Psyllid ID: psy16377


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340----
MFEVPENCSWKMENESMNRISVTCNLNYLGKGGGSNLSFVPTDLITKLNIDCDATVLLDSSITTKSFQNIYSLEELKISNCKLVELPVDVFSGLRNLKRLTINTRNLQWDKSKKLDLVPGSLDGLRELQVLNISSSNIKSISDDVFCSLANIQTLNLSRNSIRDIDTLGFAVRRASAESNSGEKIECSGGMDLRILDLSHNKLRTLGDYSGITKFRRLQNLHLENNEISQIAPNAFVALSSLRILNISSNHLVSLPEGLFSSCRDISEIYAQKNSLVELSRGLFHKLEQLLVLDLSSNHLSSNHIDETTFIGLIRLIILNLSNNELTRIDAKTFKDLVFLQRLDLRNNSIGYIEDNAFLSLYNLHTIYLSENRIHHITAHLFNGLYVLSKLTLSNNLLVNIDSKAFKNCSALKELDLSSNAIVEIPSALSELPFLKTLDLGENQISKIENGSFKNLQQLTDLRLVDNNIGNLSSGMLYELPSLEVLNLSKNKIHQIEIGTFEKNKRLAAIRLDSNFLTDINGVFTYLAQLLWLNLSENHLVWFDYAMVPGNLKWLDIHGNYISSLNNYYEIKDGLSIKNLDASHNRILEISELSIPNSVEVLFINNNLIKSVKPHTFFDKSNLARVDIYANDITKLDLTALRLKPVPQNKTLPEFYLGGNPFDCDCSMDWLPIINNNTSPSMERQYPKIMDLDNVVCKMTYSRGSTHLPASEAAPSQYLCPYDIHCFALCHCCEFDACDCEMTCPKNCSCFHDQNWNTNVVDCSEQQISTVPPRIPMDATHVYLDGNTFKTIPNHVFIGRKNMLSLYVNNSQIEVILNQTFNGLSSLQVLHLENNLITHFYGYEFDNLEKLSELYLQENRIEYIANGTFNALISLQVLQLDGNRLKSFRAFDLNTNSMLRKVYLGNNPFSCSCATLQELQTWIIDNSNKVKDGLDISCVIDESSPPIRKEIDLNSTTCTEYYATSSVIASIMVSDYLPFMIITFLMFLVFLILIIFMFVFKDPFRVWLYTKYGIRLFNFKATSSKHFGEDREKLPKDEEFVLQSIVAELEHGNPSYQLCLHYRDLPHHSPYLQQHTTSPVVIEAAEASRRVILVLTKNFLQTEWSRSDFLIEAAEASRRVILVLTKNFLQTEWSRSDFRSAIHEALTTKTHKLVLVEENIVPEAESDIELKPYLKSCMKIRWGEKRFWERLRYAMPTCDNSKKSCNYRRNINNYTIDSGTGRRSIEAHHTHPYSSQHISSHPLFKASTVISKNHNQEDLAYSSATTATPSPKPHRLHCYTNASDKPVSDHIYSSIDTPEYQEYASRTDRNSTRRMNGKVPVHQQTWSPAGVTMMDSNGVQAYLV
ccccccccEEccccccccEEEEEEccccccccccccccccccccccEEEcccccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccccccccEEEccccccccccHHHccccccccEEEccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccEEEccccccccccHHcccccccccEEEEEcccccccccccccccccccEEEccccccccccHHHHcccccccEEEcccccccccccccccccccccccEEEcccccccccccccccccccccEEEEEccccccccHHHHcccccccEEEccccccccccHHHccccccccEEEccccccccccHHHHcccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccHHHccccccccEEEcccccccccccHHHcccccccEEEccccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccHHHHHHHHHHccccccccccEEEccccccccccEEccccccccccccccccEEEHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEcccccHHHHHHHHHHHHccccccccEEEEccccccccccccccccHHHHHHHHHHccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccEEEEEEEcccccccccHHHHHHHcccccEEccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccEEcccccccEEEEc
cccccccccEEEEcccccccEEEEEcEEEEcccccccccccHHHcEEEEEcccccccccccccHHHHHccccccEEEccccccccccHHHHHcHHcccEEEEcccccccccccHHHccHHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccHHHHHHHHHccccccccccccccccccEEEEcccccccccccHHHHHccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccEEccccccccccccEEEcccccccEEccccccccccccEEEccccccccccHcccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccHHHccccccEEEEcccccccccccHHHHHHccEEEccccccccccccHHHccccccEEEEccccccccccccccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHccccccccccccccccccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccccHcccccccHcccccccccccccccccccccccccccccHHHHHcccccccEEEccccccccccHHHcccccEEEcccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEcccccccccccHHHHccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccccHHHHHHHHHHHcccccccccEEEccccccccccccccccccccccccccccEcccccHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccccccccccEEEEEccccHHHHHHHHHHHHHccccccEEEEEEccccccHHHHHccccHHHHHHHHHHHccEEEEEcHHHHHHHHccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHccccEEEEEEEccccHHHccHHHHHHHHcccEEEEccHHHHHHHHHHcccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccHHHccccccccHHccccccccccccccccccccccccccEEEEEc
mfevpencswkmenesmNRISVTCnlnylgkgggsnlsfvptdlitklnidcdatvlldssittksfqNIYSLEelkisncklvelpvdvfsglrnlkrlTINTrnlqwdkskkldlvpgsldglRELQVLNIsssniksisDDVFCSLANIqtlnlsrnsirdiDTLGFAVRRasaesnsgekiecsggmdlrildlshnklrtlgdysgiTKFRRLQnlhlenneisqiapNAFVALSSLRILNIssnhlvslpeglfsscRDISEIYAQKNSLVELSRGLFHKLEQLLVLDLssnhlssnhidetTFIGLIRLIILNLsnneltridaktfKDLVFLQRLdlrnnsigyiednaFLSLYNLHtiylsenrIHHITAHLFNGLYVLSKLTLSNNLLVNIDSKAFkncsalkeldlssnaiveipsalselpflktldlgenqiskiengsfknlqqltdlrlvdnnignlssgmlyelpslevlnlsknkihqieigtfEKNKRLAAIrldsnfltdINGVFTYLAQLLWLNLSENHLVWfdyamvpgnlkwlDIHGNYISSLNnyyeikdglsiknldasHNRILEiselsipnsvEVLFINNnliksvkphtffdksnlarvdiyanditkldltalrlkpvpqnktlpefylggnpfdcdcsmdwlpiinnntspsmerqypkimdldnvvckmtysrgsthlpaseaapsqylcpydihcfalchccefdacdcemtcpkncscfhdqnwntnvvdcseqqistvppripmdathvyldgntfktipnhvfigRKNMLSLYVNNSQIEVILNQTFNGLSSLQVLHLENNLithfygyefdnlEKLSELYLQENRIEYIANGTFNALISLQVLQLDgnrlksfrafdlnTNSMLRKVylgnnpfscsCATLQELQTWIIdnsnkvkdgldiscvidessppirkeidlnsttcteyyATSSVIASIMVSDYLPFMIITFLMFLVFLILIIFMFVFKDPFRVWLYTKYGIRlfnfkatsskhfgedreklpkdeEFVLQSIVAELehgnpsyqlclhyrdlphhspylqqhttspvVIEAAEASRRVILVLTKNFLQTEWSRSDFLIEAAEASRRVILVLTKNFLQTEWSRSDFRSAIHEALTTKTHKLVLVEEnivpeaesdielkpYLKSCMKIRWGEKRFWERLRYamptcdnskkscnyrrninnytidsgtgrrsieahhthpyssqhisshplfkastvisknhnqedlayssattatpspkphrlhcytnasdkpvsdhiyssidtpeyqeyasrtdrnstrrmngkvpvhqqtwspagvtmmdsngvqaylv
mfevpencswkmenESMNRISVTCNLNYLGKGGGSNLSFVPTDLITKLNIDCDATVLLDSSITTKSFQNIYSLEELKISNCKLVELPVDVfsglrnlkrltintrnlqwdkskkldLVPGSLDGLRELQVLNISSSNIKSISDDVFCSLANIqtlnlsrnsirdIDTLGFAVRrasaesnsgekiecsggMDLRILDLSHNKLRTLGDYSGITKFRRLQNLHLENNEISQIAPNAFVALSSLRILNISSNHLVSLPEGLFSSCRDISEIYAQKNSLVELSRGLFHKLEQLLVLDLSSNHLSSNHIDETTFIGLIRLIILNLSNNELTRIDAKTFKDLVFLQRLDLRNNSIGYIEDNAFLSLYNLHTIYLSENRIHHITAHLFNGLYVLSKLTLSNNLLVNIDSKAFKNCSALKELDLSSNAIVEIPSALSELPFLKTLDLGENQISKIENGSFKNLQQLTDLRLVDNNIGNLSSGMLYELPSLEVLNLSKNKIHQIEIGTFEKNKRLAAIRLDSNFLTDINGVFTYLAQLLWLNLSENHLVWFDYAMVPGNLKWLDIHGNYISSLNNYYEIKDGLSIKNLDASHNRILEIselsipnsVEVLFINNNLIKSVKphtffdksnlarvDIYANDITKldltalrlkpvpqnKTLPEFYLGGNPFDCDCSMDWLPIINNNTSPSMERQYPKIMDLDNVVCKMTYSRGSTHLPASEAAPSQYLCPYDIHCFALCHCCEFDACDCEMTCPKNCSCFHDQNWNTNVVDCSEQQISTVPPRIPMDATHVYLDGNTFKTIPNHVFIGRKNMLSLYVNNSQIEVILNQTFNGLSSLQVLHLENNLITHFYGYEFDNLEKLSELYLQENRIEYIANGTFNALISLQVLQLDGNRLKSFRAFDLNTNSMLRKVYLGNNPFSCSCATLQELQTWIIDNSNKVKDGLDIScvidessppirkeidlnsTTCTEYYATSSVIASIMVSDYLPFMIITFLMFLVFLILIIFMFVFKDPFRVWLYTKYGIRLFNfkatsskhfgedreklpkDEEFVLQSIVAELEHGNPSYQLCLHYRDLPHHSPYLQQHTTSPVVIEAAEASRRVILVLTKnflqtewsrSDFLIEAAEASRRVILVLTKNflqtewsrSDFRSAIHEAlttkthklvlveenivpeaesdielkpylkSCMKIRWGEKRFWERLRYamptcdnskkscnyrrnINNYTIDSGTGRRSIEAHHTHPYSSQHISSHPLFKASTVISKNHNQEDLAYSSattatpspkpHRLHCYTNASDKPVSDHIyssidtpeyqeyasrtdrnstrrmngkvpvhqqtwspagvtmmdSNGVQAYLV
MFEVPENCSWKMENESMNRISVTCNLNYLGKGGGSNLSFVPTDLITKLNIDCDATVLLDSSITTKSFQNIYSLEELKISNCKLVELPVDVFSGLRNLKRLTINTRNLQWDKSKKLDLVPGSLDGLRELQVLnisssniksisDDVFCSLANIQTLNLSRNSIRDIDTLGFAVRRASAESNSGEKIECSGGMDLRILDLSHNKLRTLGDYSGITKFRRLQNLHLENNEISQIAPNAFVAlsslrilnissnhlVSLPEGLFSSCRDISEIYAQKNSLVELSRGLFHKLEQllvldlssnhlssnhIDETTFIGlirliilnlsnnelTRIDAKTFKDLVFLQRLDLRNNSIGYIEDNAFLSLYNLHTIYLSENRIHHITAHLFNGLYVLSKLTLSNNLLVNIDSKAFKNCSALKELDLSSNAIVEIPSALSELPFLKTLDLGENQISKIENGSFKNLQQLTDLRLVDNNIGNLSSGMLYELPSLEVLNLSKNKIHQIEIGTFEKNKRLAAIRLDSNFLTDINGVFTYLAQLLWLNLSENHLVWFDYAMVPGNLKWLDIHGNYISSLNNYYEIKDGLSIKNLDASHNRILEISELSIPNSVEVLFINNNLIKSVKPHTFFDKSNLARVDIYANDITKLDLTALRLKPVPQNKTLPEFYLGGNPFDCDCSMDWLPIINNNTSPSMERQYPKIMDLDNVVCKMTYSRGSTHLPASEAAPSQYLCPYDIHCFALCHCCEFDACDCEMTCPKNCSCFHDQNWNTNVVDCSEQQISTVPPRIPMDATHVYLDGNTFKTIPNHVFIGRKNMLSLYVNNSQIEVILNQTFNGLSSLQVLHLENNLITHFYGYEFDNLEKLSELYLQENRIEYIANGTFNALISLQVLQLDGNRLKSFRAFDLNTNSMLRKVYLGNNPFSCSCATLQELQTWIIDNSNKVKDGLDISCVIDESSPPIRKEIDLNSTTCTEYYATSSVIASIMVSDYLPfmiitflmflvfliliifmfvfKDPFRVWLYTKYGIRLFNFKATSSKHFGEDREKLPKDEEFVLQSIVAELEHGNPSYQLCLHYRDLPHHSPYLQQHTTSPVVIEAAEASRRVILVLTKNFLQTEWSRSDFLIEAAEASRRVILVLTKNFLQTEWSRSDFRSAIHEALTTKTHKLVLVEENIVPEAESDIELKPYLKSCMKIRWGEKRFWERLRYAMPTCDNSKKSCNYRRNINNYTIDSGTGRRSIEAHHTHPYSSQHISSHPLFKASTVISKNHNQEDLAYSSATTATPSPKPHRLHCYTNASDKPVSDHIYSSIDTPEYQEYASRTDRNSTRRMNGKVPVHQQTWSPAGVTMMDSNGVQAYLV
*****************NRISVTCNLNYLGKGGGSNLSFVPTDLITKLNIDCDATVLLDSSITTKSFQNIYSLEELKISNCKLVELPVDVFSGLRNLKRLTINTRNLQWDKSKKLDLVPGSLDGLRELQVLNISSSNIKSISDDVFCSLANIQTLNLSRNSIRDIDTLGFAVR***********IECSGGMDLRILDLSHNKLRTLGDYSGITKFRRLQNLHLENNEISQIAPNAFVALSSLRILNISSNHLVSLPEGLFSSCRDISEIYAQKNSLVELSRGLFHKLEQLLVLDLSSNHLSSNHIDETTFIGLIRLIILNLSNNELTRIDAKTFKDLVFLQRLDLRNNSIGYIEDNAFLSLYNLHTIYLSENRIHHITAHLFNGLYVLSKLTLSNNLLVNIDSKAFKNCSALKELDLSSNAIVEIPSALSELPFLKTLDLGENQISKIENGSFKNLQQLTDLRLVDNNIGNLSSGMLYELPSLEVLNLSKNKIHQIEIGTFEKNKRLAAIRLDSNFLTDINGVFTYLAQLLWLNLSENHLVWFDYAMVPGNLKWLDIHGNYISSLNNYYEIKDGLSIKNLDASHNRILEISELSIPNSVEVLFINNNLIKSVKPHTFFDKSNLARVDIYANDITKLDLTALRLKPVPQNKTLPEFYLGGNPFDCDCSMDWLPIINNNT******QYPKIMDLDNVVCKMTYSRGSTHL*****APSQYLCPYDIHCFALCHCCEFDACDCEMTCPKNCSCFHDQNWNTNVVDCSEQQISTVPPRIPMDATHVYLDGNTFKTIPNHVFIGRKNMLSLYVNNSQIEVILNQTFNGLSSLQVLHLENNLITHFYGYEFDNLEKLSELYLQENRIEYIANGTFNALISLQVLQLDGNRLKSFRAFDLNTNSMLRKVYLGNNPFSCSCATLQELQTWIIDNSNKVKDGLDISCVIDESSPPIRKEIDLNSTTCTEYYATSSVIASIMVSDYLPFMIITFLMFLVFLILIIFMFVFKDPFRVWLYTKYGIRLFNFKAT****************EFVLQSIVAELEHGNPSYQLCLHYRDLPHHSPYLQQHTTSPVVIEAAEASRRVILVLTKNFLQTEWSRSDFLIEAAEASRRVILVLTKNFLQTEWSRSDFRSAIHEALTTKTHKLVLVEENIVPEAESDIELKPYLKSCMKIRWGEKRFWERLRYAMPTCDNSKKSCNYRRNINNYTID*******************************************************************************************************************************
MFEVPENCSWKMENESMNRISVTCNLNYLGKGGGSNLSFVPTDLITKLNIDCDATVLLDSSITTKSFQNIYSLEELKISNCKLVELPVDVFSGLRNLKRLTINTRNLQWDKSKKLDLVPGSLDGLRELQVLNISSSNIKSISDDVFCSLANIQTLNLSRNSIRDIDTLGFAVRRASAESNSGEKIECSGGMDLRILDLSHNKLRTLGDYSGITKFRRLQNLHLENNEISQIAPNAFVALSSLRILNISSNHLVSLPEGLFSSCRDISEIYAQKNSLVELSRGLFHKLEQLLVLDLSSNHLSSNHIDETTFIGLIRLIILNLSNNELTRIDAKTFKDLVFLQRLDLRNNSIGYIEDNAFLSLYNLHTIYLSENRIHHITAHLFNGLYVLSKLTLSNNLLVNIDSKAFKNCSALKELDLSSNAIVEIPSALSELPFLKTLDLGENQISKIENGSFKNLQQLTDLRLVDNNIGNLSSGMLYELPSLEVLNLSKNKIHQIEIGTFEKNKRLAAIRLDSNFLTDINGVFTYLAQLLWLNLSENHLVWFDYAMVPGNLKWLDIHGNYISSLNNYYEIKDGLSIKNLDASHNRILEISELSIPNSVEVLFINNNLIKSVKPHTFFDKSNLARVDIYANDITKLDLTALRLKPVPQNKTLPEFYLGGNPFDCDCSMDWLPIINNNTSPSMERQYPKIMDLDNVVCKMTYSRGSTHLPASEAAPSQYLCPYDIHCFALCHCCEFDACDCEMTCPKNCSCFHDQNWNTNVVDCSEQQISTVPPRIPMDATHVYLDGNTFKTIPNHVFIGRKNMLSLYVNNSQIEVILNQTFNGLSSLQVLHLENNLITHFYGYEFDNLEKLSELYLQENRIEYIANGTFNALISLQVLQLDGNRLKSFRAFDLNTNSMLRKVYLGNNPFSCSCATLQELQTWIIDNSNKVKDGLDISCVI**********IDLNSTTCTEYYATSSVIASIMVSDYLPFMIITFLMFLVFLILIIFMFVFKDPFRVWLYTKYGIRLFNFKATSSKHFGEDREKLPKDEEFVLQSIVAELEHGNPSYQLCLHYRDLPHHSPYLQQHTTSPVVIEAAEASRRVILVLTKNFLQTEWSRSDFLIEAAEASRRVILVLTKNFLQTEWSRSDFRSAIHEALTTKTHKLVLVEENIVPEAESDIELKPYLKSCMKIRWGEKRFWERLRYAM***********************************************************************************************IYSSI*********************************************AYLV
MFEVPENCSWKMENESMNRISVTCNLNYLGKGGGSNLSFVPTDLITKLNIDCDATVLLDSSITTKSFQNIYSLEELKISNCKLVELPVDVFSGLRNLKRLTINTRNLQWDKSKKLDLVPGSLDGLRELQVLNISSSNIKSISDDVFCSLANIQTLNLSRNSIRDIDTLGFAVR***********IECSGGMDLRILDLSHNKLRTLGDYSGITKFRRLQNLHLENNEISQIAPNAFVALSSLRILNISSNHLVSLPEGLFSSCRDISEIYAQKNSLVELSRGLFHKLEQLLVLDLSSNHLSSNHIDETTFIGLIRLIILNLSNNELTRIDAKTFKDLVFLQRLDLRNNSIGYIEDNAFLSLYNLHTIYLSENRIHHITAHLFNGLYVLSKLTLSNNLLVNIDSKAFKNCSALKELDLSSNAIVEIPSALSELPFLKTLDLGENQISKIENGSFKNLQQLTDLRLVDNNIGNLSSGMLYELPSLEVLNLSKNKIHQIEIGTFEKNKRLAAIRLDSNFLTDINGVFTYLAQLLWLNLSENHLVWFDYAMVPGNLKWLDIHGNYISSLNNYYEIKDGLSIKNLDASHNRILEISELSIPNSVEVLFINNNLIKSVKPHTFFDKSNLARVDIYANDITKLDLTALRLKPVPQNKTLPEFYLGGNPFDCDCSMDWLPIINNNTSPSMERQYPKIMDLDNVVCKMTYSRGSTHLPASEAAPSQYLCPYDIHCFALCHCCEFDACDCEMTCPKNCSCFHDQNWNTNVVDCSEQQISTVPPRIPMDATHVYLDGNTFKTIPNHVFIGRKNMLSLYVNNSQIEVILNQTFNGLSSLQVLHLENNLITHFYGYEFDNLEKLSELYLQENRIEYIANGTFNALISLQVLQLDGNRLKSFRAFDLNTNSMLRKVYLGNNPFSCSCATLQELQTWIIDNSNKVKDGLDISCVIDESSPPIRKEIDLNSTTCTEYYATSSVIASIMVSDYLPFMIITFLMFLVFLILIIFMFVFKDPFRVWLYTKYGIRLFNFKATSSKHFGEDREKLPKDEEFVLQSIVAELEHGNPSYQLCLHYRDLPHHSPYLQQHTTSPVVIEAAEASRRVILVLTKNFLQTEWSRSDFLIEAAEASRRVILVLTKNFLQTEWSRSDFRSAIHEALTTKTHKLVLVEENIVPEAESDIELKPYLKSCMKIRWGEKRFWERLRYAMPTCDNSKKSCNYRRNINNYTIDSGTGRRSIEAHH**********SHPLFKASTVISKNHNQEDLAYSS*********PHRLHCYTNASDKPVSDHIYSSIDTPEYQEYASRTDRNSTRRMNGKVPVHQQTWSPAGVTMMDSNGVQAYLV
MFEVPENCSWKMENESMNRISVTCNLNYLGKGGGSNLSFVPTDLITKLNIDCDATVLLDSSITTKSFQNIYSLEELKISNCKLVELPVDVFSGLRNLKRLTINTRNLQWDKSKKLDLVPGSLDGLRELQVLNISSSNIKSISDDVFCSLANIQTLNLSRNSIRDIDTLGFAVRRASAESNSGEKIECSGGMDLRILDLSHNKLRTLGDYSGITKFRRLQNLHLENNEISQIAPNAFVALSSLRILNISSNHLVSLPEGLFSSCRDISEIYAQKNSLVELSRGLFHKLEQLLVLDLSSNHLSSNHIDETTFIGLIRLIILNLSNNELTRIDAKTFKDLVFLQRLDLRNNSIGYIEDNAFLSLYNLHTIYLSENRIHHITAHLFNGLYVLSKLTLSNNLLVNIDSKAFKNCSALKELDLSSNAIVEIPSALSELPFLKTLDLGENQISKIENGSFKNLQQLTDLRLVDNNIGNLSSGMLYELPSLEVLNLSKNKIHQIEIGTFEKNKRLAAIRLDSNFLTDINGVFTYLAQLLWLNLSENHLVWFDYAMVPGNLKWLDIHGNYISSLNNYYEIKDGLSIKNLDASHNRILEISELSIPNSVEVLFINNNLIKSVKPHTFFDKSNLARVDIYANDITKLDLTALRLKPVPQNKTLPEFYLGGNPFDCDCSMDWLPIINNNTSPSMERQYPKIMDLDNVVCKMTYSRGSTHLPASEAAPSQYLCPYDIHCFALCHCCEFDACDCEMTCPKNCSCFHDQNWNTNVVDCSEQQISTVPPRIPMDATHVYLDGNTFKTIPNHVFIGRKNMLSLYVNNSQIEVILNQTFNGLSSLQVLHLENNLITHFYGYEFDNLEKLSELYLQENRIEYIANGTFNALISLQVLQLDGNRLKSFRAFDLNTNSMLRKVYLGNNPFSCSCATLQELQTWIIDNSNKVKDGLDISCVIDESSPPIRKEIDLNSTTCTEYYATSSVIASIMVSDYLPFMIITFLMFLVFLILIIFMFVFKDPFRVWLYTKYGIRLFNFKATSSKHFGEDREKLPKDEEFVLQSIVAELEHGNPSYQLCLHYRDLPHHSPYLQQHTTSPVVIEAAEASRRVILVLTKNFLQTEWSRSDFLIEAAEASRRVILV*******TEWSRSDFRSAIHEALTTKTHKLVLVEENIVPEAESDIELKPYLKSCMKIRWGEKRFWERLRYAMPTCDNSKKSCNYRRNINNYTIDSGTGRRSIEAHHTHPYSSQHISSHP*****************************************DKPVSDHIYSSIDTPEYQEYASRTDRN**R***********************NGV**YL*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFEVPENCSWKMENESMNRISVTCNLNYLGKGGGSNLSFVPTDLITKLNIDCDATVLLDSSITTKSFQNIYSLEELKISNCKLVELPVDVFSGLRNLKRLTINTRNLQWDKSKKLDLVPGSLDGLRELQVLNISSSNIKSISDDVFCSLANIQTLNLSRNSIRDIDTLGFAVRRASAESNSGEKIECSGGMDLRILDLSHNKLRTLGDYSGITKFRRLQNLHLENNEISQIAPNAFVALSSLRILNISSNHLVSLPEGLFSSCRDISEIYAQKNSLVELSRGLFHKLEQLLVLDLSSNHLSSNHIDETTFIGLIRLIILNLSNNELTRIDAKTFKDLVFLQRLDLRNNSIGYIEDNAFLSLYNLHTIYLSENRIHHITAHLFNGLYVLSKLTLSNNLLVNIDSKAFKNCSALKELDLSSNAIVEIPSALSELPFLKTLDLGENQISKIENGSFKNLQQLTDLRLVDNNIGNLSSGMLYELPSLEVLNLSKNKIHQIEIGTFEKNKRLAAIRLDSNFLTDINGVFTYLAQLLWLNLSENHLVWFDYAMVPGNLKWLDIHGNYISSLNNYYEIKDGLSIKNLDASHNRILEISELSIPNSVEVLFINNNLIKSVKPHTFFDKSNLARVDIYANDITKLDLTALRLKPVPQNKTLPEFYLGGNPFDCDCSMDWLPIINNNTSPSMERQYPKIMDLDNVVCKMTYSRGSTHLPASEAAPSQYLCPYDIHCFALCHCCEFDACDCEMTCPKNCSCFHDQNWNTNVVDCSEQQISTVPPRIPMDATHVYLDGNTFKTIPNHVFIGRKNMLSLYVNNSQIEVILNQTFNGLSSLQVLHLENNLITHFYGYEFDNLEKLSELYLQENRIEYIANGTFNALISLQVLQLDGNRLKSFRAFDLNTNSMLRKVYLGNNPFSCSCATLQELQTWIIDNSNKVKDGLDISCVIDESSPPIRKEIDLNSTTCTEYYATSSVIASIMVSDYLPFMIITFLMFLVFLILIIFMFVFKDPFRVWLYTKYGIRLFNFKATSSKHFGEDREKLPKDEEFVLQSIVAELEHGNPSYQLCLHYRDLPHHSPYLQQHTTSPVVIEAAEASRRVILVLTKNFLQTEWSRSDFLIEAAEASRRVILVLTKNFLQTEWSRSDFRSAIHEALTTKTHKLVLVEENIVPEAESDIELKPYLKSCMKIRWGEKRFWERLRYAMPTCDNSKKSCNYRRNINNYTIDSGTGRRSIEAHHTHPYSSQHISSHPLFKASTVISKNHNQEDLAYSSATTATPSPKPHRLHCYTNASDKPVSDHIYSSIDTPEYQEYASRTDRNSTRRMNGKVPVHQQTWSPAGVTMMDSNGVQAYLV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1344 2.2.26 [Sep-21-2011]
P089531097 Protein toll OS=Drosophil no N/A 0.619 0.759 0.242 2e-52
O88280 1523 Slit homolog 3 protein OS yes N/A 0.528 0.466 0.237 1e-37
P70389603 Insulin-like growth facto yes N/A 0.342 0.762 0.301 3e-36
O75094 1523 Slit homolog 3 protein OS yes N/A 0.526 0.464 0.239 5e-36
O02833605 Insulin-like growth facto N/A N/A 0.345 0.768 0.280 8e-36
O88279 1531 Slit homolog 1 protein OS no N/A 0.408 0.358 0.263 1e-35
Q9WVB4 1523 Slit homolog 3 protein OS no N/A 0.548 0.483 0.247 1e-35
O75093 1534 Slit homolog 1 protein OS no N/A 0.412 0.361 0.262 3e-35
Q9R1B9 1521 Slit homolog 2 protein OS no N/A 0.549 0.485 0.241 5e-35
P35859603 Insulin-like growth facto no N/A 0.354 0.791 0.266 6e-35
>sp|P08953|TOLL_DROME Protein toll OS=Drosophila melanogaster GN=Tl PE=1 SV=1 Back     alignment and function desciption
 Score =  208 bits (530), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 254/1049 (24%), Positives = 417/1049 (39%), Gaps = 216/1049 (20%)

Query: 199  SHNKLRTLGDYSGITKFRRLQNLHLENNEISQIAPNAFVALSSLRILNISSNHLVSLPEG 258
             H  + ++ DY GI     L  +   +N    I       L  L+    ++  L  +P  
Sbjct: 111  GHTPIASILDYLGIVSPTTL--IFESDNLGMNITRQHLDRLHGLKRFRFTTRRLTHIPAN 168

Query: 259  LFSSCRDISEIYAQKNSLVELSRGLFHKLEQLLVLDLSSNHLSSNHIDETTFIGLIRLII 318
            L +  R++S +  + N + E+   LF  LE L  ++  SN L    +    F  + +L  
Sbjct: 169  LLTDMRNLSHLELRAN-IEEMPSHLFDDLENLESIEFGSNKLR--QMPRGIFGKMPKLKQ 225

Query: 319  LNLSNNELTRIDAKTFKDLVFLQRLDLRNNSIGYIEDNAFLSLYNLHTIYLSENRIHHIT 378
            LNL +N+L  +    F+    +  +D+ +N I  +  + F  L N+  I LS N    + 
Sbjct: 226  LNLWSNQLHNLTKHDFEGATSVLGIDIHDNGIEQLPHDVFAHLTNVTDINLSANLFRSLP 285

Query: 379  AHLFNGLYVLSKLTLSNNL--LVNIDSKAFKNCSALK----------------------- 413
              LF+    L+++ L NN   L  + S+ F N   L+                       
Sbjct: 286  QGLFDHNKHLNEVRLMNNRVPLATLPSRLFANQPELQILRLRAELQSLPGDLFEHSTQIT 345

Query: 414  ELDLSSNAIVEIPSALSELPF-LKTLDLGENQISKIENGSFKNLQQLTDLRLVDNNIGNL 472
             + L  N +  +P+ L E    L +LDL  N+++ + +  F +   LTDLRL DN +  +
Sbjct: 346  NISLGDNLLKTLPATLLEHQVNLLSLDLSNNRLTHLPDSLFAHTTNLTDLRLEDNLLTGI 405

Query: 473  SSGMLYELPSLEVLNLSKNKIHQIEIGTFEKNKRLAAIRLDSN------------FLTDI 520
            S  +   L +L  L +S+N++  I+   F     L  + LD N              T I
Sbjct: 406  SGDIFSNLGNLVTLVMSRNRLRTIDSRAFVSTNGLRHLHLDHNDIDLQQPLLDIMLQTQI 465

Query: 521  NGVFTYLAQLLWLNLSENHLVWF--DYAMVPGNLKWLDIHGNYISSLNNYYEIKDGLSIK 578
            N  F Y+  LL LNL  N +++   D+      L+ LD+  N ISSL   YE    LS  
Sbjct: 466  NSPFGYMHGLLTLNLRNNSIIFVYNDWKNTMLQLRELDLSYNNISSLG--YEDLAFLSQN 523

Query: 579  NL--DASHNRILEISELSIPNSVEVLFINNNLIKSVKPHTFFDKSNLARVDIYANDITKL 636
             L  + +HN+I  I+   +P  V +    NN              NL  VD         
Sbjct: 524  RLHVNMTHNKIRRIA---LPEDVHLGEGYNN--------------NLVHVD--------- 557

Query: 637  DLTALRLKPVPQNKTLPEFYLGGNPFDCDCSMDW-LPIINNNTSPSMERQYPKIMDLDNV 695
                                L  NP  CDC++ W + ++     P   RQ+   +  D +
Sbjct: 558  --------------------LNDNPLVCDCTILWFIQLVRGVHKPQYSRQFK--LRTDRL 595

Query: 696  VCKMTYSRGSTHLPASEAAPSQYLCPYDIHCFALCHCCEFDACDCEMTCPKNCSCFHDQN 755
            VC        T  P  +  P   +CP D           F     E  CP+ C+C H + 
Sbjct: 596  VCSQPNVLEGT--PVRQIEPQTLICPLD-----------FSDDPRERKCPRGCNC-HVRT 641

Query: 756  WNTN-VVDCSEQQISTVPPRIP-----MDATHVYLDGNTFKTIPNHVFIGRKNMLSLYVN 809
            ++   V++C    ++ V PR+P     M    ++L+ NT   +P+    G +++ SL++ 
Sbjct: 642  YDKALVINCHSGNLTHV-PRLPNLHKNMQLMELHLENNTLLRLPSANTPGYESVTSLHLA 700

Query: 810  NSQIEVILNQTFNGLSSLQVLHLENNLITHFYGYEFDNLEKLSELYLQENRIEYIANGTF 869
                        N L+S+ V  L  NL TH                              
Sbjct: 701  G-----------NNLTSIDVDQLPTNL-THLD---------------------------- 720

Query: 870  NALISLQVLQLDGNRLKSFRAFDLNTNSMLRKVYLGNNPFSCSCATLQELQTWIIDNSNK 929
               IS   LQ+    +  F    LN     R V L  NP+ C C T + L  +  DN  +
Sbjct: 721  ---ISWNHLQMLNATVLGF----LNRTMKWRSVKLSGNPWMCDC-TAKPLLLFTQDNFER 772

Query: 930  VKDGLDISCVIDESSPPIRKEIDLNSTTCTEYYATSSVIASIMVSDYLPFMIITFLMFLV 989
            + D  ++ CV +   P    E+  N     E               ++   ++  L  L+
Sbjct: 773  IGDRNEMMCV-NAEMPTRMVELSTNDICPAEKGV------------FIALAVVIALTGLL 819

Query: 990  FLILIIFMFVFKDPFRVWLYTKYGIRLFNFKA--TSSKHFGEDREKLPKDEEFVLQSIVA 1047
                    + F+   ++WLY    +  F  +      K F        KD+ F+   +V 
Sbjct: 820  AGFTAALYYKFQTEIKIWLYAHNLLLWFVTEEDLDKDKKFDAFISYSHKDQSFIEDYLVP 879

Query: 1048 ELEHGNPSYQLCLHYRDLPHHSPYLQQHTTSPVVIEAAEASRRVILVLTKNFLQTEWSRS 1107
            +LEHG   +QLC+H RD      +L        ++ +   SRR I+VL++NF+++EW+R 
Sbjct: 880  QLEHGPQKFQLCVHERD------WLVGGHIPENIMRSVADSRRTIIVLSQNFIKSEWARL 933

Query: 1108 DFLIEAAEASRRVILVLTKNFLQTEWSRSDFRSAIHEALTTKTHKLVLVEENIVPEAESD 1167
            +F                         R+  RSA++E    ++  +V++  +I    + D
Sbjct: 934  EF-------------------------RAAHRSALNEG---RSRIIVIIYSDIGDVEKLD 965

Query: 1168 IELKPYLKSCMKIRWGEKRFWERLRYAMP 1196
             ELK YLK    ++WG+  FW++LR+A+P
Sbjct: 966  EELKAYLKMNTYLKWGDPWFWDKLRFALP 994




Component of the extracellular signaling pathway that establishes the dorsal-ventral pathway of the embryo. Three proteases; ndl, gd and snk process easter to create active easter. Active easter defines cell identities along the dorsal-ventral continuum by activating the spz ligand for the Tl receptor in the ventral region of the embryo. Promotes heterophilic cellular adhesion. Spz C-106 in the hemolymph controls expression of the antifungal peptide Drosomycin (Drs) by acting as a ligand of Tl and inducing an intracellular signaling pathway.
Drosophila melanogaster (taxid: 7227)
>sp|O88280|SLIT3_RAT Slit homolog 3 protein OS=Rattus norvegicus GN=Slit3 PE=2 SV=1 Back     alignment and function description
>sp|P70389|ALS_MOUSE Insulin-like growth factor-binding protein complex acid labile subunit OS=Mus musculus GN=Igfals PE=2 SV=1 Back     alignment and function description
>sp|O75094|SLIT3_HUMAN Slit homolog 3 protein OS=Homo sapiens GN=SLIT3 PE=2 SV=3 Back     alignment and function description
>sp|O02833|ALS_PAPHA Insulin-like growth factor-binding protein complex acid labile subunit OS=Papio hamadryas GN=IGFALS PE=2 SV=1 Back     alignment and function description
>sp|O88279|SLIT1_RAT Slit homolog 1 protein OS=Rattus norvegicus GN=Slit1 PE=1 SV=1 Back     alignment and function description
>sp|Q9WVB4|SLIT3_MOUSE Slit homolog 3 protein OS=Mus musculus GN=Slit3 PE=2 SV=2 Back     alignment and function description
>sp|O75093|SLIT1_HUMAN Slit homolog 1 protein OS=Homo sapiens GN=SLIT1 PE=2 SV=4 Back     alignment and function description
>sp|Q9R1B9|SLIT2_MOUSE Slit homolog 2 protein OS=Mus musculus GN=Slit2 PE=2 SV=2 Back     alignment and function description
>sp|P35859|ALS_RAT Insulin-like growth factor-binding protein complex acid labile subunit OS=Rattus norvegicus GN=Igfals PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1344
2420200131317 toll, putative [Pediculus humanus corpor 0.947 0.966 0.558 0.0
910764781310 PREDICTED: similar to 18 wheeler [Tribol 0.945 0.970 0.558 0.0
3287196121336 PREDICTED: protein toll-like [Acyrthosip 0.941 0.946 0.517 0.0
1825112201295 18 wheeler precursor [Bombyx mori] gi|18 0.923 0.958 0.510 0.0
3576176861295 18 wheeler [Danaus plexippus] 0.924 0.959 0.513 0.0
3504137301393 PREDICTED: protein toll-like [Bombus imp 0.937 0.904 0.487 0.0
1700628651353 toll [Culex quinquefasciatus] gi|1678806 0.918 0.912 0.479 0.0
3454856831270 PREDICTED: LOW QUALITY PROTEIN: protein 0.847 0.896 0.519 0.0
616562161370 18-wheeler precursor [Apis mellifera] gi 0.927 0.909 0.496 0.0
3800279641371 PREDICTED: protein toll-like [Apis flore 0.924 0.906 0.494 0.0
>gi|242020013|ref|XP_002430452.1| toll, putative [Pediculus humanus corporis] gi|212515590|gb|EEB17714.1| toll, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 1481 bits (3833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 758/1357 (55%), Positives = 975/1357 (71%), Gaps = 84/1357 (6%)

Query: 2    FEVPENCSWKMENESMN-RISVTCNLNYLGKGGGSNLSFVPTDLITKLNIDCDATVLLDS 60
            +E P +C W   NE+ + +++V+C    L   G   L+ +  D I +L + C   V  +S
Sbjct: 31   YEPPSDCVWSSGNETTSSKMTVSCTYKNLDVNG---LTSLQPDGILRLTVTCRENVFHES 87

Query: 61   SITTKSFQNIYSLEELKISNCKLVELPVDVFSGLRNLKRLTINTRNLQWDKSKKLDLVPG 120
             +   +   +  LEEL + +CK+++L    F GLR L++L+++TRN  W + K LD+  G
Sbjct: 88   FVP-PAVNRLLHLEELTLDSCKILKLLPIGFDGLRELRKLSVHTRNSDWSQGKVLDVSEG 146

Query: 121  SLDGLRELQVLNISSSNIKSISDDVFCSLANIQTLNLSRNSIRDIDTLGFAVRRASAESN 180
            SL GL+EL VL++  SNIK+I D+V+C L N+QTLNL+RN IRD++ +GF  R +   S+
Sbjct: 147  SLSGLKELHVLDLGWSNIKAIPDEVYCPLVNLQTLNLTRNRIRDVNKIGFGTRISRESSS 206

Query: 181  SGEKI-ECSGGMDLRILDLSHNKLRTLGDYSGITKFRRLQNLHLENNEISQIAPNAFVAL 239
            S   + ECSGG+D+R LD+S+N ++ L + S + K +RLQ L+L+NN +S+I   AF  L
Sbjct: 207  SSSSVAECSGGIDIRHLDVSYNDIKLLKNDSDLIKLKRLQGLYLQNNLLSEIGSGAFAGL 266

Query: 240  SSLRILNISSNHLVSLPEGLFSSCRDISEIYAQKNSLVELSRGLFHKLEQLLVLDLSSNH 299
             SLR+LNIS+N+L SLPEGLF S R++ EIY Q N L EL+ G+FH+LEQLLVLDLS N 
Sbjct: 267  LSLRVLNISNNNLRSLPEGLFVSSRELREIYLQNNGLTELAAGIFHRLEQLLVLDLSGNM 326

Query: 300  LSSNHIDETTFIGLIRLIILNLSNNELTRIDAKTFKDLVFLQRLDLRNNSIGYIEDNAFL 359
            L+SNH+D+ TF+GLIRLI+LNLS+N L RI+AKTFKDL FLQ LDLRNNSI +I+DNAFL
Sbjct: 327  LTSNHVDDGTFLGLIRLIVLNLSHNSLNRIEAKTFKDLFFLQILDLRNNSIQHIQDNAFL 386

Query: 360  SLYNLHTIYLSENRIHHITAHLFNGLYVLSKLTLSNNLLVNIDSKAFKNCSALKELDLSS 419
             LYNLHT+ L+ENR+H+I AHLFNGL+VLSKLTLS N++++ID +AF+NCS LKELDLSS
Sbjct: 387  PLYNLHTLNLAENRLHNIDAHLFNGLFVLSKLTLSGNMIISIDQQAFRNCSDLKELDLSS 446

Query: 420  NAIVEIPSALSELPFLKTLDLGENQISKIENGSFKNLQQLTDLRLVDNNIGNLSSGMLYE 479
            NA+ ++P AL EL FLKTLDLGEN+IS   NGSFK L QLT LRL+DN+IGNL+ GM  +
Sbjct: 447  NALEKVPEALRELSFLKTLDLGENKISGFRNGSFKGLSQLTGLRLIDNDIGNLTKGMFSD 506

Query: 480  LPSLEVLNLSKNKIHQIEIGTFEKNKRLAAIRLDSNFLTDINGVFTYLAQLLWLNLSENH 539
            LPSL+VLNL+KNKI QIE GTF  N +L AIRLD+NF+ DINGVF+ L  LLWLNLSENH
Sbjct: 507  LPSLQVLNLAKNKIQQIEHGTFHYNTQLEAIRLDANFIVDINGVFSSLQSLLWLNLSENH 566

Query: 540  LVWFDYAMVPGNLKWLDIHGNYISSLNNYYEIKDGLSIKNLDASHNRILEISELSIPNSV 599
            LVWFDYA +P NLKWLD+HGN+I SL NYY+I+D L ++ LDASHNRI  IS LSIPNSV
Sbjct: 567  LVWFDYAFIPLNLKWLDVHGNFIESLGNYYKIQDELHVRTLDASHNRISSISPLSIPNSV 626

Query: 600  EVLFINNNLIKSVKPHTFFDKSNLARVDIYANDITKLDLTALRLKPVPQNKTLPEFYLGG 659
            E++FINNN I +V P+TF+DKSNLARVD+YAN I KLD+ +LRLK VP+NKTLPEFY+GG
Sbjct: 627  ELVFINNNFITNVHPNTFYDKSNLARVDMYANQIEKLDINSLRLKQVPENKTLPEFYIGG 686

Query: 660  NPFDCDCSMDWLPIINNNTSPSMERQYPKIMDLDNVVCKMTYSRGSTHLPASEAAPSQYL 719
            NPF CDC+MDWL +INN T     RQYPK+MDLDNV+C++T+SRGST +P +E   S +L
Sbjct: 687  NPFHCDCTMDWLGMINNMTL----RQYPKVMDLDNVMCRLTFSRGSTLVPTTETKSSDFL 742

Query: 720  CPYDIHCFALCHCCEFDACDCEMTCPKNCSCFHDQNWNTNVVDCSEQQISTVPPRIPMDA 779
            C YD HCF LCHCC++DACDCEMTCP+NCSC+HDQ W TN+V+CS ++++ +P RIPMDA
Sbjct: 743  CKYDTHCFTLCHCCDYDACDCEMTCPQNCSCYHDQLWTTNIVECSNRKLNEIPVRIPMDA 802

Query: 780  THVYLDGNTFKTIPNHVFIGRKNMLSLYVNNSQIEVILNQTFNGLSSLQVLHLENNLITH 839
              VYLDGN  K + NHVFIGRKNM  LYVNNS +E I N+TFNGL+SLQ+LHLE+N +  
Sbjct: 803  NEVYLDGNHLKELQNHVFIGRKNMRVLYVNNSHVESIQNRTFNGLNSLQILHLEDNNLHA 862

Query: 840  FYGYEFDNLEKLSELYLQENRIEYIANGTFNALISLQVLQLDGNRLKSFRAFDLNTNSML 899
              G+EF++L  L ELYLQ N+I +I N T   L SL++L+LD NRL +F  + L  N+ L
Sbjct: 863  LKGFEFEHLSHLRELYLQNNKISHIGNMTLLPLRSLEILRLDNNRLVTFPVWQLTLNTYL 922

Query: 900  RKVYLGNNPFSCSCATLQELQTWIIDNSNKVKDGLDISCVIDESSPPIRKEIDLNSTTCT 959
             +V L NN +SC C  L ELQTWI DN  KV D  +I CV + S PP R+ ID+N+T C+
Sbjct: 923  VEVTLSNNQWSCRCKFLVELQTWISDNEPKVTDSSEIMCVDNNSRPPYRRSIDINNTACS 982

Query: 960  EYYATSSVIASIMVSDYLPFMIITFLMFLVFLILIIFMFVFKDPFRVWLYTKYGIRLFNF 1019
            +YY+ SSVI S+MVS Y P +I+T   F++ L +++ +F+F+D  +VW+YTKYG+R++NF
Sbjct: 983  DYYSGSSVIQSLMVSHYWPMVIVTLSTFVLILFVMMLVFIFRDSLKVWVYTKYGVRIWNF 1042

Query: 1020 KATSSKHFGEDREKL--------PKDEEFVLQSIVAELEHGNPSYQLCLHYRDLPHHSPY 1071
            K        EDREKL        PKDEEFVLQSIVAELEHG+PS+QLCLHYRDLP  SPY
Sbjct: 1043 KGGMGS--CEDREKLYDGYVCYSPKDEEFVLQSIVAELEHGSPSFQLCLHYRDLPQPSPY 1100

Query: 1072 LQQHTTSPVVIEAAEASRRVILVLTKNFLQTEWSRSDFLIEAAEASRRVILVLTKNFLQT 1131
            +Q   TSPVV+EAAEASRRVILVL++NFLQTEW                           
Sbjct: 1101 MQ--NTSPVVVEAAEASRRVILVLSRNFLQTEW--------------------------- 1131

Query: 1132 EWSRSDFRSAIHEALTTKTHKLVLVEE-NIVPEAESDIELKPYLKSCMKIRWGEKRFWER 1190
              SR +FR A+HEAL  +  KLVLVEE + +PEAE D +L+PYLK+  ++RWGEKRFWER
Sbjct: 1132 --SRFEFRQALHEALKGRIFKLVLVEEGSSLPEAELDPDLRPYLKTGARVRWGEKRFWER 1189

Query: 1191 LRYAMPTCD-NSKKSCNYRRNINNYTIDSGTGRRSIEAHHTHPYSSQHISSHPLFKASTV 1249
            LRYAMP+ D +  KS NY                          ++      P    + V
Sbjct: 1190 LRYAMPSGDKHHTKSTNYPA-----------------------MAAAMNDMAPPAYCANV 1226

Query: 1250 ISKNHNQEDLAYSSATTATPSPKP-HRLHCYTNASD-KPVSDHIYSSIDTPEYQEYASRT 1307
               + + +D  YSSA TATPSPKP HR    +N  + +P S+HIYSSID+    +Y++  
Sbjct: 1227 PPTSQDVDDANYSSAATATPSPKPSHRHQSSSNDQNSRPNSEHIYSSIDS----DYST-L 1281

Query: 1308 DRNSTRRMNGKVPVHQQTWSPAGVTMMDSNGVQAYLV 1344
            +RNS RR NG +      W PA  +++DS+GVQAYLV
Sbjct: 1282 ERNSNRRQNGVLQRPGAPWRPAD-SIVDSSGVQAYLV 1317




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91076478|ref|XP_972409.1| PREDICTED: similar to 18 wheeler [Tribolium castaneum] gi|270002880|gb|EEZ99327.1| toll-7-like protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328719612|ref|XP_001946943.2| PREDICTED: protein toll-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|182511220|ref|NP_001116821.1| 18 wheeler precursor [Bombyx mori] gi|18916402|dbj|BAB85498.1| 18 wheeler [Bombyx mori] Back     alignment and taxonomy information
>gi|357617686|gb|EHJ70927.1| 18 wheeler [Danaus plexippus] Back     alignment and taxonomy information
>gi|350413730|ref|XP_003490091.1| PREDICTED: protein toll-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|170062865|ref|XP_001866855.1| toll [Culex quinquefasciatus] gi|167880620|gb|EDS44003.1| toll [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|345485683|ref|XP_003425317.1| PREDICTED: LOW QUALITY PROTEIN: protein toll [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|61656216|ref|NP_001013379.1| 18-wheeler precursor [Apis mellifera] gi|60678633|gb|AAX33677.1| Toll-like receptor [Apis mellifera] Back     alignment and taxonomy information
>gi|380027964|ref|XP_003697682.1| PREDICTED: protein toll-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1344
FB|FBgn00344761446 Toll-7 "Toll-7" [Drosophila me 0.809 0.752 0.465 1e-310
FB|FBgn00043641389 18w "18 wheeler" [Drosophila m 0.805 0.778 0.442 5.3e-283
FB|FBgn00364941514 Toll-6 "Toll-6" [Drosophila me 0.821 0.729 0.386 6.1e-240
FB|FBgn00291141346 Tollo "Tollo" [Drosophila mela 0.688 0.687 0.387 1.2e-201
WB|WBGene000065931221 tol-1 [Caenorhabditis elegans 0.415 0.457 0.271 8.1e-70
FB|FBgn02624731097 Tl "Toll" [Drosophila melanoga 0.352 0.432 0.243 1.2e-36
ZFIN|ZDB-GENE-030722-3 1524 slit1a "slit homolog 1a (Droso 0.375 0.331 0.253 2.2e-24
MGI|MGI:1315202 1523 Slit3 "slit homolog 3 (Drosoph 0.279 0.246 0.237 4e-15
UNIPROTKB|O75094 1523 SLIT3 "Slit homolog 3 protein" 0.279 0.246 0.234 2.3e-14
UNIPROTKB|J3KNP3 1530 SLIT3 "Slit homolog 3 protein" 0.279 0.245 0.234 2.3e-14
FB|FBgn0034476 Toll-7 "Toll-7" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 2645 (936.1 bits), Expect = 1.0e-310, Sum P(3) = 1.0e-310
 Identities = 529/1136 (46%), Positives = 720/1136 (63%)

Query:     5 PEN-CSWKMENESMNRISVTCNLNYLGKGGGSNLSFVPTDLITKLNIDCDATVLLDSSIT 63
             P N CSW     S    SV C L  + +  G +L     D  ++L I C    L +S++ 
Sbjct:    73 PANQCSWSYNGTS----SVHCALRLIERQPGLDLQ--GADGSSQLTIQCSELYLFESTLP 126

Query:    64 TKSFQNIYSLEELKISNCKLVELPVDVFSGLRNLKRLTINTRNLQWDKSKKLDLVPGSLD 123
                F  + +LE L++ +CKL++LP + F GL  LK L ++T N +W  ++ L+L P SL 
Sbjct:   127 VAVFARLQTLEALRLDSCKLLQLPNNAFEGLATLKSLRLSTHNSEWGPTRTLELFPDSLG 186

Query:   124 GLRELQVLXXXXXXXXXXXDDVFCSLANIQTLNLSRNSIRDIDTLGFAVRRASAESNSGE 183
             GL++L  L               C + N+Q LNL+RN IR  + +GFA     A   SG 
Sbjct:   187 GLKQLTDLDLGDNNLRQLPSGFLCPVGNLQVLNLTRNRIRTAEQMGFADMNCGA--GSG- 243

Query:   184 KIECSGGMDLRILDLSHNKLRTLGDYSGITKFRRLQNLHLENNEISQIAPNAFVAXXXXX 243
                 S G +L++LD SHN+LR++ +  GI++ RRLQ+L+L  N +S+++  A        
Sbjct:   244 ----SAGSELQVLDASHNELRSISESWGISRLRRLQHLNLAYNNLSELSGEALAGLASLR 299

Query:   244 XXXXXXXXXVSLPEGLFSSCRDISEIYAQKNSLVELSRGLFHKLEQXXXXXXXXXXXXXX 303
                       +LPEGLF+  +++ EI+ Q+N L EL +GLFH+LEQ              
Sbjct:   300 IVNLSNNHLETLPEGLFAGSKELREIHLQQNELYELPKGLFHRLEQLLVVDLSGNQLTSN 359

Query:   304 XIDETTFIGXXXXXXXXXXXXXXTRIDAKTFKDLVFLQRLDLRNNSIGYIEDNAFLSLYN 363
              +D TTF G              TRID +TFK+L FLQ L+LRNNSIG+IEDNAFL LYN
Sbjct:   360 HVDNTTFAGLIRLIVLNLAHNALTRIDYRTFKELYFLQILNLRNNSIGHIEDNAFLPLYN 419

Query:   364 LHTIYLSENRIHHITAHLFNGLYVLSKLTLSNNLLVNIDSKAFKNCSALKELDLSSNAIV 423
             LHT+ L+ENR+H +   LFNGLYVLSKLTL+NNL+  ++   FKNCS LKELDLSSN + 
Sbjct:   420 LHTLNLAENRLHTLDDKLFNGLYVLSKLTLNNNLISVVEPAVFKNCSDLKELDLSSNQLN 479

Query:   424 EIPSALSELPFLKTLDLGENQISKIENGSFKNLQQLTDLRLVDNNIGNLSSGMLYELPSL 483
             E+P AL +L  L+TLDLGENQI   +N SFKNL QLT LRL+DN IGN++ GM  +LP L
Sbjct:   480 EVPRALQDLAMLRTLDLGENQIRTFDNQSFKNLHQLTGLRLIDNQIGNITVGMFQDLPRL 539

Query:   484 EVLNLSKNKIHQIEIGTFEKNKRLAAIRLDSNFLTDINGVFTYLAQLLWLNLSENHLVWF 543
              VLNL+KN+I  IE G+F+KN  L AIRLD NFL DINGVF  L  LLWLNLSENHLVWF
Sbjct:   540 SVLNLAKNRIQSIERGSFDKNFELEAIRLDRNFLADINGVFATLVSLLWLNLSENHLVWF 599

Query:   544 DYAMVPGNLKWLDIHGNYISSLNNYYEIKDGLSIKNLDASHNRILEISELSIPNSVEVLF 603
             DYA +P NLKWLDIHGNYI +L NYY++++ + +K LDASHNRI EI  +SIPN++E+LF
Sbjct:   600 DYAFIPSNLKWLDIHGNYIEALGNYYKLQEEIRVKTLDASHNRITEIGPMSIPNTIELLF 659

Query:   604 INNNLIKSVKPHTFFDKSNLARVDIYANDITKLDLTALRLKPVPQNKTLPEFYLGGNPFD 663
             INNNLI +V+P+ F DK+NLARVD+YAN ++KL L  LR+ PV   K LPEFYLGGNPF+
Sbjct:   660 INNNLIGNVQPNAFVDKANLARVDLYANQLSKLQLQQLRVAPVVAPKPLPEFYLGGNPFE 719

Query:   664 CDCSMDWLPIINNNTSPSMERQYPKIMDLDNVVCKMTYSRGSTHLPASEAAPSQYLCPYD 723
             CDC+MDWL  INN T+    RQ+P++MD+ N+ C M ++RG+   P S   P  +LC Y+
Sbjct:   720 CDCTMDWLQRINNLTT----RQHPRVMDMANIECVMPHARGAAVRPLSGLRPQDFLCRYE 775

Query:   724 IHCFALCHCCEFDACDCEMTCPKNCSCFHDQNWNTNVVDCSEQQISTVPPRIPMDATHVY 783
              HCFALCHCC+FDACDCEMTCP NC+C+HDQ W+TNVVDC  QQ + +P R+PMD++ VY
Sbjct:   776 SHCFALCHCCDFDACDCEMTCPSNCTCYHDQIWSTNVVDCGGQQTTELPRRVPMDSSVVY 835

Query:   784 LDGNTFKTIPNHVFIGRKNMLSLYVNNSQIEVILNQTFNGLSSLQVLHLENNLITHFYGY 843
             LDGN F  + NH FIGRKN+ +LYVN SQ+  I N+TF  L+SLQ+LHL +N +   +GY
Sbjct:   836 LDGNNFPVLKNHAFIGRKNLRALYVNGSQVAAIQNRTFASLASLQLLHLADNKLRTLHGY 895

Query:   844 EFDNLEKLSELYLQENRIEYIANGTFNALISLQVLQLDGNRLKSFRAFDLNTN---SMLR 900
             EF+ L  L ELYLQ N++  I N T   L +L+++++DGNRL +   + ++     + L+
Sbjct:   896 EFEQLSALRELYLQNNQLTTIENATLAPLAALELIRIDGNRLVTLPIWQMHATHFGTRLK 955

Query:   901 KVYLGNNPFSCSCATLQELQTWIIDNSNKVKDGLDISCV----------IDESSPPI--- 947
              + LG N +SC C  LQ L +++ DN+  V+D  DI C+          +++SS      
Sbjct:   956 SISLGRNQWSCRCQFLQALTSYVADNALIVQDAQDIYCMAASSGTGSAALEDSSSNSGSL 1015

Query:   948 -RKEIDLNST--TCTEYYATSSVIASIMVSDYLPXXXXXXXXXXXXXXXXXXXXXXKDPF 1004
              ++E+D N+T   CT+YY+  S++   +   Y+P                      ++  
Sbjct:  1016 EKRELDFNATGAACTDYYSGGSMLQHGIPESYIPLLAAALALLFLLVVIAMVFAF-RESL 1074

Query:  1005 RVWLYTKYGIRLFNFKATSSKHFGEDREKL--PKDEEFVLQSIVAELEHGNPSYQLCLHY 1062
             R+WL+  YG+R+F  +   S+    D   L   KD EFV Q + A+LE G P  ++CL +
Sbjct:  1075 RIWLFAHYGVRVFGPRCEESEKL-YDAVLLHSAKDSEFVCQHLAAQLETGRPPLRVCLQH 1133

Query:  1063 RDLPHHSPYLQQHTTSPVVIEAAEASRRVILVLTKNFLQTEWSRSDFLIEAAEASR 1118
             RDL H + + Q       ++EA   SRRV+++LT+NFLQTEW+R +      +A R
Sbjct:  1134 RDLAHDATHYQ-------LLEATRVSRRVVILLTRNFLQTEWARCELRRSVHDALR 1182


GO:0005886 "plasma membrane" evidence=NAS
GO:0004888 "transmembrane signaling receptor activity" evidence=ISS;NAS
GO:0006952 "defense response" evidence=NAS
GO:0016021 "integral to membrane" evidence=ISS
GO:0007165 "signal transduction" evidence=IEA;ISS
GO:0002752 "cell surface pattern recognition receptor signaling pathway" evidence=IC
GO:0008329 "pattern recognition receptor activity" evidence=IC
GO:0051607 "defense response to virus" evidence=IMP
GO:0046790 "virion binding" evidence=IDA
GO:0009897 "external side of plasma membrane" evidence=IDA
GO:0010508 "positive regulation of autophagy" evidence=IMP
FB|FBgn0004364 18w "18 wheeler" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0036494 Toll-6 "Toll-6" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0029114 Tollo "Tollo" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00006593 tol-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0262473 Tl "Toll" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030722-3 slit1a "slit homolog 1a (Drosophila)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1315202 Slit3 "slit homolog 3 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|O75094 SLIT3 "Slit homolog 3 protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3KNP3 SLIT3 "Slit homolog 3 protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1344
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-17
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-17
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-17
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-15
pfam01582135 pfam01582, TIR, TIR domain 4e-15
smart00255140 smart00255, TIR, Toll - interleukin 1 - resistance 3e-13
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-12
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-11
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-10
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-07
pfam13306128 pfam13306, LRR_5, Leucine rich repeats (6 copies) 8e-07
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 9e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-06
pfam13306128 pfam13306, LRR_5, Leucine rich repeats (6 copies) 9e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-05
smart0001333 smart00013, LRRNT, Leucine rich repeat N-terminal 5e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 2e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.001
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score = 89.1 bits (221), Expect = 1e-17
 Identities = 128/456 (28%), Positives = 195/456 (42%), Gaps = 81/456 (17%)

Query: 66  SFQNIYSLEELKISNCKLV-ELPVDVFSGLRNLKRLTINTRNLQWDKSKK---------L 115
           S  N+ SLE L +++ +LV ++P ++   +++LK + +   NL  +   +         L
Sbjct: 183 SLTNLTSLEFLTLASNQLVGQIPREL-GQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHL 241

Query: 116 DLV--------PGSLDGLRELQVLNISSSNIK-SISDDVFCSLANIQTLNLSRNSIRDID 166
           DLV        P SL  L+ LQ L +  + +   I   +F SL  + +L+LS NS+    
Sbjct: 242 DLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIF-SLQKLISLDLSDNSL---- 296

Query: 167 TLGFAVRRASAESNSGEKIECSGGM-DLRILDLSHNKLRTLGDYSGITKFRRLQNLHLEN 225
                         SGE  E    + +L IL L  N   T      +T   RLQ L L +
Sbjct: 297 --------------SGEIPELVIQLQNLEILHLFSNNF-TGKIPVALTSLPRLQVLQLWS 341

Query: 226 NEISQIAPNAFVALSSLRILNISSNHLVS-LPEGLFSSCRDISEIYAQKNSL---VELSR 281
           N+ S   P      ++L +L++S+N+L   +PEGL SS   + ++    NSL   +  S 
Sbjct: 342 NKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGN-LFKLILFSNSLEGEIPKSL 400

Query: 282 GLFHKLEQLLVLDLSSNHLSSNHIDETTFIGLIRLIILNLSNNELT-RIDAKTFKDLVFL 340
           G    L ++    L  N  S     E T + L+    L++SNN L  RI+++ + D+  L
Sbjct: 401 GACRSLRRV---RLQDNSFSGELPSEFTKLPLVYF--LDISNNNLQGRINSRKW-DMPSL 454

Query: 341 QRLDL-RNNSIGYIEDNAFLSLYNLHTIYLSENRIHHITAHLFNGLYVLSKLTLSNNLLV 399
           Q L L RN   G + D                            G   L  L LS N   
Sbjct: 455 QMLSLARNKFFGGLPD--------------------------SFGSKRLENLDLSRNQFS 488

Query: 400 NIDSKAFKNCSALKELDLSSNAIV-EIPSALSELPFLKTLDLGENQISKIENGSFKNLQQ 458
               +   + S L +L LS N +  EIP  LS    L +LDL  NQ+S     SF  +  
Sbjct: 489 GAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPV 548

Query: 459 LTDLRLVDNNIGNLSSGMLYELPSLEVLNLSKNKIH 494
           L+ L L  N +       L  + SL  +N+S N +H
Sbjct: 549 LSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLH 584


Length = 968

>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|216585 pfam01582, TIR, TIR domain Back     alignment and domain information
>gnl|CDD|214587 smart00255, TIR, Toll - interleukin 1 - resistance Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205486 pfam13306, LRR_5, Leucine rich repeats (6 copies) Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205486 pfam13306, LRR_5, Leucine rich repeats (6 copies) Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|214470 smart00013, LRRNT, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1344
PLN00113968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194|consensus873 100.0
KOG4194|consensus873 100.0
KOG4237|consensus498 100.0
KOG0472|consensus565 99.97
KOG0472|consensus565 99.97
KOG0618|consensus1081 99.96
KOG0618|consensus1081 99.96
KOG0444|consensus1255 99.94
KOG4237|consensus498 99.94
KOG0444|consensus1255 99.94
PF01582141 TIR: TIR domain; InterPro: IPR000157 In Drosophila 99.86
PLN032101153 Resistant to P. syringae 6; Provisional 99.84
PLN032101153 Resistant to P. syringae 6; Provisional 99.83
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.8
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.79
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.69
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.67
smart00255140 TIR Toll - interleukin 1 - resistance. 99.63
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.54
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.52
KOG0617|consensus264 99.37
KOG0617|consensus264 99.28
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.17
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.15
KOG1909|consensus382 99.02
KOG3207|consensus505 98.94
KOG1259|consensus490 98.91
KOG3207|consensus505 98.91
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.89
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.85
KOG0531|consensus414 98.84
KOG1909|consensus382 98.84
PLN03150623 hypothetical protein; Provisional 98.84
KOG0531|consensus414 98.83
KOG0532|consensus722 98.8
KOG1259|consensus490 98.78
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.77
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.76
KOG0532|consensus722 98.7
KOG4658|consensus889 98.68
KOG4658|consensus889 98.51
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 98.16
KOG2120|consensus419 98.15
PLN03150623 hypothetical protein; Provisional 98.12
PF13676102 TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_ 98.1
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.09
KOG1859|consensus1096 98.09
KOG1644|consensus233 98.06
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.01
KOG1859|consensus 1096 97.97
PLN03194187 putative disease resistance protein; Provisional 97.97
PRK15386426 type III secretion protein GogB; Provisional 97.91
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.86
KOG1644|consensus233 97.82
KOG2120|consensus419 97.81
KOG4579|consensus177 97.81
KOG2982|consensus418 97.8
KOG2982|consensus418 97.76
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.68
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.66
KOG4579|consensus177 97.61
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.54
KOG4341|consensus483 97.48
PRK15386426 type III secretion protein GogB; Provisional 97.41
smart0008251 LRRCT Leucine rich repeat C-terminal domain. 97.38
KOG4341|consensus483 97.32
KOG3665|consensus699 97.29
KOG2123|consensus388 97.09
KOG3665|consensus699 97.03
PF01582141 TIR: TIR domain; InterPro: IPR000157 In Drosophila 96.58
KOG2123|consensus388 96.35
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 96.08
KOG2739|consensus260 95.98
KOG2739|consensus260 95.97
smart0001333 LRRNT Leucine rich repeat N-terminal domain. 95.96
KOG1947|consensus482 95.93
KOG1947|consensus482 95.3
smart00255140 TIR Toll - interleukin 1 - resistance. 95.23
PF0146228 LRRNT: Leucine rich repeat N-terminal domain; Inte 94.57
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.06
smart0008251 LRRCT Leucine rich repeat C-terminal domain. 92.82
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 92.65
KOG3678|consensus832 92.0
smart0037026 LRR Leucine-rich repeats, outliers. 91.45
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.45
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.57
smart0037026 LRR Leucine-rich repeats, outliers. 89.57
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 89.07
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 88.87
KOG4308|consensus478 88.54
KOG4308|consensus478 86.87
KOG0473|consensus326 86.22
KOG3864|consensus221 85.69
PLN03194187 putative disease resistance protein; Provisional 83.35
PF08937130 DUF1863: MTH538 TIR-like domain (DUF1863); InterPr 83.34
PF13676102 TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_ 83.09
KOG0473|consensus326 81.73
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=4.6e-46  Score=499.53  Aligned_cols=319  Identities=28%  Similarity=0.301  Sum_probs=139.1

Q ss_pred             CcccEEECCCCCCCCCCCCccCCCCCCCCEEEccCCCCCCcChhhh-cCCCCccEEEeeCCCCCC-CChhhhcCCCCCcE
Q psy16377        191 MDLRILDLSHNKLRTLGDYSGITKFRRLQNLHLENNEISQIAPNAF-VALSSLRILNISSNHLVS-LPEGLFSSCRDISE  268 (1344)
Q Consensus       191 ~~L~~LdLs~n~l~~l~~~~~l~~l~~L~~L~Ls~n~i~~~~~~~~-~~l~~L~~L~Ls~n~l~~-l~~~~f~~l~~L~~  268 (1344)
                      .+++.|+|++|.+++..+. .+..+++|+.|+|++|.+.+..|..+ .++++|++|+|++|.+.. +|.           
T Consensus        69 ~~v~~L~L~~~~i~~~~~~-~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~-----------  136 (968)
T PLN00113         69 SRVVSIDLSGKNISGKISS-AIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR-----------  136 (968)
T ss_pred             CcEEEEEecCCCccccCCh-HHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc-----------
Confidence            4455555555555443332 44555555555555555543333322 245555555555554432 221           


Q ss_pred             EEcccCcccccChhhhcCCCCCCEEEccCCCCCCCCCCcccccCCCcccEEEccCCCCCccccccccCCCcccEEEecCC
Q psy16377        269 IYAQKNSLVELSRGLFHKLEQLLVLDLSSNHLSSNHIDETTFIGLIRLIILNLSNNELTRIDAKTFKDLVFLQRLDLRNN  348 (1344)
Q Consensus       269 L~L~~n~l~~l~~~~~~~l~~L~~L~Ls~n~l~~~~i~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n  348 (1344)
                                      ..+++|++|+|++|.+.+  ..+..+..+++|++|++++|.+.+..+..+.++++|+.|++++|
T Consensus       137 ----------------~~l~~L~~L~Ls~n~~~~--~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n  198 (968)
T PLN00113        137 ----------------GSIPNLETLDLSNNMLSG--EIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASN  198 (968)
T ss_pred             ----------------cccCCCCEEECcCCcccc--cCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCC
Confidence                            223444444444444432  11233344444444444444444333334444444444444444


Q ss_pred             CccccchhhhcCCCCccEEEccCCcccccccccccCCCceeEEEccCCcCCCCChhhhcCCCCCcEEEccCCCCC-ccch
Q psy16377        349 SIGYIEDNAFLSLYNLHTIYLSENRIHHITAHLFNGLYVLSKLTLSNNLLVNIDSKAFKNCSALKELDLSSNAIV-EIPS  427 (1344)
Q Consensus       349 ~l~~i~~~~f~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~-~lp~  427 (1344)
                      .+....+..+..+++|+.|++++|.+.+..+..+.++++|+.|++++|.+.+..+..|.++++|+.|++++|.+. .+|.
T Consensus       199 ~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~  278 (968)
T PLN00113        199 QLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPP  278 (968)
T ss_pred             CCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCch
Confidence            443333333444444444444444444444444444444444444444444444444444444444444444443 3344


Q ss_pred             hhcCCCCccEEEccCCCCCccCcchhcCCCCCcEEEcccCCCCCCCcccccCCCCccEEEcCCCcCcccccccccCCCcc
Q psy16377        428 ALSELPFLKTLDLGENQISKIENGSFKNLQQLTDLRLVDNNIGNLSSGMLYELPSLEVLNLSKNKIHQIEIGTFEKNKRL  507 (1344)
Q Consensus       428 ~l~~l~~L~~L~Ls~n~i~~~~~~~~~~l~~L~~L~L~~n~l~~l~~~~~~~l~~L~~L~Ls~n~i~~~~~~~~~~l~~L  507 (1344)
                      .+..+++|++|++++|.+.+..+..+.++++|+.|++++|.+....+..+..+++|+.|++++|.+....+..+..+++|
T Consensus       279 ~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L  358 (968)
T PLN00113        279 SIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNL  358 (968)
T ss_pred             hHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCC
Confidence            44444444444444444444444444444444444444444432222234444444444444444443333334444444


Q ss_pred             ceEeccccCCC-ChhhHhhcCCCCcEEEcCCCC
Q psy16377        508 AAIRLDSNFLT-DINGVFTYLAQLLWLNLSENH  539 (1344)
Q Consensus       508 ~~L~L~~n~l~-~l~~~~~~l~~L~~L~Ls~n~  539 (1344)
                      +.|++++|.++ .+|..+..+++|+.|++++|+
T Consensus       359 ~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~  391 (968)
T PLN00113        359 TVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNS  391 (968)
T ss_pred             cEEECCCCeeEeeCChhHhCcCCCCEEECcCCE
Confidence            44444444433 123333333444444444433



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>PF01582 TIR: TIR domain; InterPro: IPR000157 In Drosophila melanogaster the Toll protein is involved in establishment of dorso-ventral polarity in the embryo Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>smart00255 TIR Toll - interleukin 1 - resistance Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13676 TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_A 3UB2_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>PLN03194 putative disease resistance protein; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>smart00082 LRRCT Leucine rich repeat C-terminal domain Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>PF01582 TIR: TIR domain; InterPro: IPR000157 In Drosophila melanogaster the Toll protein is involved in establishment of dorso-ventral polarity in the embryo Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>smart00013 LRRNT Leucine rich repeat N-terminal domain Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>smart00255 TIR Toll - interleukin 1 - resistance Back     alignment and domain information
>PF01462 LRRNT: Leucine rich repeat N-terminal domain; InterPro: IPR000372 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00082 LRRCT Leucine rich repeat C-terminal domain Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3678|consensus Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>PLN03194 putative disease resistance protein; Provisional Back     alignment and domain information
>PF08937 DUF1863: MTH538 TIR-like domain (DUF1863); InterPro: IPR015032 This protein adopts the flavodoxin fold, that is, five parallel beta-strands and four helical segments Back     alignment and domain information
>PF13676 TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_A 3UB2_A Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1344
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 2e-23
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 1e-19
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 2e-19
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 2e-09
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 3e-07
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 2e-19
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 3e-09
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 3e-07
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 1e-18
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 6e-18
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 6e-18
3zyi_A452 Netring2 In Complex With Ngl2 Length = 452 3e-17
3zyi_A452 Netring2 In Complex With Ngl2 Length = 452 2e-11
3zyi_A452 Netring2 In Complex With Ngl2 Length = 452 4e-10
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 8e-17
3zyj_A440 Netring1 In Complex With Ngl1 Length = 440 1e-16
3zyj_A440 Netring1 In Complex With Ngl1 Length = 440 1e-08
3zyj_A440 Netring1 In Complex With Ngl1 Length = 440 6e-08
3zyo_A411 Crystal Structure Of The N-Terminal Leucine Rich Re 2e-16
3zyo_A411 Crystal Structure Of The N-Terminal Leucine Rich Re 1e-11
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 2e-16
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 8e-12
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 5e-15
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 2e-14
2v9s_A220 Second Lrr Domain Of Human Slit2 Length = 220 2e-14
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 2e-14
2v9t_B220 Complex Between The Second Lrr Domain Of Slit2 And 2e-14
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 5e-14
2xot_A361 Crystal Structure Of Neuronal Leucine Rich Repeat P 8e-14
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 2e-13
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 7e-05
2v70_A220 Third Lrr Domain Of Human Slit2 Length = 220 3e-13
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 4e-13
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 2e-12
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 2e-12
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 7e-12
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 2e-12
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 7e-12
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 6e-12
3j0a_A844 Homology Model Of Human Toll-Like Receptor 5 Fitted 6e-12
3j0a_A844 Homology Model Of Human Toll-Like Receptor 5 Fitted 1e-09
3j0a_A844 Homology Model Of Human Toll-Like Receptor 5 Fitted 6e-06
2r9u_A174 Crystal Structure Of Lamprey Variable Lymphocyte Re 5e-11
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 6e-11
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 1e-08
3g3b_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 1e-10
3g39_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 1e-10
3g3a_A178 Structure Of A Lamprey Variable Lymphocyte Receptor 5e-10
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 5e-10
3ula_A279 Crystal Structure Of The Tv3 Mutant F63w-Md-2-Erito 7e-10
3ula_A279 Crystal Structure Of The Tv3 Mutant F63w-Md-2-Erito 3e-08
3ul7_A278 Crystal Structure Of The Tv3 Mutant F63w Length = 2 7e-10
3ul7_A278 Crystal Structure Of The Tv3 Mutant F63w Length = 2 3e-08
3ul9_A278 Structure Of The Tv3 Mutant M41e Length = 278 8e-10
3ul9_A278 Structure Of The Tv3 Mutant M41e Length = 278 4e-08
3twi_D179 Variable Lymphocyte Receptor Recognition Of The Imm 8e-10
2z62_A276 Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 A 8e-10
2z62_A276 Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 A 4e-08
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 9e-10
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 1e-09
3ul8_A279 Crystal Structure Of The Tv3 Mutant V134l Length = 1e-09
3ul8_A279 Crystal Structure Of The Tv3 Mutant V134l Length = 5e-08
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 1e-09
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 3e-09
3oja_B597 Crystal Structure Of Lrim1APL1C COMPLEX Length = 59 6e-09
3oja_B597 Crystal Structure Of Lrim1APL1C COMPLEX Length = 59 7e-04
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 6e-09
1w8a_A192 Third Lrr Domain Of Drosophila Slit Length = 192 6e-09
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 7e-09
3o6n_A390 Crystal Structure Of Apl1 Leucine-Rich Repeat Domai 1e-08
3o6n_A390 Crystal Structure Of Apl1 Leucine-Rich Repeat Domai 9e-04
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 3e-08
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 1e-06
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 3e-08
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 3e-06
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 4e-08
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 3e-06
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 4e-08
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 3e-06
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 5e-08
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 2e-05
3b2d_A603 Crystal Structure Of Human Rp105MD-1 Complex Length 6e-08
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 6e-08
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 2e-05
3v44_A407 Crystal Structure Of The N-Terminal Fragment Of Zeb 6e-08
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 7e-08
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 2e-05
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 7e-08
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 3e-05
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 7e-08
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 2e-05
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 8e-08
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 2e-05
4arn_A279 Crystal Structure Of The N-terminal Domain Of Droso 9e-08
2a0z_A705 The Molecular Structure Of Toll-like Receptor 3 Lig 9e-08
3cig_A697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 9e-08
3ulu_A694 Structure Of Quaternary Complex Of Human Tlr3ecd Wi 1e-07
1ziw_A680 Human Toll-Like Receptor 3 Extracellular Domain Str 1e-07
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 1e-07
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 5e-07
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 2e-07
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 6e-07
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 4e-07
3t6q_A606 Crystal Structure Of Mouse Rp105MD-1 Complex Length 4e-07
3a79_A580 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 2e-06
2z81_A549 Crystal Structure Of The Tlr1-tlr2 Heterodimer Indu 2e-06
3rg1_A612 Crystal Structure Of The Rp105MD-1 Complex Length = 3e-06
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 4e-06
2z80_A353 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 8e-06
2z80_A353 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 1e-04
1o77_A146 Crystal Structure Of The C713s Mutant Of The Tir Do 1e-05
2z7x_A549 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 1e-05
2z7x_A549 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 1e-04
1fyx_A149 Crystal Structure Of P681h Mutant Of Tir Domain Of 8e-05
4fmz_A347 Crystal Structure Of An Internalin (Inlf) From List 1e-04
2z64_A599 Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Comp 2e-04
3vq1_A606 Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLE 2e-04
4fho_A231 Crystal Structure Of An Internalin C2 (Inlc2) From 7e-04
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure

Iteration: 1

Score = 108 bits (269), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 60/189 (31%), Positives = 104/189 (55%), Gaps = 6/189 (3%) Query: 744 CPKNCSCFHDQNWNTNVVDCSEQQISTVPPRIPMDATHVYLDGNTFKTIPNHVFIGRKNM 803 CP CSC + V+C Q ++VP IP T++ L+ N+ K++PN VF ++ Sbjct: 1 CPSRCSC------SGTTVECYSQGRTSVPTGIPAQTTYLDLETNSLKSLPNGVFDELTSL 54 Query: 804 LSLYVNNSQIEVILNQTFNGLSSLQVLHLENNLITHFYGYEFDNLEKLSELYLQENRIEY 863 LY+ ++++ + N FN L+SL L+L N + FD L +L EL L N+++ Sbjct: 55 TQLYLGGNKLQSLPNGVFNKLTSLTYLNLSTNQLQSLPNGVFDKLTQLKELALNTNQLQS 114 Query: 864 IANGTFNALISLQVLQLDGNRLKSFRAFDLNTNSMLRKVYLGNNPFSCSCATLQELQTWI 923 + +G F+ L L+ L+L N+LKS + + L+ ++L +NP+ C+C ++ L WI Sbjct: 115 LPDGVFDKLTQLKDLRLYQNQLKSVPDGVFDRLTSLQYIWLHDNPWDCTCPGIRYLSEWI 174 Query: 924 IDNSNKVKD 932 +S V++ Sbjct: 175 NKHSGVVRN 183
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|2V9S|A Chain A, Second Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|2V9T|B Chain B, Complex Between The Second Lrr Domain Of Slit2 And The First Ig Domain From Robo1 Length = 220 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|2XOT|A Chain A, Crystal Structure Of Neuronal Leucine Rich Repeat Protein Amigo-1 Length = 361 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|2V70|A Chain A, Third Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|2R9U|A Chain A, Crystal Structure Of Lamprey Variable Lymphocyte Receptor 2913 Ectodomain Length = 174 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|3G3B|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Mutant In Complex With A Protein Antigen Length = 170 Back     alignment and structure
>pdb|3G39|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Length = 170 Back     alignment and structure
>pdb|3G3A|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor In Complex With A Protein Antigen Length = 178 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|3ULA|A Chain A, Crystal Structure Of The Tv3 Mutant F63w-Md-2-Eritoran Complex Length = 279 Back     alignment and structure
>pdb|3ULA|A Chain A, Crystal Structure Of The Tv3 Mutant F63w-Md-2-Eritoran Complex Length = 279 Back     alignment and structure
>pdb|3UL7|A Chain A, Crystal Structure Of The Tv3 Mutant F63w Length = 278 Back     alignment and structure
>pdb|3UL7|A Chain A, Crystal Structure Of The Tv3 Mutant F63w Length = 278 Back     alignment and structure
>pdb|3UL9|A Chain A, Structure Of The Tv3 Mutant M41e Length = 278 Back     alignment and structure
>pdb|3UL9|A Chain A, Structure Of The Tv3 Mutant M41e Length = 278 Back     alignment and structure
>pdb|3TWI|D Chain D, Variable Lymphocyte Receptor Recognition Of The Immunodominant Glycoprotein Of Bacillus Anthracis Spores Length = 179 Back     alignment and structure
>pdb|2Z62|A Chain A, Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 276 Back     alignment and structure
>pdb|2Z62|A Chain A, Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 276 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|3UL8|A Chain A, Crystal Structure Of The Tv3 Mutant V134l Length = 279 Back     alignment and structure
>pdb|3UL8|A Chain A, Crystal Structure Of The Tv3 Mutant V134l Length = 279 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|3OJA|B Chain B, Crystal Structure Of Lrim1APL1C COMPLEX Length = 597 Back     alignment and structure
>pdb|3OJA|B Chain B, Crystal Structure Of Lrim1APL1C COMPLEX Length = 597 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|1W8A|A Chain A, Third Lrr Domain Of Drosophila Slit Length = 192 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|3O6N|A Chain A, Crystal Structure Of Apl1 Leucine-Rich Repeat Domain Length = 390 Back     alignment and structure
>pdb|3O6N|A Chain A, Crystal Structure Of Apl1 Leucine-Rich Repeat Domain Length = 390 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|3V44|A Chain A, Crystal Structure Of The N-Terminal Fragment Of Zebrafish Tlr5 Length = 407 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|4ARN|A Chain A, Crystal Structure Of The N-terminal Domain Of Drosophila Toll Receptor Length = 279 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|3ULU|A Chain A, Structure Of Quaternary Complex Of Human Tlr3ecd With Three Fabs (Form1) Length = 694 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|3T6Q|A Chain A, Crystal Structure Of Mouse Rp105MD-1 Complex Length = 606 Back     alignment and structure
>pdb|3A79|A Chain A, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 580 Back     alignment and structure
>pdb|2Z81|A Chain A, Crystal Structure Of The Tlr1-tlr2 Heterodimer Induced By Binding Of A Tri-acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure
>pdb|2Z80|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 353 Back     alignment and structure
>pdb|2Z80|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 353 Back     alignment and structure
>pdb|1O77|A Chain A, Crystal Structure Of The C713s Mutant Of The Tir Domain Of Human Tlr2 Length = 146 Back     alignment and structure
>pdb|2Z7X|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|2Z7X|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|1FYX|A Chain A, Crystal Structure Of P681h Mutant Of Tir Domain Of Human Tlr2 Length = 149 Back     alignment and structure
>pdb|4FMZ|A Chain A, Crystal Structure Of An Internalin (Inlf) From Listeria Monocytogenes Str. 4b F2365 At 1.91 A Resolution Length = 347 Back     alignment and structure
>pdb|2Z64|A Chain A, Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Complex Length = 599 Back     alignment and structure
>pdb|3VQ1|A Chain A, Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLEX Length = 606 Back     alignment and structure
>pdb|4FHO|A Chain A, Crystal Structure Of An Internalin C2 (Inlc2) From Listeria Monocytogenes Str. 4b F2365 At 1.90 A Resolution Length = 231 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1344
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-117
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-98
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-70
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-56
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-39
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-20
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-112
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-30
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-24
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-111
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-62
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-29
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-25
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-90
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-89
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-65
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-59
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-53
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-26
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-90
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-62
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-45
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-85
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-64
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-47
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-35
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-27
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-22
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-84
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-79
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-71
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-67
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-66
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-53
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-35
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-21
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-80
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-78
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-75
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-26
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-76
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-63
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-51
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-74
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-65
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-47
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-44
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-35
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-33
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-73
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-70
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-65
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-54
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-69
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-50
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-47
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-35
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-31
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-22
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 9e-69
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-64
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-61
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-58
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-54
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-21
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-67
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-60
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-56
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-54
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-46
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-31
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-17
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-67
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-57
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-52
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-43
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-33
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-66
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-58
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-55
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-51
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-44
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-42
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-12
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-62
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-61
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-60
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-51
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-39
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-61
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-53
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-48
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-46
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-60
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-56
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-55
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-44
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-40
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-39
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-36
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-26
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-25
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-56
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-55
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-44
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-40
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-39
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-36
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-27
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-26
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-55
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-51
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-49
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-42
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-33
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-30
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-54
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-50
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-48
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-47
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-34
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-29
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-54
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-53
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-43
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-34
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-28
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-24
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-53
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-46
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-36
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-33
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-53
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-51
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-49
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-49
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-40
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-50
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-42
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-40
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-35
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-33
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-49
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-48
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-39
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-37
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-47
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-42
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-41
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-20
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-43
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-42
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-41
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-34
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-32
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-29
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-27
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-27
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-42
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-42
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-42
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-40
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-39
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-34
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-40
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-28
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-26
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-25
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-24
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-15
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-15
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-14
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-14
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-40
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-26
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-25
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-24
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-23
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-17
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-40
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-39
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-31
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-31
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-29
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-23
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-16
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-40
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-36
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-35
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-29
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-26
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-25
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-25
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-24
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-22
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-19
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-38
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-37
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-33
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-33
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-27
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-25
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-22
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-37
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-32
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-31
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-31
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-27
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-27
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-19
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-18
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-37
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-35
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-32
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-17
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-10
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-35
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-19
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-16
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-14
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-14
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-14
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-14
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-34
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-34
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-33
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-29
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-28
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-34
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-33
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-29
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-28
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-24
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-34
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-34
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-32
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-30
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-27
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-34
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-23
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-23
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-23
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-21
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-18
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-16
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-34
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-29
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-27
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 7e-08
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-32
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-17
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-15
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-13
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-12
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-11
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-11
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-32
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-18
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-17
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-13
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-13
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-12
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-12
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-30
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-27
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-18
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-16
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-29
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-16
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-15
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-13
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-13
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-12
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-11
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-10
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-29
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-14
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-13
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-12
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 9e-12
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-10
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-10
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-10
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-10
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 6e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-29
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-24
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-23
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 8e-20
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-18
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-12
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-08
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-28
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-24
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-23
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-21
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-06
2js7_A160 Myeloid differentiation primary response protein M 6e-28
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-27
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-23
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-22
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-06
1fyx_A149 TOLL-like receptor 2; beta-alpha-beta fold, signal 4e-27
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-25
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-24
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-21
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-20
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-25
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-23
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-21
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-21
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-20
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-20
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-18
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-16
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-05
2j67_A178 TOLL like receptor 10; TIR, IL-1, TLR10, membrane, 6e-25
3ub2_A146 TOLL/interleukin-1 receptor domain-containing ADA 2e-24
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-23
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-22
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-16
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-15
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-13
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-22
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-09
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-07
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 5e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-04
1t3g_A159 X-linked interleukin-1 receptor accessory protein- 1e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-22
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-09
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 5e-08
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 6e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 7e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-21
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-18
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-17
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-15
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-14
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-21
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-18
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-18
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-17
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-13
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-18
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-18
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-10
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-18
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-16
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-16
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-15
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-14
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-13
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-12
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-11
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-17
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-14
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-13
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-12
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-12
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-11
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-15
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 7e-13
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-15
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-14
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-11
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-14
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-14
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-12
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-11
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-10
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-13
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-10
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-08
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 4e-08
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 9e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-12
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-09
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 4e-12
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 4e-12
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-10
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
4fdw_A401 Leucine rich hypothetical protein; putative cell s 2e-10
4fdw_A401 Leucine rich hypothetical protein; putative cell s 8e-09
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 3e-08
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 2e-07
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 4e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 5e-06
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 3e-05
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 4e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 3e-04
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
 Score =  385 bits (991), Expect = e-117
 Identities = 169/984 (17%), Positives = 328/984 (33%), Gaps = 192/984 (19%)

Query: 292  VLDLSSNHLSSNHIDETTFIGLIRLIILNLSNNELTRIDAKTFKDLVFLQRLDLRNNSIG 351
            +      +L+           L     L LS N +  + A +F  L  LQ L+L +    
Sbjct: 8    IAFYRFCNLTQ------VPQVLNTTERLLLSFNYIRTVTASSFPFLEQLQLLELGSQYTP 61

Query: 352  Y-IEDNAFLSLYNLHTIYLSENRIHHITAHLFNGLYVLSKLTLSNNLL--VNIDSKAFKN 408
              I+  AF +L NL  + L  ++I+ +    F GL+ L +L L    L    +    F+N
Sbjct: 62   LTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFHLFELRLYFCGLSDAVLKDGYFRN 121

Query: 409  CSALKELDLSSNAI--VEIPSALSELPFLKTLDLGENQISKIENGSFKNLQQ--LTDLRL 464
              AL  LDLS N I  + +  +  +L  LK++D   NQI  +     + LQ   L+   L
Sbjct: 122  LKALTRLDLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQIFLVCEHELEPLQGKTLSFFSL 181

Query: 465  VDNNIGNLSSGMLYELP------SLEVLNLSKNKIHQIEIGTFEKNKRLAAIRLDSNFLT 518
              N++ +  S    +         LE+L++S N       G F            SN ++
Sbjct: 182  AANSLYSRVSVDWGKCMNPFRNMVLEILDVSGNGWTVDITGNF------------SNAIS 229

Query: 519  DIN-GVFTYLAQLLWLNLSENHLVWFDYAMVPGNLKWLDIHGNYISSLNNYYEIKDGLSI 577
                        ++      +++               D   N  + L          S+
Sbjct: 230  KSQAFSLILAHHIMGAGFGFHNIK--------------DPDQNTFAGLAR-------SSV 268

Query: 578  KNLDASHNRILEISELSIPN--SVEVLFINNNLIKSVKPHTFFDKSNLARVDIYANDITK 635
            ++LD SH  +  ++         ++VL +  N I  +    F+   NL  +++  N + +
Sbjct: 269  RHLDLSHGFVFSLNSRVFETLKDLKVLNLAYNKINKIADEAFYGLDNLQVLNLSYNLLGE 328

Query: 636  LDLTALRLKPVPQNKTLPEFYLGGNPFDCDCSMDWLPIINNNTSPSMERQYPKIMDLDNV 695
            L  +            +    L  N          + II + T   +     K+  LD  
Sbjct: 329  LYSSNFY-----GLPKVAYIDLQKNH---------IAIIQDQTFKFL----EKLQTLDLR 370

Query: 696  VCKMTYSRGSTHLPASEAAPSQYLCPYDIHCFALCHCCEFDACDCEMTCPKNCSCFHDQN 755
               +T       +P        +L                                   N
Sbjct: 371  DNALTTIHFIPSIP------DIFLSG------------------------NKLVTLPKIN 400

Query: 756  WNTNVVDCSEQQISTVPPRIPMDA----THVYLDGNTFKTIP-NHVFIGRKNMLSLYVNN 810
               N++  SE ++  +     +        + L+ N F +   +       ++  L++  
Sbjct: 401  LTANLIHLSENRLENLDILYFLLRVPHLQILILNQNRFSSCSGDQTPSENPSLEQLFLGE 460

Query: 811  SQIEV-----ILNQTFNGLSSLQVLHLENNLITHFYGYEFDNLEKLSELYLQENRIEYIA 865
            + +++     +    F GLS LQVL+L +N +       F +L  L  L L  NR+  ++
Sbjct: 461  NMLQLAWETELCWDVFEGLSHLQVLYLNHNYLNSLPPGVFSHLTALRGLSLNSNRLTVLS 520

Query: 866  NGTFNALISLQVLQLDGNRLKSFRAFDLNTNSMLRKVYLGNNPFSCSCATLQELQTWIID 925
            +       +L++L +  N+L +    + +    L  + + +N F C C  L     W+  
Sbjct: 521  HNDL--PANLEILDISRNQLLA---PNPDVFVSLSVLDITHNKFICECE-LSTFINWLNH 574

Query: 926  NSNKVKDGLDISCVIDESSPPIRKEIDLNSTTCTEYYATSSVIASIMVSDYLPFMIITFL 985
             +  +         +   S        L++  C E     S+  S+         I+  +
Sbjct: 575  TNVTIAGPPADIYCVYPDSFSGVSLFSLSTEGCDEEEVLKSLKFSL--------FIVCTV 626

Query: 986  MFLVFLILIIFMFVFKDPFRVWLYTKYGIRLFNFKATSSKHFGEDREKL--------PKD 1037
               +FL+ I+ +  F+     ++  K   RL            E              KD
Sbjct: 627  TLTLFLMTILTVTKFRG--FCFICYKTAQRLVFKDHPQGT---EPDMYKYDAYLCFSSKD 681

Query: 1038 EEFVLQSIVAELE---HGNPSYQLCLHYRDLPHHSPYLQQHTTSPVVIEAAEASRRVILV 1094
              +V  +++  L+        + LC   RD       +                      
Sbjct: 682  FTWVQNALLKHLDTQYSDQNRFNLCFEERDFVPGENRIAN-------------------- 721

Query: 1095 LTKNFLQTEWSRSDFLIEAAEASRRVILVLTKNFLQTEWSRSDFRSAIHEALTTKTHKLV 1154
                           + +A   SR+++ +++++FL+  W    F  A    L+     L+
Sbjct: 722  ---------------IQDAIWNSRKIVCLVSRHFLRDGWCLEAFSYAQGRCLSDLNSALI 766

Query: 1155 LV-EENIVPEAES-DIELKPYLKSCMKIRWGEKR-----FWERLRYAMPTCDNSKKSCNY 1207
            +V   ++          ++ +++    +RW E       F  +L   +   +        
Sbjct: 767  MVVVGSLSQYQLMKHQSIRGFVQKQQYLRWPEDFQDVGWFLHKLSQQILKKEKE------ 820

Query: 1208 RRNINNYTIDSGTGRRSIEAHHTH 1231
            ++  NN  + +     S   HH H
Sbjct: 821  KKKDNNIPLQTVAT-ISGSHHHHH 843


>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2js7_A Myeloid differentiation primary response protein MYD88; MYD88_human, TIR domain, TOLL like receptor adaptor domain, innate immune signaling; NMR {Homo sapiens} PDB: 2z5v_A Length = 160 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1fyx_A TOLL-like receptor 2; beta-alpha-beta fold, signaling protein; 2.80A {Homo sapiens} SCOP: c.23.2.1 PDB: 1fyw_A 1o77_A Length = 149 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2j67_A TOLL like receptor 10; TIR, IL-1, TLR10, membrane, innate immunity, immune response, leucine-rich repeat, glycoprotein, transmembrane; 2.20A {Homo sapiens} PDB: 1fyv_A Length = 178 Back     alignment and structure
>3ub2_A TOLL/interleukin-1 receptor domain-containing ADA protein; TIR domain, TLRS adaptor, immune system; 2.40A {Homo sapiens} PDB: 3ub3_A 3ub4_A 2y92_A Length = 146 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>1t3g_A X-linked interleukin-1 receptor accessory protein-like 1; TIR, IL-1RAPL, IL-1R, TLR, membrane protein; 2.30A {Homo sapiens} Length = 159 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Length = 401 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Length = 401 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1344
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.98
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.94
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.94
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.94
1t3g_A159 X-linked interleukin-1 receptor accessory protein- 99.94
2j67_A178 TOLL like receptor 10; TIR, IL-1, TLR10, membrane, 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.93
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.92
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.92
1fyx_A149 TOLL-like receptor 2; beta-alpha-beta fold, signal 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.91
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.9
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.9
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.9
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.9
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.9
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.9
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.89
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.89
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.89
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.89
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.87
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.87
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.87
2js7_A160 Myeloid differentiation primary response protein M 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.85
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.85
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.85
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.84
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.84
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.84
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.84
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.83
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.83
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.83
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.82
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.81
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.81
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.8
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.79
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.78
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.78
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.77
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.76
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.76
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.76
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.73
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.73
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.73
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.72
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.72
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.72
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.71
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.71
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.71
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.7
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.7
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.69
3ub2_A146 TOLL/interleukin-1 receptor domain-containing ADA 99.68
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.68
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.67
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.65
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.64
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.64
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.63
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.62
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.62
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.62
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.61
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.6
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.59
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.59
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.59
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.56
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.55
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.54
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.54
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.54
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.54
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.48
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.47
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.46
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.43
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.41
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.4
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.4
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.38
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.37
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.36
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.31
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 99.3
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.28
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.16
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.1
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.97
3ozi_A204 L6TR; plant TIR domain, plant protein; 2.30A {Linu 98.97
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.96
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.94
3h16_A154 TIR protein; bacteria TIR domain, signaling protei 98.74
3jrn_A176 AT1G72930 protein; TIR domain arabidopsis thaliana 98.71
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.45
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 98.36
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.3
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.0
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.87
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.79
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.62
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.35
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.33
2j67_A178 TOLL like receptor 10; TIR, IL-1, TLR10, membrane, 96.98
1t3g_A159 X-linked interleukin-1 receptor accessory protein- 96.94
1fyx_A149 TOLL-like receptor 2; beta-alpha-beta fold, signal 96.92
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.44
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.33
2js7_A160 Myeloid differentiation primary response protein M 95.96
3ub2_A146 TOLL/interleukin-1 receptor domain-containing ADA 95.91
3ozi_A204 L6TR; plant TIR domain, plant protein; 2.30A {Linu 93.84
3jrn_A176 AT1G72930 protein; TIR domain arabidopsis thaliana 93.35
3h16_A154 TIR protein; bacteria TIR domain, signaling protei 91.59
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 90.93
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 88.55
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=2e-82  Score=836.95  Aligned_cols=757  Identities=23%  Similarity=0.311  Sum_probs=481.9

Q ss_pred             CCcccEEECCCCCCCCCCCCccCCCCCCCCEEEccCCCC-CCcChhhhcCCCCccEEEeeCCCCCCCChhhhcCCCCCcE
Q psy16377        190 GMDLRILDLSHNKLRTLGDYSGITKFRRLQNLHLENNEI-SQIAPNAFVALSSLRILNISSNHLVSLPEGLFSSCRDISE  268 (1344)
Q Consensus       190 l~~L~~LdLs~n~l~~l~~~~~l~~l~~L~~L~Ls~n~i-~~~~~~~~~~l~~L~~L~Ls~n~l~~l~~~~f~~l~~L~~  268 (1344)
                      .++|++|||++|.++.+.+. .|.++++|++|+|++|.. ..+.|.+|.++++|++|+|++|.+..+++..|.++++|++
T Consensus        23 p~~l~~LdLs~N~i~~i~~~-~~~~l~~L~~LdLs~n~~~~~i~~~~f~~L~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~  101 (844)
T 3j0a_A           23 LNTTERLLLSFNYIRTVTAS-SFPFLEQLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFHLFE  101 (844)
T ss_dssp             CTTCCEEEEESCCCCEECSS-SCSSCCSCSEEEECTTCCCCEECTTTTSSCTTCCEEECTTCCCCEECTTSSCSCSSCCC
T ss_pred             CCCcCEEECCCCcCCccChh-HCcccccCeEEeCCCCCCccccCHHHhcCCCCCCEEECCCCcCcccCHhHccCCcccCE
Confidence            45677777777777776555 677777777777777743 3344667777777777777777777776666777777777


Q ss_pred             EEcccCccccc-C-hhhhcCCCCCCEEEccCCCCCCCCCCcccccCCCcccEEEccCCCCCccccccccCC--CcccEEE
Q psy16377        269 IYAQKNSLVEL-S-RGLFHKLEQLLVLDLSSNHLSSNHIDETTFIGLIRLIILNLSNNELTRIDAKTFKDL--VFLQRLD  344 (1344)
Q Consensus       269 L~L~~n~l~~l-~-~~~~~~l~~L~~L~Ls~n~l~~~~i~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l--~~L~~L~  344 (1344)
                      |+|++|.+... + ...|.++++|++|+|++|.+.+. .....|.++++|+.|++++|.+..+.+..+..+  ++|+.|+
T Consensus       102 L~Ls~n~l~~~~~~~~~~~~L~~L~~L~Ls~N~l~~~-~~~~~~~~L~~L~~L~Ls~N~i~~~~~~~l~~l~~~~L~~L~  180 (844)
T 3j0a_A          102 LRLYFCGLSDAVLKDGYFRNLKALTRLDLSKNQIRSL-YLHPSFGKLNSLKSIDFSSNQIFLVCEHELEPLQGKTLSFFS  180 (844)
T ss_dssp             EECTTCCCSSCCSTTCCCSSCSSCCEEEEESCCCCCC-CCCGGGGTCSSCCEEEEESSCCCCCCSGGGHHHHHCSSCCCE
T ss_pred             eeCcCCCCCcccccCccccccCCCCEEECCCCccccc-ccchhHhhCCCCCEEECCCCcCCeeCHHHcccccCCccceEE
Confidence            77777777652 2 22356777777777777776652 112456677777777777777776666666655  6677777


Q ss_pred             ecCCCccccchhhhcCCCC------ccEEEccCCcccccccccccC---CCceeEEEccCC---------cCCCCChhhh
Q psy16377        345 LRNNSIGYIEDNAFLSLYN------LHTIYLSENRIHHITAHLFNG---LYVLSKLTLSNN---------LLVNIDSKAF  406 (1344)
Q Consensus       345 Ls~n~l~~i~~~~f~~l~~------L~~L~Ls~n~l~~~~~~~~~~---l~~L~~L~Ls~n---------~l~~~~~~~~  406 (1344)
                      ++.|.+....+..+..+++      |+.|++++|.+.+..+..+..   ...++.|.+..+         .+.......|
T Consensus       181 L~~n~l~~~~~~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~~l~~~~l~~L~l~~~~~~~~~~~~~l~~~~~~~f  260 (844)
T 3j0a_A          181 LAANSLYSRVSVDWGKCMNPFRNMVLEILDVSGNGWTVDITGNFSNAISKSQAFSLILAHHIMGAGFGFHNIKDPDQNTF  260 (844)
T ss_dssp             ECCSBSCCCCCCCCCSSSCTTTTCCBSEEBCSSCCSSTTTTSGGGGTSCSCCBSEEECCSSCCBCSSSCSSSTTGGGTTT
T ss_pred             CCCCccccccccchhhcCCccccCceeEEecCCCcCchhHHHHHHhhcCcccccceecccccccccccccccCCCChhhh
Confidence            7777665544333333333      666667666665544433322   134555555422         2222222233


Q ss_pred             cCC--CCCcEEEccCCCCCcc-chhhcCCCCccEEEccCCCCCccCcchhcCCCCCcEEEcccCCCCCCCcccccCCCCc
Q psy16377        407 KNC--SALKELDLSSNAIVEI-PSALSELPFLKTLDLGENQISKIENGSFKNLQQLTDLRLVDNNIGNLSSGMLYELPSL  483 (1344)
Q Consensus       407 ~~l--~~L~~L~Ls~n~l~~l-p~~l~~l~~L~~L~Ls~n~i~~~~~~~~~~l~~L~~L~L~~n~l~~l~~~~~~~l~~L  483 (1344)
                      .++  ++|+.|++++|.+..+ +..+..+++|+.|+|++|.+.++.+..|.++++|+.|++++|.++.+.+..|.++++|
T Consensus       261 ~~l~~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L  340 (844)
T 3j0a_A          261 AGLARSSVRHLDLSHGFVFSLNSRVFETLKDLKVLNLAYNKINKIADEAFYGLDNLQVLNLSYNLLGELYSSNFYGLPKV  340 (844)
T ss_dssp             TTTTTSCCCEEECTTCCCCEECSCCSSSCCCCCEEEEESCCCCEECTTTTTTCSSCCEEEEESCCCSCCCSCSCSSCTTC
T ss_pred             hccccCCccEEECCCCcccccChhhhhcCCCCCEEECCCCcCCCCChHHhcCCCCCCEEECCCCCCCccCHHHhcCCCCC
Confidence            332  3455555555554433 2344445555555555555555544455555555555555555544444444555555


Q ss_pred             cEEEcCCCcCcccccccccCCCccceEeccccCCCChhhHhhcCCCCcEEEcCCCCCccccCCCcCCCccEEEcCCCcCC
Q psy16377        484 EVLNLSKNKIHQIEIGTFEKNKRLAAIRLDSNFLTDINGVFTYLAQLLWLNLSENHLVWFDYAMVPGNLKWLDIHGNYIS  563 (1344)
Q Consensus       484 ~~L~Ls~n~i~~~~~~~~~~l~~L~~L~L~~n~l~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~lp~~L~~L~Ls~n~l~  563 (1344)
                      +.|++++|++..+.+..|..                       +++|+.|++++|.++.++.   .++|+.|++++|.++
T Consensus       341 ~~L~L~~N~i~~~~~~~~~~-----------------------l~~L~~L~Ls~N~l~~i~~---~~~L~~L~l~~N~l~  394 (844)
T 3j0a_A          341 AYIDLQKNHIAIIQDQTFKF-----------------------LEKLQTLDLRDNALTTIHF---IPSIPDIFLSGNKLV  394 (844)
T ss_dssp             CEEECCSCCCCCCCSSCSCS-----------------------CCCCCEEEEETCCSCCCSS---CCSCSEEEEESCCCC
T ss_pred             CEEECCCCCCCccChhhhcC-----------------------CCCCCEEECCCCCCCcccC---CCCcchhccCCCCcc
Confidence            55555555554444444444                       4445555555554443322   345555666666665


Q ss_pred             CCCccccccCCCcccEEECCCCcccccccccccCcccEEEcCCCcCCccCCCCCCCCCCccEEEecCCCCcccccccccc
Q psy16377        564 SLNNYYEIKDGLSIKNLDASHNRILEISELSIPNSVEVLFINNNLIKSVKPHTFFDKSNLARVDIYANDITKLDLTALRL  643 (1344)
Q Consensus       564 ~l~~~~~l~~~~~L~~L~Ls~N~l~~~~~~~~~~sL~~L~Ls~N~i~~~~~~~f~~~~~L~~LdL~~N~l~~l~~~~l~~  643 (1344)
                      .++..     ..+++.|++++|++.++....                     .+.++++|+.|++++|+++++.....  
T Consensus       395 ~l~~~-----~~~l~~L~ls~N~l~~l~~~~---------------------~~~~l~~L~~L~Ls~N~l~~~~~~~~--  446 (844)
T 3j0a_A          395 TLPKI-----NLTANLIHLSENRLENLDILY---------------------FLLRVPHLQILILNQNRFSSCSGDQT--  446 (844)
T ss_dssp             CCCCC-----CTTCCEEECCSCCCCSSTTHH---------------------HHTTCTTCCEEEEESCCCCCCCSSSS--
T ss_pred             ccccc-----ccccceeecccCccccCchhh---------------------hhhcCCccceeeCCCCcccccccccc--
Confidence            55431     246777777777776643211                     12345666777776666553211000  


Q ss_pred             cCCCCCCCCCeEEcCCCcccccccCccccccccCCCCccccccCccccCCCceeecccCCCCccccccccCCCCCcCCCC
Q psy16377        644 KPVPQNKTLPEFYLGGNPFDCDCSMDWLPIINNNTSPSMERQYPKIMDLDNVVCKMTYSRGSTHLPASEAAPSQYLCPYD  723 (1344)
Q Consensus       644 ~~~~~~~~l~~l~l~~Np~~C~c~~~~l~~~~~~~~~~~~~~~~~~~~l~~~~C~~~~~~~~~~~~l~~~~~~~~~c~~~  723 (1344)
                                                                                                      
T Consensus       447 --------------------------------------------------------------------------------  446 (844)
T 3j0a_A          447 --------------------------------------------------------------------------------  446 (844)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             cccccccccccccccccCCCCCCCCeeeccCCCCccEEEcCCCCCCCCCCCCCCCccEEEEeCCcccccCCCcCCCCCCc
Q psy16377        724 IHCFALCHCCEFDACDCEMTCPKNCSCFHDQNWNTNVVDCSEQQISTVPPRIPMDATHVYLDGNTFKTIPNHVFIGRKNM  803 (1344)
Q Consensus       724 ~~~~~~c~c~~~~~~~~~~~cp~~c~c~~~~~~~~~~v~cs~~~l~~~p~~ip~~l~~L~L~~n~l~~l~~~~f~~l~~L  803 (1344)
                                                                      +.. ...++.|+|++|.++.+...        
T Consensus       447 ------------------------------------------------~~~-~~~L~~L~Ls~N~l~~~~~~--------  469 (844)
T 3j0a_A          447 ------------------------------------------------PSE-NPSLEQLFLGENMLQLAWET--------  469 (844)
T ss_dssp             ------------------------------------------------SCS-CTTCCBCEEESCCCSSSCCS--------
T ss_pred             ------------------------------------------------ccc-CCccccccCCCCcccccccc--------
Confidence                                                            000 01233344444444322211        


Q ss_pred             cEEEccCCcccccccchhcCCCccceeecccccccccCcccccCccccceeeccccccccccCccccCCCCCCEEEccCC
Q psy16377        804 LSLYVNNSQIEVILNQTFNGLSSLQVLHLENNLITHFYGYEFDNLEKLSELYLQENRIEYIANGTFNALISLQVLQLDGN  883 (1344)
Q Consensus       804 ~~L~l~~n~i~~i~~~~f~~l~~L~~L~Ls~N~l~~l~~~~f~~l~~L~~L~L~~N~l~~i~~~~f~~l~~L~~L~L~~N  883 (1344)
                                 .+.+..|.++++|++|+|++|+|+.+++..|.++++|++|+|++|+|+++++..|.  ++|++|+|++|
T Consensus       470 -----------~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~Ls~N~l~~l~~~~~~--~~L~~L~Ls~N  536 (844)
T 3j0a_A          470 -----------ELCWDVFEGLSHLQVLYLNHNYLNSLPPGVFSHLTALRGLSLNSNRLTVLSHNDLP--ANLEILDISRN  536 (844)
T ss_dssp             -----------CCCSSCSSCBCCEECCCCCHHHHTTCCTTSSSSCCSCSEEEEESCCCSSCCCCCCC--SCCCEEEEEEE
T ss_pred             -----------ccchhhhcCcccccEEECCCCcccccChhHccchhhhheeECCCCCCCccChhhhh--ccccEEECCCC
Confidence                       12234677888999999999999999999999999999999999999999988887  89999999999


Q ss_pred             CCcccccccccCCCCCcEEEecCCcccCCChhhHHHHHHHhhcCCccCC-CCCeeecCCCCCCCccccccCCcccccCcc
Q psy16377        884 RLKSFRAFDLNTNSMLRKVYLGNNPFSCSCATLQELQTWIIDNSNKVKD-GLDISCVIDESSPPIRKEIDLNSTTCTEYY  962 (1344)
Q Consensus       884 ~l~~~~~~~l~~~~~L~~L~l~~Np~~C~C~~l~~l~~w~~~~~~~v~~-~~~~~C~~~~~~~~~~~~~~~~~~~C~~~~  962 (1344)
                      +|+.+++..+   .+|+.|++++|||.|+|+ +.||..|+......+.+ ..++.|..|....+ ....++....|....
T Consensus       537 ~l~~~~~~~~---~~L~~l~l~~Np~~C~c~-~~~f~~~~~~~~~~~~~~~~~~~C~~p~~~~g-~~l~~~~~~~C~~~~  611 (844)
T 3j0a_A          537 QLLAPNPDVF---VSLSVLDITHNKFICECE-LSTFINWLNHTNVTIAGPPADIYCVYPDSFSG-VSLFSLSTEGCDEEE  611 (844)
T ss_dssp             CCCCCCSCCC---SSCCEEEEEEECCCCSSS-CCSHHHHHHHTTTTTCCCGGGCCCSSCSSSCS-CCTTTCCCCCC----
T ss_pred             cCCCCChhHh---CCcCEEEecCCCcccccc-cHHHHHHHHhcCcccccccccCccCCchhhCC-CccccCccccCCchh
Confidence            9999988766   478999999999999999 68999999876655544 47799998876443 234555566787532


Q ss_pred             cccceeeeeccccchhHHHHHHHHHHHHHHHHHhhhhcccceeeeeeeccceeeeee----cccCCCccCCccCCCCchh
Q psy16377        963 ATSSVIASIMVSDYLPFMIITFLMFLVFLILIIFMFVFKDPFRVWLYTKYGIRLFNF----KATSSKHFGEDREKLPKDE 1038 (1344)
Q Consensus       963 ~~~~~~~~~~~~~~~~~lv~~lv~~~v~l~~~~~~~~~~~~~~~wl~~~~~~~~~~~----~~~~~~~~~~~~~~~~~d~ 1038 (1344)
                      ...    .   ..+ .+++++.++++++ +++++++++++.+.+++|.+...+++..    ....++.||++..+.++|+
T Consensus       612 ~~~----~---~~~-~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~y~~~~~~~~~~~~~~~~~~~~~yd~fisy~~~d~  682 (844)
T 3j0a_A          612 VLK----S---LKF-SLFIVCTVTLTLF-LMTILTVTKFRGFCFICYKTAQRLVFKDHPQGTEPDMYKYDAYLCFSSKDF  682 (844)
T ss_dssp             -------------C-HHHHHHHHHHHHH-HHTTTSHHHHC----------------CCCGGGSSSCCCCSEEEECCSTTH
T ss_pred             hcc----c---cce-ehhHHHHHHHHHH-HHHHHHHHHHhhhhhhhhHHHHHHHhccccccccccceeccEEEEeeCCcH
Confidence            110    0   001 1111111111111 1111222222222222232222222211    1234567888888889999


Q ss_pred             HHHHHHHHhhhhc---CCCCceeEEeeccCCCCCCcccccCCchhHHHHHhhhheeeeeeecccccCCccchhHHHHHHH
Q psy16377       1039 EFVLQSIVAELEH---GNPSYQLCLHYRDLPHHSPYLQQHTTSPVVIEAAEASRRVILVLTKNFLQTEWSRSDFLIEAAE 1115 (1344)
Q Consensus      1039 ~~v~~~l~~~Le~---~~~~~~lc~~~rD~~~~~~~~~~~~~~~~~~~~~~~s~~~i~vls~~~~~~~w~~~~~i~~~i~ 1115 (1344)
                      +||.++|++.||+   ++++||+|+|+|||.||.+++                                   |+|.+||+
T Consensus       683 ~~v~~~l~~~Le~~~~~~~~~~~~~~~rd~~~G~~~~-----------------------------------~~i~~~i~  727 (844)
T 3j0a_A          683 TWVQNALLKHLDTQYSDQNRFNLCFEERDFVPGENRI-----------------------------------ANIQDAIW  727 (844)
T ss_dssp             HHHHHTHHHHHHSTTTTTTCSCEECSSSSCCSSSCHH-----------------------------------HHHHHHHH
T ss_pred             HHHHHHHHHHHhhccccCCceEEEEEccccCCCchHH-----------------------------------HHHHHHHH
Confidence            9999999999998   378999999999999999999                                   99999999


Q ss_pred             hcccEEEEecccchhhhhhHHHHHHHHHHHHhcCCceEEEEEecCCCcccc--hhhHHHHhhhccEEEeCc-----hhhH
Q psy16377       1116 ASRRVILVLTKNFLQTEWSRSDFRSAIHEALTTKTHKLVLVEENIVPEAES--DIELKPYLKSCMKIRWGE-----KRFW 1188 (1344)
Q Consensus      1116 ~srr~i~vls~~f~~~~w~~~e~~~a~~~~l~~~~~~~i~i~~~~~~~~~~--~~~l~~~l~~~~~l~w~~-----~~Fw 1188 (1344)
                      +|||+|+|+|++|++++||++||+.|++++++++++++|+|+++++++..+  +++||++|+++|||+|++     ++||
T Consensus       728 ~sr~~i~vls~~~~~s~wc~~e~~~a~~~~~~~~~~~~i~i~~~~~~~~~~~~~~~l~~~~~~~~~l~w~~~~~~~~~Fw  807 (844)
T 3j0a_A          728 NSRKIVCLVSRHFLRDGWCLEAFSYAQGRCLSDLNSALIMVVVGSLSQYQLMKHQSIRGFVQKQQYLRWPEDFQDVGWFL  807 (844)
T ss_dssp             HSSEEEEEECTTHHHHTSTTHHHHHHHSCCCCSSCTTEEEEESSCCCSSSCCSCSSTTHHHHTTCCCCCCSSSTTTTHHH
T ss_pred             HhCeEEEEeccccccChHHHHHHHHHHHHHHHhcCCcEEEEEeccCChHHhhhhHHHHHHHhhCCeeeCCCCchhHHHHH
Confidence            999999999999999999999999999999999999999999999998876  579999999999999976     6999


Q ss_pred             HHhHhhcCCCCcC
Q psy16377       1189 ERLRYAMPTCDNS 1201 (1344)
Q Consensus      1189 ~~l~~~~p~~~~~ 1201 (1344)
                      ++||||||.+++.
T Consensus       808 ~~l~~al~~~~~~  820 (844)
T 3j0a_A          808 HKLSQQILKKEKE  820 (844)
T ss_dssp             HHHTTTTTSCCCC
T ss_pred             HHHHHHhcccccc
Confidence            9999999987543



>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1t3g_A X-linked interleukin-1 receptor accessory protein-like 1; TIR, IL-1RAPL, IL-1R, TLR, membrane protein; 2.30A {Homo sapiens} Back     alignment and structure
>2j67_A TOLL like receptor 10; TIR, IL-1, TLR10, membrane, innate immunity, immune response, leucine-rich repeat, glycoprotein, transmembrane; 2.20A {Homo sapiens} PDB: 1fyv_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1fyx_A TOLL-like receptor 2; beta-alpha-beta fold, signaling protein; 2.80A {Homo sapiens} SCOP: c.23.2.1 PDB: 1fyw_A 1o77_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2js7_A Myeloid differentiation primary response protein MYD88; MYD88_human, TIR domain, TOLL like receptor adaptor domain, innate immune signaling; NMR {Homo sapiens} PDB: 2z5v_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ub2_A TOLL/interleukin-1 receptor domain-containing ADA protein; TIR domain, TLRS adaptor, immune system; 2.40A {Homo sapiens} PDB: 3ub3_A 3ub4_A 2y92_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ozi_A L6TR; plant TIR domain, plant protein; 2.30A {Linum usitatissimum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3h16_A TIR protein; bacteria TIR domain, signaling protein; 2.50A {Paracoccus denitrificans PD1222} Back     alignment and structure
>3jrn_A AT1G72930 protein; TIR domain arabidopsis thaliana, plant protein; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2j67_A TOLL like receptor 10; TIR, IL-1, TLR10, membrane, innate immunity, immune response, leucine-rich repeat, glycoprotein, transmembrane; 2.20A {Homo sapiens} PDB: 1fyv_A Back     alignment and structure
>1t3g_A X-linked interleukin-1 receptor accessory protein-like 1; TIR, IL-1RAPL, IL-1R, TLR, membrane protein; 2.30A {Homo sapiens} Back     alignment and structure
>1fyx_A TOLL-like receptor 2; beta-alpha-beta fold, signaling protein; 2.80A {Homo sapiens} SCOP: c.23.2.1 PDB: 1fyw_A 1o77_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2js7_A Myeloid differentiation primary response protein MYD88; MYD88_human, TIR domain, TOLL like receptor adaptor domain, innate immune signaling; NMR {Homo sapiens} PDB: 2z5v_A Back     alignment and structure
>3ub2_A TOLL/interleukin-1 receptor domain-containing ADA protein; TIR domain, TLRS adaptor, immune system; 2.40A {Homo sapiens} PDB: 3ub3_A 3ub4_A 2y92_A Back     alignment and structure
>3ozi_A L6TR; plant TIR domain, plant protein; 2.30A {Linum usitatissimum} Back     alignment and structure
>3jrn_A AT1G72930 protein; TIR domain arabidopsis thaliana, plant protein; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3h16_A TIR protein; bacteria TIR domain, signaling protein; 2.50A {Paracoccus denitrificans PD1222} Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1344
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-26
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-22
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-21
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-06
d1fyxa_149 c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (H 5e-22
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-19
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-18
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.003
d1fyva_161 c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (H 2e-16
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-13
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-11
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-07
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 7e-12
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 4e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-10
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-09
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 1e-06
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 9e-06
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.004
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-09
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-07
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 7e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 8e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 8e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 8e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.001
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.003
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 2e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 8e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 8e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 2e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.003
d1cyga183 b.1.18.2 (A:492-574) Cyclomaltodextrin glycanotran 0.002
d3bmva183 b.1.18.2 (A:496-578) Cyclomaltodextrin glycanotran 0.003
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
 Score =  107 bits (266), Expect = 9e-26
 Identities = 75/323 (23%), Positives = 137/323 (42%), Gaps = 30/323 (9%)

Query: 192 DLRILDLSHNKLRTLGDYSGITKFRRLQNLHLENNEISQIAPNAFVALSSLRILNISSNH 251
            LR++  S   L  +     +        L L+NN+I++I    F  L +L  L + +N 
Sbjct: 11  HLRVVQCSDLGLEKVP--KDL--PPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNK 66

Query: 252 LVSLPEGLFSSCRDISEIYAQKNSLVELSRGLFHKLEQLLVLDLSSNHLSSNHIDETTFI 311
           +  +  G F+    +  +Y  KN L EL   +   L++   L +  N ++         +
Sbjct: 67  ISKISPGAFAPLVKLERLYLSKNQLKELPEKMPKTLQE---LRVHENEITKVRKSVFNGL 123

Query: 312 GLIRLIILNLSNNELTRIDAKTFKDLVFLQRLDLRNNSIGYIEDNAFLSLYNLHTIYLSE 371
             + ++ L  +  + + I+   F+ +  L  + + + +I  I      SL  LH   L  
Sbjct: 124 NQMIVVELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIPQGLPPSLTELH---LDG 180

Query: 372 NRIHHITAHLFNGLYVLSKLTLSNNLLVNIDSKAFKNCSALKELDLSSNAIVEIPSALSE 431
           N+I  + A    GL  L+KL LS N +  +D+ +  N   L+EL L++N +V++P  L++
Sbjct: 181 NKITKVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLAD 240

Query: 432 LPFLKTLDLGENQISKIENGSFKNLQQLTDLRLVDNNIGNLSSGMLYELPSLEVLNLSKN 491
             +++ + L  N IS I +  F                     G   +  S   ++L  N
Sbjct: 241 HKYIQVVYLHNNNISAIGSNDF------------------CPPGYNTKKASYSGVSLFSN 282

Query: 492 KIHQIEI--GTFEKNKRLAAIRL 512
            +   EI   TF      AA++L
Sbjct: 283 PVQYWEIQPSTFRCVYVRAAVQL 305


>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1cyga1 b.1.18.2 (A:492-574) Cyclomaltodextrin glycanotransferase, domain D {Bacillus stearothermophilus [TaxId: 1422]} Length = 83 Back     information, alignment and structure
>d3bmva1 b.1.18.2 (A:496-578) Cyclomaltodextrin glycanotransferase, domain D {Thermoanaerobacterium [TaxId: 28895]} Length = 83 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1344
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.9
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1fyxa_149 Toll-like receptor 2, TLR2 {Human (Homo sapiens) [ 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1fyva_161 Toll-like receptor 1, TLR1 {Human (Homo sapiens) [ 99.87
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.83
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.82
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.8
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.79
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.77
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.76
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.64
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.64
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.63
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.63
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.63
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.56
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.55
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.55
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.55
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.42
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.39
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.38
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.38
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.35
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.26
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.22
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.21
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.19
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.0
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.98
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.21
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.13
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.06
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.96
d1fyxa_149 Toll-like receptor 2, TLR2 {Human (Homo sapiens) [ 96.73
d1fyva_161 Toll-like receptor 1, TLR1 {Human (Homo sapiens) [ 96.14
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.07
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.68
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93  E-value=8e-26  Score=252.78  Aligned_cols=219  Identities=21%  Similarity=0.324  Sum_probs=187.7

Q ss_pred             CcccEEECCCCcccccccccccCcccEEEcCCCcCCccCCCCCCCCCCccEEEecCCCCcccccccccccCCCCCCCCCe
Q psy16377        575 LSIKNLDASHNRILEISELSIPNSVEVLFINNNLIKSVKPHTFFDKSNLARVDIYANDITKLDLTALRLKPVPQNKTLPE  654 (1344)
Q Consensus       575 ~~L~~L~Ls~N~l~~~~~~~~~~sL~~L~Ls~N~i~~~~~~~f~~~~~L~~LdL~~N~l~~l~~~~l~~~~~~~~~~l~~  654 (1344)
                      ..+.+++.+++.++.++ ..+|..+++|+|++|+|+++.+..|.++++|++|+|++|+|+.++..       ...     
T Consensus        10 ~~~~~v~C~~~~L~~iP-~~lp~~l~~L~Ls~N~i~~l~~~~f~~l~~L~~L~L~~N~l~~l~~~-------~~l-----   76 (266)
T d1p9ag_          10 ASHLEVNCDKRNLTALP-PDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRAELTKLQVD-------GTL-----   76 (266)
T ss_dssp             TTCCEEECTTSCCSSCC-SCCCTTCCEEECTTSCCSEEEGGGGTTCTTCCEEECTTSCCCEEECC-------SCC-----
T ss_pred             CCCeEEEccCCCCCeeC-cCcCcCCCEEECcCCcCCCcCHHHhhccccccccccccccccccccc-------ccc-----
Confidence            45667788888888764 45778899999999999998888899999999999999988754210       000     


Q ss_pred             EEcCCCcccccccCccccccccCCCCccccccCccccCCCceeecccCCCCccccccccCCCCCcCCCCccccccccccc
Q psy16377        655 FYLGGNPFDCDCSMDWLPIINNNTSPSMERQYPKIMDLDNVVCKMTYSRGSTHLPASEAAPSQYLCPYDIHCFALCHCCE  734 (1344)
Q Consensus       655 l~l~~Np~~C~c~~~~l~~~~~~~~~~~~~~~~~~~~l~~~~C~~~~~~~~~~~~l~~~~~~~~~c~~~~~~~~~c~c~~  734 (1344)
                                                                                                      
T Consensus        77 --------------------------------------------------------------------------------   76 (266)
T d1p9ag_          77 --------------------------------------------------------------------------------   76 (266)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             ccccccCCCCCCCCeeeccCCCCccEEEcCCCCCCCCCCCCCCCccEEEEeCCcccccCCCcCCCCCCccEEEccCCccc
Q psy16377        735 FDACDCEMTCPKNCSCFHDQNWNTNVVDCSEQQISTVPPRIPMDATHVYLDGNTFKTIPNHVFIGRKNMLSLYVNNSQIE  814 (1344)
Q Consensus       735 ~~~~~~~~~cp~~c~c~~~~~~~~~~v~cs~~~l~~~p~~ip~~l~~L~L~~n~l~~l~~~~f~~l~~L~~L~l~~n~i~  814 (1344)
                                                                ..++.|+|++|+++.++. .|.++++|+.|++++|.+.
T Consensus        77 ------------------------------------------~~L~~L~Ls~N~l~~~~~-~~~~l~~L~~L~l~~~~~~  113 (266)
T d1p9ag_          77 ------------------------------------------PVLGTLDLSHNQLQSLPL-LGQTLPALTVLDVSFNRLT  113 (266)
T ss_dssp             ------------------------------------------TTCCEEECCSSCCSSCCC-CTTTCTTCCEEECCSSCCC
T ss_pred             ------------------------------------------cccccccccccccccccc-ccccccccccccccccccc
Confidence                                                      135667777777776654 5778899999999999999


Q ss_pred             ccccchhcCCCccceeecccccccccCcccccCccccceeeccccccccccCccccCCCCCCEEEccCCCCccccccccc
Q psy16377        815 VILNQTFNGLSSLQVLHLENNLITHFYGYEFDNLEKLSELYLQENRIEYIANGTFNALISLQVLQLDGNRLKSFRAFDLN  894 (1344)
Q Consensus       815 ~i~~~~f~~l~~L~~L~Ls~N~l~~l~~~~f~~l~~L~~L~L~~N~l~~i~~~~f~~l~~L~~L~L~~N~l~~~~~~~l~  894 (1344)
                      .+....+..+.+|+.|++++|.++.+++..|..+++|+.|++++|+|+.+++..|..+++|++|+|++|+|+.+|+..+ 
T Consensus       114 ~~~~~~~~~l~~l~~L~l~~n~l~~l~~~~~~~l~~l~~l~l~~N~l~~~~~~~~~~l~~L~~L~Ls~N~L~~lp~~~~-  192 (266)
T d1p9ag_         114 SLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFF-  192 (266)
T ss_dssp             CCCSSTTTTCTTCCEEECTTSCCCCCCTTTTTTCTTCCEEECTTSCCSCCCTTTTTTCTTCCEEECCSSCCCCCCTTTT-
T ss_pred             eeeccccccccccccccccccccceeccccccccccchhcccccccccccCccccccccccceeecccCCCcccChhHC-
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999998765 


Q ss_pred             CCCCCcEEEecCCcccCCChhhHHHHHHHhhcCCccC
Q psy16377        895 TNSMLRKVYLGNNPFSCSCATLQELQTWIIDNSNKVK  931 (1344)
Q Consensus       895 ~~~~L~~L~l~~Np~~C~C~~l~~l~~w~~~~~~~v~  931 (1344)
                      .+++|+.|+|++|||.|||+ +.||..|++++...+.
T Consensus       193 ~~~~L~~L~L~~Np~~CdC~-~~~l~~wl~~~~~~~~  228 (266)
T d1p9ag_         193 GSHLLPFAFLHGNPWLCNCE-ILYFRRWLQDNAENVY  228 (266)
T ss_dssp             TTCCCSEEECCSCCBCCSGG-GHHHHHHHHHTGGGBC
T ss_pred             CCCCCCEEEecCCCCCCCcc-hHHHHHHHHhccccee
Confidence            68899999999999999999 7999999987766553



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure