.002
d1vg8a_184 c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId 0.003
d2a5ja1173 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [Ta 0.003
d1tq4a_ 400 c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( 0.004
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab-related protein Sec4
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 55.2 bits (132), Expect = 1e-09
 Identities = 26/101 (25%), Positives = 43/101 (42%), Gaps = 4/101 (3%)

Query: 313 ILVLGLDNAGKSSIIKRIL-GEPIISLVPTVG--FNRARVEY-GNKYEVFLYDLGGSEDF 368
           IL++G    GKS ++ R +  +   S + T+G  F    V+  G K ++ ++D  G E F
Sbjct: 5   ILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQIWDTAGQERF 64

Query: 369 RTIWKQYLGTVSQTLLVSHSLSGRPDDRCQVYLMSCNCQVY 409
           RTI   Y       +LV      R     + +  + N    
Sbjct: 65  RTITTAYYRGAMGIILVYDITDERTFTNIKQWFKTVNEHAN 105


>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Length = 221 Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Length = 221 Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Length = 182 Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Length = 182 Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 186 Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 186 Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 195 Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 195 Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170 Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170 Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Length = 167 Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Length = 185 Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 184 Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 184 Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query537
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 99.94
d2awna2232 Maltose transport protein MalK, N-terminal domain 99.94
d1g2912240 Maltose transport protein MalK, N-terminal domain 99.94
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.94
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 99.94
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 99.94
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 99.94
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 99.93
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 99.92
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 99.92
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 99.92
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.91
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 99.9
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 99.89
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 99.89
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 99.89
d2hyda1255 Putative multidrug export ATP-binding/permease pro 99.87
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 99.82
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 99.82
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.76
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.09
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.06
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.0
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 98.93
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 98.93
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 98.91
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.87
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 98.87
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 98.87
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 98.86
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 98.86
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 98.83
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 98.82
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 98.81
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 98.79
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 98.78
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 98.77
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 98.77
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 98.77
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 98.77
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 98.77
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 98.76
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 98.76
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 98.75
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 98.74
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 98.74
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 98.74
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 98.73
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 98.72
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 98.72
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 98.72
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 98.72
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 98.71
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 98.71
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 98.71
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 98.7
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 98.67
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 98.67
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 98.66
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 98.66
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 98.66
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 98.66
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 98.61
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 98.61
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 98.6
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 98.6
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 98.6
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 98.6
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 98.59
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 98.59
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 98.56
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.56
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 98.55
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 98.53
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 98.49
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 98.49
d2fh5b1207 Signal recognition particle receptor beta-subunit 98.48
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.47
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 98.37
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.33
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 98.33
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 98.32
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 98.31
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 98.26
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 98.26
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 98.21
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 98.21
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 98.12
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 98.11
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 98.1
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 98.09
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 98.08
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 98.07
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 98.03
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 98.02
d1nrjb_209 Signal recognition particle receptor beta-subunit 98.02
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 98.02
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 98.01
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 98.01
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 97.98
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 97.97
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 97.97
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 97.97
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 97.96
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 97.95
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 97.95
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 97.94
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 97.93
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 97.93
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 97.92
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 97.9
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 97.88
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 97.88
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 97.87
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 97.87
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 97.86
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 97.85
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 97.85
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 97.85
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 97.85
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 97.83
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 97.82
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 97.81
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 97.79
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 97.78
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 97.78
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 97.76
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 97.75
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 97.73
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 97.71
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 97.7
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 97.7
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 97.66
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 97.62
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 97.6
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 97.59
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 97.57
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 97.54
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 97.51
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 97.48
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 97.46
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 97.43
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 97.42
d2fh5b1207 Signal recognition particle receptor beta-subunit 97.37
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 97.34
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.32
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 97.3
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 97.29
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 97.29
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.26
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 97.14
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 97.11
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 97.11
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 97.09
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 97.05
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 97.05
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 97.04
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 97.02
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 96.98
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 96.77
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 96.77
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 96.74
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.74
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.72
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 96.62
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.57
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.57
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 96.56
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.56
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.48
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.37
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.32
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 96.32
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 96.27
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.23
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.22
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.2
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.14
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.12
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.08
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.04
d1vmaa2213 GTPase domain of the signal recognition particle r 96.03
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.02
d1nrjb_209 Signal recognition particle receptor beta-subunit 96.01
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 96.0
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.97
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.95
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 95.94
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 95.93
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 95.91
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 95.9
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 95.79
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.78
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 95.67
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.67
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 95.64
d1okkd2207 GTPase domain of the signal recognition particle r 95.62
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.61
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 95.61
d2qy9a2211 GTPase domain of the signal recognition particle r 95.61
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.6
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 95.6
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 95.56
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.52
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.5
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 95.46
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.43
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 95.43
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.36
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.32
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.31
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.29
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.24
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.23
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 95.23
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.22
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.2
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 95.17
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.16
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 95.15
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.14
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.09
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 95.02
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 94.93
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 94.9
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 94.85
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 94.77
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 94.56
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 94.53
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.46
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 94.46
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 94.3
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 94.13
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 94.05
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 94.0
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 93.87
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 93.83
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 93.77
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 93.64
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 93.63
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 93.55
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 93.51
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 93.5
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 93.5
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 93.47
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 93.39
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 93.35
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 93.19
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 93.06
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 92.9
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 92.89
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 92.84
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 92.74
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 92.68
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 92.59
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 92.41
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 92.36
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 92.25
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 92.22
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 92.16
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 92.1
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 92.09
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 92.09
d1xpua3289 Transcription termination factor Rho, ATPase domai 91.86
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 91.86
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 91.79
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 91.69
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 91.64
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 91.59
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 91.55
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 91.34
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 91.03
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 91.0
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 90.99
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 90.98
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 90.92
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 90.56
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 90.48
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 90.46
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 90.36
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 90.34
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 90.25
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 90.18
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 90.16
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 90.01
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 89.78
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 89.63
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 89.59
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 89.5
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 88.77
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 88.71
d1svma_362 Papillomavirus large T antigen helicase domain {Si 88.4
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 88.04
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 87.73
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 87.62
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 87.3
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 87.24
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 87.04
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 86.98
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 86.55
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 86.37
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 86.25
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 86.21
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 86.11
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 85.94
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 85.93
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 85.35
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 84.62
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 82.76
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 82.11
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 81.42
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 81.23
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 80.68
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 80.26
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 80.03
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Hypothetical protein PH0022, N-terminal domain
species: Pyrococcus horikoshii [TaxId: 53953]
Probab=99.94  E-value=2.2e-29  Score=244.81  Aligned_cols=210  Identities=16%  Similarity=0.132  Sum_probs=148.3

Q ss_pred             hhhcccccCCCcccCCCCCCCCCcchhhcccccccccccccccCCCCCeEEEEeCCCCcHHHHHHHHhCCCCccccCcee
Q psy16304        150 GILMGIQNVPNFQTSSVLSDDPAPTFENFLDLRVLLPTHLSLFDFRSVPILVLGLDNAGKSSIIKRILGEPIISLVPTVG  229 (537)
Q Consensus       150 ~~li~~~~l~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~G~~vgLVG~NGAGKSTLL~~L~G~~~~~~~Pt~G  229 (537)
                      ...+.++++++.||+..                  +...++|.+.+|++++|+||||||||||+++|+|.    +.|++|
T Consensus         4 M~~I~v~nlsk~yg~~~------------------al~~vsl~v~~Ge~~~liGpsGaGKSTLl~~i~Gl----~~p~sG   61 (239)
T d1v43a3           4 MVEVKLENLTKRFGNFT------------------AVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGL----EEPTEG   61 (239)
T ss_dssp             CCCEEEEEEEEEETTEE------------------EEEEEEEEECTTCEEEEECCTTSSHHHHHHHHHTS----SCCSEE
T ss_pred             cCeEEEEEEEEEECCEE------------------EEcceeEEECCCCEEEEECCCCChHHHHHHHHHcC----CCCCCC
Confidence            34578899999887432                  23446788899999999999999999999999999    999999


Q ss_pred             eeeEEEEECCcEEEEEeecCCCchhhHHHHhhhhccccCCCCCCCccceeeEEeecCcccccCCcccccccCcCC---cc
Q psy16304        230 FNRARVEYGNKYEVFLYDLGGSEDFRTIWKQYLGTVSQTPLGRPDSRTCQVYLIMCGVHQVSGIPDELTSATHLP---LV  306 (537)
Q Consensus       230 ~t~~~i~i~g~~~i~~~D~~G~~~~r~~~~~~i~~v~Q~~~l~~~~~~~il~v~Ds~~~~~~~l~~~l~~~~~l~---~~  306 (537)
                          +|.++| .++     ......+    +.+|+|||++.+++.++.            .+++.... ...++.   ..
T Consensus        62 ----~I~i~g-~~i-----~~~~~~~----r~ig~v~Q~~~l~~~ltv------------~enl~~~~-~~~~~~~~~~~  114 (239)
T d1v43a3          62 ----RIYFGD-RDV-----TYLPPKD----RNISMVFQSYAVWPHMTV------------YENIAFPL-KIKKFPKDEID  114 (239)
T ss_dssp             ----EEEETT-EEC-----TTSCGGG----GTEEEEEC------CCCH------------HHHHHTTC-C--CCCHHHHH
T ss_pred             ----EEEEcc-eec-----ccCCccc----ceEEEEeechhhcccchH------------HHHHHHHH-HHcCCCHHHHH
Confidence                999997 443     2222222    569999999988776554            11111111 011111   11


Q ss_pred             ccCCccEEEeccCccCccchhhhhcCCCceeeecccccccceeccCCceEEEEEe--cCchh--hHHHHH---HHHHhcC
Q psy16304        307 DFRSVPILVLGLDNAGKSSIIKRILGEPIISLVPTVGFNRARVEYGNKYEVFLYD--LGGSE--DFRTIW---KQYLGTV  379 (537)
Q Consensus       307 ~~~~~~L~llGl~~~gKs~li~~LSgG~rqrvs~ti~la~all~~~e~p~lllLD--T~Gl~--~~~~l~---~~~~~~~  379 (537)
                      .+....+..+|+.+.. ...+.+|||||+||+    ++|++++. +  |+++++|  |+|++  ....+|   .++.++.
T Consensus       115 ~~~~~~l~~~~l~~~~-~~~~~~LSGGq~QRv----aiAraL~~-~--P~iLllDEPts~LD~~~~~~i~~ll~~l~~~~  186 (239)
T d1v43a3         115 KRVRWAAELLQIEELL-NRYPAQLSGGQRQRV----AVARAIVV-E--PDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKL  186 (239)
T ss_dssp             HHHHHHHHHTTCGGGT-TSCTTTCCSSCHHHH----HHHHHHTT-C--CSEEEEESTTTTSCHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHcCChhhh-cCChhhCCHHHHHHH----HHHhhhcc-C--CCceeecCCcccCCHHHHHHHHHHHHHHHHhc
Confidence            2233455678888776 455999999999999    99999996 5  8999999  99993  333344   4554555


Q ss_pred             CEEEEEEeCCCcchhhhhh--hhhhcCCcEEEEecccchh
Q psy16304        380 SQTLLVSHSLSGRPDDRCQ--VYLMSCNCQVYLISAKNLS  417 (537)
Q Consensus       380 ~~vIlVvdshd~~~~~~~~--i~ll~~G~ii~~g~nkdl~  417 (537)
                      +.+++++ +||+.+....+  +++|++|+++..|+++++.
T Consensus       187 g~tii~v-THd~~~a~~~~dri~vm~~G~iv~~G~~~el~  225 (239)
T d1v43a3         187 KVTTIYV-THDQVEAMTMGDRIAVMNRGQLLQIGSPTEVY  225 (239)
T ss_dssp             TCEEEEE-ESCHHHHHHHCSEEEEEETTEEEEEECHHHHH
T ss_pred             CCeEEEE-eCCHHHHHHhCCEEEEEECCEEEEEcCHHHHH
Confidence            6677777 89999887654  9999999999999999884



>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure