Psyllid ID: psy16355

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MSEGISKGGFIHNFQTKRKLGLLNIKLSVEFFKFVSEQCNNYKGNFILWLGPYPKVYFQTPDCTQAILSSTEHIDKSTEYALLDVWLGTGLITSTGQKWHHRRKLLTPAFHYNILETMLEPMQDTTDILVDRLSQELDNSGFDVFPIMKLTTLDIVCETTMGYDLGALKNQNSAYTQAVGIVAEISMKRFMLPWLHYDAIFKRTEMGKTYYRELEVMKKFTLSYSELY
cccccccccccccccccccccccccccHHHHHHHHHHHHHHccccEEEccccccEEEEccHHHHHHHHcccccccccccccccHHHHccccccccccHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEcccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcc
ccccccccccccccEEccHHHccccccHHHHHHHHHHHHHHccccEEEEEccccEEEEEcHHHHHHHHcccHccccccHHHHHcHHcccccEEcccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHccHcccHHHHHcccccHHHHHHHHHHHHHHHHHHHHc
msegiskggfihnfQTKRKLGLLNIKLSVEFFKFVSEQCnnykgnfilwlgpypkvyfqtpdctQAILSSTEHIDKSTEYALLDVWLGTglitstgqkwhhrrklltpAFHYNILETmlepmqdtTDILVDRLSQeldnsgfdvfpimklTTLDIVCETtmgydlgalknqnsAYTQAVGIVAEISMKRfmlpwlhydAIFKRTEMGKTYYRELEVMKKFTLSYSELY
msegiskggfihnfqtkrkLGLLNIKLSVEFFKFVSEQCNNYKGNFILWLGPYPKVYFQTPDCTQAILSSTEHIDKSTEYALLDVWLGTGLITSTGQKWHHRRKLLTPAFHYNILETMLEPMQDTTDILVDRLSQELDNSGFDVFPIMKLTTLDIVCETTMGYDLGALKNQNSAYTQAVGIVAEISMKRFMLPWLHYDAIFKRTEMGKTYYRELEvmkkftlsysely
MSEGISKGGFIHNFQTKRKLGLLNIKLSVEFFKFVSEQCNNYKGNFILWLGPYPKVYFQTPDCTQAILSSTEHIDKSTEYALLDVWLGTGLITSTGQKWHHRRKLLTPAFHYNILETMLEPMQDTTDILVDRLSQELDNSGFDVFPIMKLTTLDIVCETTMGYDLGALKNQNSAYTQAVGIVAEISMKRFMLPWLHYDAIFKRTEMGKTYYRELEVMKKFTLSYSELY
********GFIHNFQTKRKLGLLNIKLSVEFFKFVSEQCNNYKGNFILWLGPYPKVYFQTPDCTQAILSSTEHIDKSTEYALLDVWLGTGLITSTGQKWHHRRKLLTPAFHYNILETMLEPMQDTTDILVDRLSQELDNSGFDVFPIMKLTTLDIVCETTMGYDLGALKNQNSAYTQAVGIVAEISMKRFMLPWLHYDAIFKRTEMGKTYYRELEVMKKFTLS*****
*****SKGGFIHNFQTKRKLGLLNIKLSVEFFKFVSEQCNNYKGNFILWLGPYPKVYFQTPDCTQAILSSTEHIDKSTEYALLDVWLGTGLITSTGQKWHHRRKLLTPAFHYNILETMLEPMQDTTDILVDRLSQELDNSGFDVFPIMKLTTLDIVCETTMGYDL*A***QNSAYTQAVGIVAEISMKRFMLPWLHYDAIFKRTEMGKTYYRELEVMKKFTLSYSELY
MSEGISKGGFIHNFQTKRKLGLLNIKLSVEFFKFVSEQCNNYKGNFILWLGPYPKVYFQTPDCTQAILSSTEHIDKSTEYALLDVWLGTGLITSTGQKWHHRRKLLTPAFHYNILETMLEPMQDTTDILVDRLSQELDNSGFDVFPIMKLTTLDIVCETTMGYDLGALKNQNSAYTQAVGIVAEISMKRFMLPWLHYDAIFKRTEMGKTYYRELEVMKKFTLSYSELY
*******GGFIHNFQTKRKLGLLNIKLSVEFFKFVSEQCNNYKGNFILWLGPYPKVYFQTPDCTQAILSSTEHIDKSTEYALLDVWLGTGLITSTGQKWHHRRKLLTPAFHYNILETMLEPMQDTTDILVDRLSQELDNSGFDVFPIMKLTTLDIVCETTMGYDLGALKNQNSAYTQAVGIVAEISMKRFMLPWLHYDAIFKRTEMGKTYYRELEVMKKFTLSYSELY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEGISKGGFIHNFQTKRKLGLLNIKLSVEFFKFVSEQCNNYKGNFILWLGPYPKVYFQTPDCTQAILSSTEHIDKSTEYALLDVWLGTGLITSTGQKWHHRRKLLTPAFHYNILETMLEPMQDTTDILVDRLSQELDNSGFDVFPIMKLTTLDIVCETTMGYDLGALKNQNSAYTQAVGIVAEISMKRFMLPWLHYDAIFKRTEMGKTYYRELEVMKKFTLSYSELY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query228 2.2.26 [Sep-21-2011]
P29981 511 Cytochrome P450 4C1 OS=Bl N/A N/A 0.842 0.375 0.375 7e-38
Q6ZWL3 525 Cytochrome P450 4V2 OS=Ho yes N/A 0.850 0.369 0.392 3e-37
Q5RCN6 525 Cytochrome P450 4V2 OS=Po yes N/A 0.881 0.382 0.379 4e-36
Q9DBW0 525 Cytochrome P450 4V2 OS=Mu yes N/A 0.763 0.331 0.402 2e-35
A2RRT9 525 Cytochrome P450 4V2 OS=Ra yes N/A 0.850 0.369 0.367 2e-34
Q27589 501 Cytochrome P450 4d2 OS=Dr yes N/A 0.842 0.383 0.379 1e-32
Q9VA27 535 Cytochrome P450 4c3 OS=Dr no N/A 0.763 0.325 0.385 5e-31
Q9VXY0 495 Probable cytochrome P450 no N/A 0.824 0.379 0.361 9e-31
O18596 513 Cytochrome P450 4d10 OS=D N/A N/A 0.820 0.364 0.351 4e-27
P33269 512 Cytochrome P450 4d1 OS=Dr no N/A 0.842 0.375 0.329 6e-27
>sp|P29981|CP4C1_BLADI Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 Back     alignment and function desciption
 Score =  157 bits (396), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 72/192 (37%), Positives = 111/192 (57%)

Query: 30  EFFKFVSEQCNNYKGNFILWLGPYPKVYFQTPDCTQAILSSTEHIDKSTEYALLDVWLGT 89
           + F+    +   Y   + +W GP  +V    P+  + IL  T+HIDKS  Y+ +  WLG 
Sbjct: 58  KLFQVFDRRAKLYGPLYRIWAGPIAQVGLTRPEHVELILRDTKHIDKSLVYSFIRPWLGE 117

Query: 90  GLITSTGQKWHHRRKLLTPAFHYNILETMLEPMQDTTDILVDRLSQELDNSGFDVFPIMK 149
           GL+T TG KWH  RK++TP FH+ IL+  ++   + ++ILV +L  ++    FD++P + 
Sbjct: 118 GLLTGTGAKWHSHRKMITPTFHFKILDIFVDVFVEKSEILVKKLQSKVGGKDFDIYPFIT 177

Query: 150 LTTLDIVCETTMGYDLGALKNQNSAYTQAVGIVAEISMKRFMLPWLHYDAIFKRTEMGKT 209
              LDI+CET MG  + A +   S Y +AV  ++E++M+R + PWLH   IF  T MGK 
Sbjct: 178 HCALDIICETAMGIQMNAQEESESEYVKAVYEISELTMQRSVRPWLHPKVIFDLTTMGKR 237

Query: 210 YYRELEVMKKFT 221
           Y   L ++  FT
Sbjct: 238 YAECLRILHGFT 249
Involved in the metabolism of insect hormones and in the breakdown of synthetic insecticides.
Blaberus discoidalis (taxid: 6981)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 4EC: .EC: 1
>sp|Q6ZWL3|CP4V2_HUMAN Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 Back     alignment and function description
>sp|Q5RCN6|CP4V2_PONAB Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 Back     alignment and function description
>sp|Q9DBW0|CP4V2_MOUSE Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 Back     alignment and function description
>sp|A2RRT9|CP4V2_RAT Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 Back     alignment and function description
>sp|Q27589|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 Back     alignment and function description
>sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 Back     alignment and function description
>sp|Q9VXY0|CP4S3_DROME Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 Back     alignment and function description
>sp|O18596|C4D10_DROMT Cytochrome P450 4d10 OS=Drosophila mettleri GN=Cyp4d10 PE=1 SV=1 Back     alignment and function description
>sp|P33269|CP4D1_DROME Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query228
3249041 497 corpora allata cytochrome P450 [Diplopte 0.842 0.386 0.463 3e-42
339896243 433 cytochrome P450 [Bemisia tabaci] 0.714 0.376 0.460 8e-40
332030595 479 Cytochrome P450 4c3 [Acromyrmex echinati 0.833 0.396 0.413 5e-39
340727274 434 PREDICTED: cytochrome P450 4c3-like isof 0.767 0.403 0.451 6e-39
340727270 509 PREDICTED: cytochrome P450 4c3-like isof 0.767 0.343 0.451 6e-39
392612327 515 cytochrome P450 [Exopalaemon carinicauda 0.771 0.341 0.455 3e-38
408724277 398 cytochrome P450 CYP4C71v2, partial [Laod 0.842 0.482 0.395 6e-38
408724293 385 cytochrome P450 CYP4C71v2, partial [Laod 0.842 0.498 0.395 7e-38
60729680 515 cytochrome P450 enzyme, CYP4C39 enzyme - 0.947 0.419 0.387 1e-37
383847823 511 PREDICTED: cytochrome P450 4c3-like [Meg 0.767 0.342 0.434 2e-37
>gi|3249041|gb|AAC69184.1| corpora allata cytochrome P450 [Diploptera punctata] Back     alignment and taxonomy information
 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 120/192 (62%)

Query: 30  EFFKFVSEQCNNYKGNFILWLGPYPKVYFQTPDCTQAILSSTEHIDKSTEYALLDVWLGT 89
           EFF+ +S+    Y   F LW+G  P V+  + +  Q IL+ST +IDKS EY+ L  WLGT
Sbjct: 49  EFFRLLSKCATKYGNIFRLWVGQRPFVFLYSAEAIQPILNSTVYIDKSYEYSFLFPWLGT 108

Query: 90  GLITSTGQKWHHRRKLLTPAFHYNILETMLEPMQDTTDILVDRLSQELDNSGFDVFPIMK 149
           GL+TSTG KWH RRKLLT +FH  +LE  LEP+   +  L +RL  ELD   F V P  K
Sbjct: 109 GLLTSTGNKWHTRRKLLTQSFHSKVLEDFLEPIYQHSLFLCNRLELELDKPHFKVTPYAK 168

Query: 150 LTTLDIVCETTMGYDLGALKNQNSAYTQAVGIVAEISMKRFMLPWLHYDAIFKRTEMGKT 209
           L  LDI+C+T MG  + A +N  S Y  AV  ++EI  +RF+ PWL  D +FK T++GK 
Sbjct: 169 LCALDIICDTAMGSTINAQENSQSEYVTAVDSLSEIVQRRFITPWLKPDFLFKMTKLGKK 228

Query: 210 YYRELEVMKKFT 221
             + L+++  FT
Sbjct: 229 QEQCLKIVHNFT 240

Source: Diploptera punctata

Species: Diploptera punctata

Genus: Diploptera

Family: Blaberidae

Order: Blattodea

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|339896243|gb|AEK21807.1| cytochrome P450 [Bemisia tabaci] Back     alignment and taxonomy information
>gi|332030595|gb|EGI70283.1| Cytochrome P450 4c3 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340727274|ref|XP_003401972.1| PREDICTED: cytochrome P450 4c3-like isoform 3 [Bombus terrestris] Back     alignment and taxonomy information
>gi|340727270|ref|XP_003401970.1| PREDICTED: cytochrome P450 4c3-like isoform 1 [Bombus terrestris] gi|340727272|ref|XP_003401971.1| PREDICTED: cytochrome P450 4c3-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|392612327|gb|AFM82473.1| cytochrome P450 [Exopalaemon carinicauda] Back     alignment and taxonomy information
>gi|408724277|gb|AFU86456.1| cytochrome P450 CYP4C71v2, partial [Laodelphax striatella] Back     alignment and taxonomy information
>gi|408724293|gb|AFU86464.1| cytochrome P450 CYP4C71v2, partial [Laodelphax striatella] Back     alignment and taxonomy information
>gi|60729680|pir||JC8026 cytochrome P450 enzyme, CYP4C39 enzyme - green crab, common shore crab gi|37538493|gb|AAQ93010.1| cytochrome P450 CYP4C39 [Carcinus maenas] Back     alignment and taxonomy information
>gi|383847823|ref|XP_003699552.1| PREDICTED: cytochrome P450 4c3-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query228
UNIPROTKB|E1BYW5 530 CYP4V2 "Uncharacterized protei 0.837 0.360 0.409 8.9e-38
UNIPROTKB|F1N3Z7 527 CYP4V2 "Uncharacterized protei 0.837 0.362 0.410 8.9e-38
UNIPROTKB|F1PNR5 523 CYP4V2 "Uncharacterized protei 0.837 0.365 0.405 1.7e-36
UNIPROTKB|Q6ZWL3 525 CYP4V2 "Cytochrome P450 4V2" [ 0.850 0.369 0.392 2.1e-36
ZFIN|ZDB-GENE-061103-88 510 cyp4v7 "cytochrome P450, famil 0.842 0.376 0.391 3.5e-36
UNIPROTKB|Q5RCN6 525 CYP4V2 "Cytochrome P450 4V2" [ 0.842 0.365 0.386 2.4e-35
MGI|MGI:2142763 525 Cyp4v3 "cytochrome P450, famil 0.763 0.331 0.402 4.6e-34
RGD|708530 525 Cyp4v3 "cytochrome P450, famil 0.850 0.369 0.367 9.5e-34
WB|WBGene00016147 529 cyp-32A1 [Caenorhabditis elega 0.793 0.342 0.370 1.6e-33
ZFIN|ZDB-GENE-061103-601 513 cyp4v8 "cytochrome P450, famil 0.881 0.391 0.344 1.1e-32
UNIPROTKB|E1BYW5 CYP4V2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 405 (147.6 bits), Expect = 8.9e-38, P = 8.9e-38
 Identities = 79/193 (40%), Positives = 119/193 (61%)

Query:    31 FFKFVSEQCNNYKGN--FILWLGPYPKVYFQTPDCTQAILSSTEHIDKSTEYALLDVWLG 88
             FFK + +  + ++    F LWLGP P      PD  + ILSS++HI KS  Y  L  WLG
Sbjct:    74 FFKQLQQYADEFRKMPMFKLWLGPLPVTVLFHPDSVEVILSSSKHIKKSFLYTFLHPWLG 133

Query:    89 TGLITSTGQKWHHRRKLLTPAFHYNILETMLEPMQDTTDILVDRLSQELDNSGFDVFPIM 148
             TGL+TSTG KW  RRK++TP FH+ IL   LE M +   IL+++L + +D   F++F  +
Sbjct:   134 TGLLTSTGDKWRSRRKMITPTFHFAILNDFLEVMNEQGGILLEKLEKHVDKEPFNIFTDI 193

Query:   149 KLTTLDIVCETTMGYDLGALKNQNSAYTQAVGIVAEISMKRFMLPWLHYDAIFKRTEMGK 208
              L  LDI+CET MG +LGA  N++S Y +AV  ++++  +R   PWL +D ++   + G+
Sbjct:   194 TLCALDIICETAMGKNLGAQDNKDSEYVRAVYRMSDLIQQRQKSPWLWHDLMYLLFKEGR 253

Query:   209 TYYRELEVMKKFT 221
              + R L+++  FT
Sbjct:   254 EHERNLKILHGFT 266
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0020037 "heme binding" evidence=IEA
GO:0004497 "monooxygenase activity" evidence=IEA
GO:0010430 "fatty acid omega-oxidation" evidence=IEA
UNIPROTKB|F1N3Z7 CYP4V2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PNR5 CYP4V2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZWL3 CYP4V2 "Cytochrome P450 4V2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061103-88 cyp4v7 "cytochrome P450, family 4, subfamily V, polypeptide 7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RCN6 CYP4V2 "Cytochrome P450 4V2" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
MGI|MGI:2142763 Cyp4v3 "cytochrome P450, family 4, subfamily v, polypeptide 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|708530 Cyp4v3 "cytochrome P450, family 4, subfamily v, polypeptide 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
WB|WBGene00016147 cyp-32A1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061103-601 cyp4v8 "cytochrome P450, family 4, subfamily V, polypeptide 8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query228
pfam00067 461 pfam00067, p450, Cytochrome P450 7e-19
PLN02738 633 PLN02738, PLN02738, carotene beta-ring hydroxylase 4e-10
COG2124 411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 4e-08
PLN02290 516 PLN02290, PLN02290, cytokinin trans-hydroxylase 7e-07
PLN02936 489 PLN02936, PLN02936, epsilon-ring hydroxylase 2e-04
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information 
 Score = 84.3 bits (209), Expect = 7e-19
 Identities = 33/188 (17%), Positives = 69/188 (36%), Gaps = 10/188 (5%)

Query: 46  FILWLGPYPKVYFQTPD------CTQAILSSTEHIDKSTEYALLDVWLGTGLITSTGQKW 99
           F L+LGP P V    P+        +    S    +          +LG G++ + G +W
Sbjct: 37  FRLYLGPKPVVVLSGPEAVKEVLIKKGEEFSGRPDEPWFAT-SRGPFLGKGIVFANGPRW 95

Query: 100 HHRRKLLTPAFHYNILETMLEPMQDTTDILVDRLSQELD-NSGFDVFPIMKLTTLDIVCE 158
              R+ LTP F      +    +++    LV++L +        D+  ++    L+++C 
Sbjct: 96  RQLRRFLTPTFTSFGKLSFEPRVEEEARDLVEKLRKTAGEPGVIDITDLLFRAALNVICS 155

Query: 159 TTMGYDLGALKN-QNSAYTQAVGIVAEISMKRFMLPWLHY-DAIFKRTEMGKTYYRELEV 216
              G   G+L++ +     +AV  ++ +           +    +     G+   R  + 
Sbjct: 156 ILFGERFGSLEDPKFLELVKAVQELSSLLSSPSPQLLDLFPILKYFPGPHGRKLKRARKK 215

Query: 217 MKKFTLSY 224
           +K      
Sbjct: 216 IKDLLDKL 223

Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures. Length = 461
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 228
KOG0156|consensus 489 99.95
PLN02738 633 carotene beta-ring hydroxylase 99.94
KOG0157|consensus 497 99.94
PLN02936 489 epsilon-ring hydroxylase 99.93
PLN02290 516 cytokinin trans-hydroxylase 99.93
PLN02687 517 flavonoid 3'-monooxygenase 99.92
PTZ00404 482 cytochrome P450; Provisional 99.92
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.92
PLN03234 499 cytochrome P450 83B1; Provisional 99.92
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 99.91
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.91
PLN02183 516 ferulate 5-hydroxylase 99.91
KOG0159|consensus 519 99.91
PLN02196 463 abscisic acid 8'-hydroxylase 99.9
PLN02500 490 cytochrome P450 90B1 99.9
PLN02966 502 cytochrome P450 83A1 99.9
PLN02655 466 ent-kaurene oxidase 99.9
PLN02971 543 tryptophan N-hydroxylase 99.9
PLN00168 519 Cytochrome P450; Provisional 99.9
PLN03112 514 cytochrome P450 family protein; Provisional 99.89
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.89
PLN02394 503 trans-cinnamate 4-monooxygenase 99.88
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.88
KOG0158|consensus 499 99.88
PLN02774 463 brassinosteroid-6-oxidase 99.87
PLN02302 490 ent-kaurenoic acid oxidase 99.87
PLN02426 502 cytochrome P450, family 94, subfamily C protein 99.86
PLN03018 534 homomethionine N-hydroxylase 99.85
PLN02987 472 Cytochrome P450, family 90, subfamily A 99.83
PLN02648 480 allene oxide synthase 99.78
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.48
KOG0684|consensus 486 99.39
>KOG0156|consensus Back     alignment and domain information 
Probab=99.95  E-value=1.4e-26  Score=186.98  Aligned_cols=211  Identities=16%  Similarity=0.210  Sum_probs=159.0

Q ss_pred             hhhhcccccccCcHHHHHHHHHHHHHcCCeeEEeeCCcCeEEecChhHHHHHhhcC--CCCCchhhhhhhHhhh--cccc
Q psy16355         16 TKRKLGLLNIKLSVEFFKFVSEQCNNYKGNFILWLGPYPKVYFQTPDCTQAILSST--EHIDKSTEYALLDVWL--GTGL   91 (228)
Q Consensus        16 ~~~~~g~~~~~~~~~~~~~~~~~~~~yG~i~~~~~~~~~~vvv~~p~~~k~il~~~--~~~~k~~~~~~~~~~~--g~~l   91 (228)
                      +.+++||++++....++..+.+|+++|||++.+|+|+.|+|||+|+++++|+|+++  .+.+|+........+.  +.|+
T Consensus        33 ~lPiIGnl~~l~~~~~h~~~~~ls~~yGpi~tl~lG~~~~Vviss~~~akE~l~~~d~~fa~Rp~~~~~~~~~~~~~~~i  112 (489)
T KOG0156|consen   33 PLPIIGNLHQLGSLPPHRSFRKLSKKYGPVFTLRLGSVPVVVISSYEAAKEVLVKQDLEFADRPDPTATLKYLSYGGKGI  112 (489)
T ss_pred             CCCccccHHHcCCCchhHHHHHHHHHhCCeEEEEecCceEEEECCHHHHHHHHHhCCccccCCCCchhhHHHhcCCCCce
Confidence            78999999999886799999999999999999999999999999999999999876  4555554221222222  3688


Q ss_pred             ccc-CCchhhhhhhhhc-CcCCHHHHHHhHHHHHHHHHHHHHHHhhhhC-CCceehHHhHHHHHHHHHHHHhcCcccCCC
Q psy16355         92 ITS-TGQKWHHRRKLLT-PAFHYNILETMLEPMQDTTDILVDRLSQELD-NSGFDVFPIMKLTTLDIVCETTMGYDLGAL  168 (228)
Q Consensus        92 ~~~-~g~~w~~~Rk~l~-~~f~~~~l~~~~~~~~~~~~~~~~~l~~~~~-~~~~~~~~~~~~~~~~vi~~~~fG~~~~~~  168 (228)
                      +++ +|+.||.+||+.. ..|+.+.++.......++++.+++.+.+ .. ++++|+.+.+..++.+||++++||.++...
T Consensus       113 ~~a~yG~~Wr~~Rr~~~~~L~~~~~~~~~~~~R~~E~~~l~~~l~~-~~~~~~vdl~~~l~~~~~nvI~~~~fG~rf~~~  191 (489)
T KOG0156|consen  113 VFAPYGDYWREMRRFALTELRSFGRGKSFMEIREEEVDELVKKLSK-SKKGEPVDLSELLDLLVGNVICRMLFGRRFEEE  191 (489)
T ss_pred             EeCCCcHHHHHHHHHHHHHhcChhhhhhhHHHHHHHHHHHHHHHHh-cCCCceeeHHHHHHHHHHHHHHHHHhCCccccC
Confidence            888 5999999999864 5689999999988889999999999987 32 379999999999999999999999999876


Q ss_pred             CCCC-chHHHHHHHHHHHHHHH-hhcccc-chhHHhhcCchhHhHHHHHHHHHHHHHHHhhc
Q psy16355        169 KNQN-SAYTQAVGIVAEISMKR-FMLPWL-HYDAIFKRTEMGKTYYRELEVMKKFTLSYSEL  227 (228)
Q Consensus       169 ~~~~-~~~~~~~~~~~~~~~~~-~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~  227 (228)
                      +++. .++.+.+.+..+..+.. ....++ +..|+....+..++......++.++++++|++
T Consensus       192 ~~~~~~~~~~l~~~~~~~~~~~~~~d~~p~~l~~~~~~~g~~~~~~~~~~~~~~~~~~~i~e  253 (489)
T KOG0156|consen  192 DEEEFLELKELVEESLELLGSFNLSDYFPFLLRWLDGISGLEKRLKKVSKRLDEFLERIIDE  253 (489)
T ss_pred             CchHHHHHHHHHHHHHHHhCCccHHHHhhHHHHhcccccHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3222 33555666655554332 112222 22222212234555666666688888888875

>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>KOG0157|consensus Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>KOG0159|consensus Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>KOG0158|consensus Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG0684|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query228
2q9f_A 456 Crystal Structure Of Human Cytochrome P450 46a1 In 4e-05
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure 
Iteration: 1

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 64/136 (47%), Gaps = 7/136 (5%)
Query: 56  VYFQTPDCTQAILSSTEHIDKSTEYALL-----DVWLGTGLITSTG-QKWHHRRKLLTPA 109
           V   +P+  +  L ST++   S  Y  L     +   G GL++    ++WH +R+++  A
Sbjct: 37  VIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVSECNYERWHKQRRVIDLA 96
Query: 110 FHYNILETMLEPMQDTTDILVDRLSQELD-NSGFDVFPIMKLTTLDIVCETTMGYDLGAL 168
           F  + L +++E   +  + LV+ L  + D  +   +  ++  T +DI+ +   G +   L
Sbjct: 97  FSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYTAMDILAKAAFGMETSML 156
Query: 169 KNQNSAYTQAVGIVAE 184
                  +QAV ++ E
Sbjct: 157 LGAQKPLSQAVKLMLE 172

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query228
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 5e-57
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 3e-47
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 1e-44
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 2e-41
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 1e-35
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 9e-35
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 7e-29
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 2e-27
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 4e-26
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 2e-25
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 1e-20
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 1e-18
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 8e-17
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 4e-14
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 1e-13
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 6e-13
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 6e-08
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 1e-06
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 9e-04
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
 Score =  186 bits (474), Expect = 5e-57
 Identities = 32/198 (16%), Positives = 75/198 (37%), Gaps = 10/198 (5%)

Query: 31  FFKFVSEQCNNYKGNFILWLGPYPKVYFQTPDCTQAILSSTEHIDKSTEYALL-----DV 85
                 +    Y     + +     V   +P+  +  L ST++   S  Y  L     + 
Sbjct: 12  LQDVFLDWAKKYGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGER 71

Query: 86  WLGTGLITST-GQKWHHRRKLLTPAFHYNILETMLEPMQDTTDILVDRLSQELDNSG-FD 143
             G GL++    ++WH +R+++  AF  + L +++E   +  + LV+ L  + D      
Sbjct: 72  LFGQGLVSECNYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVS 131

Query: 144 VFPIMKLTTLDIVCETTMGYDLGALKNQNSAYTQAVGIVAEISMKRFMLPWLHYDAIFKR 203
           +  ++  T +DI+ +   G +   L       +QAV ++ E               +  +
Sbjct: 132 MQDMLTYTAMDILAKAAFGMETSMLLGAQKPLSQAVKLMLEGITASRNTLA---KFLPGK 188

Query: 204 TEMGKTYYRELEVMKKFT 221
            +  +     +  +++  
Sbjct: 189 RKQLREVRESIRFLRQVG 206
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query228
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.94
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.94
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.94
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.93
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.93
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.93
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.93
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.93
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.93
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.92
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.92
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.92
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.92
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.92
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 99.92
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.92
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.91
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.91
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.9
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.9
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.89
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.89
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.89
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.86
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.85
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.85
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.83
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 99.83
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.83
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.82
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 99.81
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.81
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.81
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.81
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.8
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 99.8
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 99.8
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.79
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.79
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.79
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.79
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.78
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.78
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.78
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 99.78
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.78
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.78
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.78
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.78
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.77
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.77
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.76
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.76
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.76
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.76
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.75
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 99.75
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.74
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.74
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.73
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.72
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 99.7
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 99.69
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.69
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.68
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.68
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 99.68
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.67
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.66
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.66
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.65
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.64
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 99.63
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 99.59
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.32
4dxy_A 417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.23
2yjn_B 381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 98.23
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 90.24
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 83.79
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 82.71
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 82.67
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 82.51
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 82.35
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
Probab=99.94  E-value=2.3e-26  Score=187.33  Aligned_cols=208  Identities=14%  Similarity=0.164  Sum_probs=151.2

Q ss_pred             hhhccccccc----CcHHHHHHHHHHHHHcCCeeEEeeCCcCeEEecChhHHHHHhhcCCCCCchhhh---hhhHhh--h
Q psy16355         17 KRKLGLLNIK----LSVEFFKFVSEQCNNYKGNFILWLGPYPKVYFQTPDCTQAILSSTEHIDKSTEY---ALLDVW--L   87 (228)
Q Consensus        17 ~~~~g~~~~~----~~~~~~~~~~~~~~~yG~i~~~~~~~~~~vvv~~p~~~k~il~~~~~~~k~~~~---~~~~~~--~   87 (228)
                      .+++||+..+    ..++++..+.+|+++||||+++++|+.++|+++||+++++|+.++..+.+++..   ......  .
T Consensus        32 ~p~iG~~~~~~~~~~~~~~~~~~~~l~~~YG~i~~~~~g~~~~vvv~dp~~~~~il~~~~~~~~r~~~~~~~~~~~~~~~  111 (482)
T 3k9v_A           32 WPLLGSLLEIFWKGGLKKQHDTLAEYHKKYGQIFRMKLGSFDSVHLGSPSLLEALYRTESAHPQRLEIKPWKAYRDHRNE  111 (482)
T ss_dssp             CTTTBTHHHHHHTTCGGGHHHHHHHHHHHHCSEEEEEETTEEEEEECSHHHHHHHHHTCCSSCCCCCCHHHHHHHHHHTC
T ss_pred             CCccccHHHHhccCCcccHHHHHHHHHHHcCCEEEEccCCCCEEEEcCHHHHHHHHHhcCCCCCCCCchHHHHHHHhcCC
Confidence            5778888765    245789999999999999999999999999999999999999876445444321   112222  3


Q ss_pred             cccccccCCchhhhhhhhhcCcC-CHHHHHHhHHHHHHHHHHHHHHHhhhhC--CCceehHHhHHHHHHHHHHHHhcCcc
Q psy16355         88 GTGLITSTGQKWHHRRKLLTPAF-HYNILETMLEPMQDTTDILVDRLSQELD--NSGFDVFPIMKLTTLDIVCETTMGYD  164 (228)
Q Consensus        88 g~~l~~~~g~~w~~~Rk~l~~~f-~~~~l~~~~~~~~~~~~~~~~~l~~~~~--~~~~~~~~~~~~~~~~vi~~~~fG~~  164 (228)
                      +.|+++++|+.|+++||+++++| +++.++.+.+.+.++++.+++.+.+.+.  |+++|+.+.+..+++|+|+.++||.+
T Consensus       112 ~~~l~~~~g~~w~~~Rr~~~~~f~~~~~~~~~~~~i~~~~~~l~~~l~~~~~~~g~~vd~~~~~~~~t~dvi~~~~fG~~  191 (482)
T 3k9v_A          112 AYGLMILEGQEWQRVRSAFQKKLMKPVEIMKLDKKINEVLADFLERMDELCDERGRIPDLYSELNKWSFESICLVLYEKR  191 (482)
T ss_dssp             CCCTTTCCHHHHHHHHHHHHHHHTCHHHHGGGHHHHHHHHHHHHHHHHHHCCTTSCCTTHHHHHHHHHHHHHHHHHHSCC
T ss_pred             CCCceeCCCchHHHHHHHhhHHhcChHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCHHHHHHHHHHHHHHHHHcccc
Confidence            57899999999999999999986 8889999999999999999999987642  66899999999999999999999999


Q ss_pred             cCCCCCC----CchHHHHHHHHHHHHHHHhhccccchhHHhhcCchhHhHHHHHHHHHHHHHHHhh
Q psy16355        165 LGALKNQ----NSAYTQAVGIVAEISMKRFMLPWLHYDAIFKRTEMGKTYYRELEVMKKFTLSYSE  226 (228)
Q Consensus       165 ~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~  226 (228)
                      ++..++.    ..++.+.+..++.........|..+..++  +.+..++..++.+.+.++++++|+
T Consensus       192 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~l--~~~~~~~~~~~~~~~~~~~~~~i~  255 (482)
T 3k9v_A          192 FGLLQKETEEEALTFITAIKTMMSTFGKMMVTPVELHKRL--NTKVWQAHTLAWDTIFKSVKPCID  255 (482)
T ss_dssp             CCSSSTTSTTSSHHHHHHHHHHHTTGGGGSSSCHHHHHHH--TCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             cCCCCCCcchHHHHHHHHHHHHHHHHHHHHhhhHHHHHhc--CCHHHHHHHHHHHHHHHHHHHHHH
Confidence            9765432    23455555444432221111121122222  334445555666666666655554
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 228
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 7e-14
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 8e-14
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 2e-11
d1izoa_ 411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 5e-11
d1n97a_ 385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 6e-11
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 1e-10
d1ueda_ 403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 3e-06
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 67.8 bits (164), Expect = 7e-14
 Identities = 29/192 (15%), Positives = 65/192 (33%), Gaps = 2/192 (1%)

Query: 31  FFKFVSEQCNNYKGNFILWLGPYPKVYFQTPDCTQAILSSTEHIDKSTEYALLDV-WLGT 89
           F  F  E    Y   +  + G  P +    PD  + +L    +   +       V ++ +
Sbjct: 30  FCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKS 89

Query: 90  GLITSTGQKWHHRRKLLTPAFHYNILETMLEPMQDTTDILVDRLSQELDNSG-FDVFPIM 148
            +  +  ++W   R LL+P F    L+ M+  +    D+LV  L +E +      +  + 
Sbjct: 90  AISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVF 149

Query: 149 KLTTLDIVCETTMGYDLGALKNQNSAYTQAVGIVAEISMKRFMLPWLHYDAIFKRTEMGK 208
              ++D++  T+ G ++ +L N    + +    +            +             
Sbjct: 150 GAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVL 209

Query: 209 TYYRELEVMKKF 220
                   +  F
Sbjct: 210 NICVFPREVTNF 221
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query228
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.96
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.93
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.93
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.91
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.87
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.85
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.84
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.83
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.76
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.69
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.69
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.69
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.64
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.55
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.49
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.48
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.46
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.3
d1io7a_ 366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.22
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.08
d1ue8a_ 367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 98.84
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 88.29
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 83.67
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 82.51
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 81.6
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 80.22
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome P450 bm-3
species: Bacillus megaterium [TaxId: 1404]

Probab=99.96  E-value=4.2e-29  Score=200.19  Aligned_cols=208  Identities=14%  Similarity=0.162  Sum_probs=159.9

Q ss_pred             hhhhcccccccCcHHHHHHHHHHHHHcCCeeEEeeCCcCeEEecChhHHHHHhhcCC-CCCchhhhhhhHhhhccccccc
Q psy16355         16 TKRKLGLLNIKLSVEFFKFVSEQCNNYKGNFILWLGPYPKVYFQTPDCTQAILSSTE-HIDKSTEYALLDVWLGTGLITS   94 (228)
Q Consensus        16 ~~~~~g~~~~~~~~~~~~~~~~~~~~yG~i~~~~~~~~~~vvv~~p~~~k~il~~~~-~~~k~~~~~~~~~~~g~~l~~~   94 (228)
                      +.+++||++.++.++++..+.+|+++|||||++++++.++|+|+||+++++++.++. .+.....+..+.++.|+|++++
T Consensus         8 ~~p~lG~l~~l~~~~~~~~~~~~~~kyG~if~~~~~~~~~vvl~~~~~i~~v~~~~~~~~~~~~~~~~~~~~~g~~~~~~   87 (453)
T d2ij2a1           8 TFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKFVRDFAGDGLFTS   87 (453)
T ss_dssp             CCGGGTTGGGGCSSCHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHHHTCTTTEEECCCHHHHHHHHHHTTSGGGS
T ss_pred             CcchhhCHHHhCCCCHHHHHHHHHHHhCCEEEEEeCCceEEEECCHHHHHHHHhcCCcccccccHhHHHHHhcCCcEEec
Confidence            578899999988888999999999999999999999999999999999999997663 3344445566677788888764


Q ss_pred             --CCchhhhhhhhhcCcCCHHHHHHhHHHHHHHHHHHHHHHhhhhCCCceehHHhHHHHHHHHHHHHhcCcccCCCCCC-
Q psy16355         95 --TGQKWHHRRKLLTPAFHYNILETMLEPMQDTTDILVDRLSQELDNSGFDVFPIMKLTTLDIVCETTMGYDLGALKNQ-  171 (228)
Q Consensus        95 --~g~~w~~~Rk~l~~~f~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~vi~~~~fG~~~~~~~~~-  171 (228)
                        +|++|+++|++++++|++++++.+.+.+.++++++++.|.+..+++.+|+.+.+..+++|+++.++||.+++....+ 
T Consensus        88 ~~~g~~wk~~Rk~l~~~fs~~~l~~~~~~i~~~~~~li~~l~~~~~~~~idl~~~~~~~~~~~i~~~~fG~~~~~~~~~~  167 (453)
T d2ij2a1          88 WTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGFNYRFNSFYRDQ  167 (453)
T ss_dssp             CTTSHHHHHHHHHHGGGGSTTTHHHHHHHHHHHHHHHHHHHHTCCTTCCEEHHHHHHHHHHHHHHHHHHSCCCCGGGCSS
T ss_pred             CCChHHHHHHHHHHHHHhhhhhhhhhhhhHHHHHHHHHHHhhhcCCCCccchHHHHHHHhhhcchhcccccccchhhhcc
Confidence              69999999999999999999999999999999999999976555779999999999999999999999998765432 


Q ss_pred             CchHHHHHHHHHHHHHHHhhccccchhHHhhcCchhHhHHHHHHHHHHHHHHHhh
Q psy16355        172 NSAYTQAVGIVAEISMKRFMLPWLHYDAIFKRTEMGKTYYRELEVMKKFTLSYSE  226 (228)
Q Consensus       172 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~  226 (228)
                      ..++...+...+.......   .....+...+....+.+.++.+.++++++++++
T Consensus       168 ~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~  219 (453)
T d2ij2a1         168 PHPFITSMVRALDEAMNKL---QRANPDDPAYDENKRQFQEDIKVMNDLVDKIIA  219 (453)
T ss_dssp             CCHHHHHHHHHHHHHHHTC------CTTSGGGHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             chHHHHhhhhccchhhhhh---hhcccccccchhhHHHHHHHHHHHHHHHHHHHh
Confidence            2444433333332222111   111122211233445667777778888877765
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure