Psyllid ID: psy16410
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 88 | ||||||
| 307182978 | 385 | Equilibrative nucleoside transporter 1 [ | 0.909 | 0.207 | 0.421 | 5e-12 | |
| 196015010 | 439 | hypothetical protein TRIADDRAFT_61352 [T | 0.659 | 0.132 | 0.568 | 7e-12 | |
| 91081805 | 453 | PREDICTED: similar to AGAP009114-PA [Tri | 0.738 | 0.143 | 0.523 | 1e-11 | |
| 383856861 | 491 | PREDICTED: equilibrative nucleoside tran | 0.715 | 0.128 | 0.476 | 2e-11 | |
| 322791070 | 472 | hypothetical protein SINV_80532 [Solenop | 0.738 | 0.137 | 0.446 | 3e-11 | |
| 307201187 | 471 | Equilibrative nucleoside transporter 1 [ | 0.715 | 0.133 | 0.507 | 3e-11 | |
| 332018550 | 471 | Equilibrative nucleoside transporter 1 [ | 0.738 | 0.138 | 0.461 | 6e-11 | |
| 156552507 | 470 | PREDICTED: equilibrative nucleoside tran | 0.738 | 0.138 | 0.461 | 2e-09 | |
| 196014916 | 308 | hypothetical protein TRIADDRAFT_61363 [T | 0.761 | 0.217 | 0.470 | 3e-09 | |
| 380011800 | 473 | PREDICTED: equilibrative nucleoside tran | 0.715 | 0.133 | 0.460 | 5e-09 |
| >gi|307182978|gb|EFN69965.1| Equilibrative nucleoside transporter 1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
Score = 75.1 bits (183), Expect = 5e-12, Method: Compositional matrix adjust.
Identities = 35/83 (42%), Positives = 52/83 (62%), Gaps = 3/83 (3%)
Query: 5 HWILGLLRYWEKSYSAA---PRNNGWWVLLFSISRFVFMPLVLLCNIQPRTHLPVLITSD 61
+ I GL Y + S P+ N W V+ S++R VF+P+++ CN QPR HLPV I +D
Sbjct: 263 YLIFGLGDYAGRVLSGIFQWPKGNPWLVMFMSVARSVFIPVIMFCNAQPRHHLPVYIHND 322
Query: 62 LVYATIVLLMGLSNGYLANITFI 84
+ Y I ++ ++NGYL N+TFI
Sbjct: 323 IYYILITVMFAITNGYLCNLTFI 345
|
Source: Camponotus floridanus Species: Camponotus floridanus Genus: Camponotus Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|196015010|ref|XP_002117363.1| hypothetical protein TRIADDRAFT_61352 [Trichoplax adhaerens] gi|190580116|gb|EDV20202.1| hypothetical protein TRIADDRAFT_61352 [Trichoplax adhaerens] | Back alignment and taxonomy information |
|---|
| >gi|91081805|ref|XP_974174.1| PREDICTED: similar to AGAP009114-PA [Tribolium castaneum] gi|270006294|gb|EFA02742.1| hypothetical protein TcasGA2_TC008473 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|383856861|ref|XP_003703925.1| PREDICTED: equilibrative nucleoside transporter 1-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|322791070|gb|EFZ15670.1| hypothetical protein SINV_80532 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|307201187|gb|EFN81093.1| Equilibrative nucleoside transporter 1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|332018550|gb|EGI59139.1| Equilibrative nucleoside transporter 1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|156552507|ref|XP_001602781.1| PREDICTED: equilibrative nucleoside transporter 1 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|196014916|ref|XP_002117316.1| hypothetical protein TRIADDRAFT_61363 [Trichoplax adhaerens] gi|190580069|gb|EDV20155.1| hypothetical protein TRIADDRAFT_61363 [Trichoplax adhaerens] | Back alignment and taxonomy information |
|---|
| >gi|380011800|ref|XP_003689982.1| PREDICTED: equilibrative nucleoside transporter 3-like [Apis florea] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 88 | ||||||
| ZFIN|ZDB-GENE-050913-138 | 440 | slc29a1 "solute carrier family | 0.681 | 0.136 | 0.416 | 3.8e-09 | |
| ZFIN|ZDB-GENE-050220-15 | 450 | slc29a2 "solute carrier family | 0.556 | 0.108 | 0.489 | 6.5e-09 | |
| UNIPROTKB|E1C1Q3 | 457 | SLC29A1 "Uncharacterized prote | 0.545 | 0.105 | 0.458 | 1.8e-08 | |
| UNIPROTKB|F1RQU4 | 482 | SLC29A1 "Uncharacterized prote | 0.681 | 0.124 | 0.383 | 2e-08 | |
| MGI|MGI:1918529 | 475 | Slc29a3 "solute carrier family | 0.625 | 0.115 | 0.5 | 3.2e-08 | |
| UNIPROTKB|Q3ZC83 | 456 | SLC29A1 "Solute carrier family | 0.681 | 0.131 | 0.383 | 6.3e-08 | |
| UNIPROTKB|Q14542 | 456 | SLC29A2 "Equilibrative nucleos | 0.795 | 0.153 | 0.380 | 6.3e-08 | |
| UNIPROTKB|F1PAA1 | 456 | SLC29A1 "Uncharacterized prote | 0.681 | 0.131 | 0.383 | 1.3e-07 | |
| UNIPROTKB|J9P3J4 | 456 | SLC29A1 "Uncharacterized prote | 0.681 | 0.131 | 0.383 | 1.3e-07 | |
| UNIPROTKB|F1NMA1 | 461 | SLC29A3 "Uncharacterized prote | 0.772 | 0.147 | 0.391 | 1.7e-07 |
| ZFIN|ZDB-GENE-050913-138 slc29a1 "solute carrier family 29 (nucleoside transporters), member 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 143 (55.4 bits), Expect = 3.8e-09, P = 3.8e-09
Identities = 25/60 (41%), Positives = 39/60 (65%)
Query: 22 PRNNGWWVLLFSISRFVFMPLVLLCNIQPRTHLPVLITSDLVYATIVLLMGLSNGYLANI 81
P + W+ + I+R VF+PL +LCN+QPR+ LPV+ + D Y ++ SNGYLA++
Sbjct: 338 PGKDSIWLPILVIARVVFVPLFILCNVQPRSFLPVVFSHDAWYIIFMIFFSFSNGYLASL 397
|
|
| ZFIN|ZDB-GENE-050220-15 slc29a2 "solute carrier family 29 (nucleoside transporters), member 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C1Q3 SLC29A1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RQU4 SLC29A1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1918529 Slc29a3 "solute carrier family 29 (nucleoside transporters), member 3" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3ZC83 SLC29A1 "Solute carrier family 29 (Nucleoside transporters), member 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q14542 SLC29A2 "Equilibrative nucleoside transporter 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PAA1 SLC29A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P3J4 SLC29A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NMA1 SLC29A3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 88 | |||
| TIGR00939 | 437 | TIGR00939, 2a57, Equilibrative Nucleoside Transpor | 2e-12 | |
| pfam01733 | 305 | pfam01733, Nucleoside_tran, Nucleoside transporter | 1e-11 |
| >gnl|CDD|233199 TIGR00939, 2a57, Equilibrative Nucleoside Transporter (ENT) | Back alignment and domain information |
|---|
Score = 60.5 bits (147), Expect = 2e-12
Identities = 25/67 (37%), Positives = 38/67 (56%)
Query: 22 PRNNGWWVLLFSISRFVFMPLVLLCNIQPRTHLPVLITSDLVYATIVLLMGLSNGYLANI 81
P + W+ + S R +F+PL LLCN R+ LPV D + ++LL G SNGYL ++
Sbjct: 333 PDEDSRWLPILSFLRVLFIPLFLLCNYPQRSRLPVFFPGDAYFIILMLLFGFSNGYLGSL 392
Query: 82 TFICAAK 88
+ A +
Sbjct: 393 SMCLAPR 399
|
[Transport and binding proteins, Nucleosides, purines and pyrimidines]. Length = 437 |
| >gnl|CDD|216670 pfam01733, Nucleoside_tran, Nucleoside transporter | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 88 | |||
| PF01733 | 309 | Nucleoside_tran: Nucleoside transporter; InterPro: | 99.93 | |
| TIGR00939 | 437 | 2a57 Equilibrative Nucleoside Transporter (ENT). | 99.92 | |
| KOG1479|consensus | 406 | 99.85 |
| >PF01733 Nucleoside_tran: Nucleoside transporter; InterPro: IPR002259 Delayed-early response (DER) gene products include growth progression factors and several unknown products of novel cDNAs | Back alignment and domain information |
|---|
Probab=99.93 E-value=1.4e-27 Score=176.69 Aligned_cols=82 Identities=38% Similarity=0.791 Sum_probs=4.0
Q ss_pred hhhhhhhhhhcceecccCChhHHHHHHHHHHHHHHHHHHhcccCCCC-cCceeechHHHHHHHHHHHhhhhhhhhhhhee
Q psy16410 7 ILGLLRYWEKSYSAAPRNNGWWVLLFSISRFVFMPLVLLCNIQPRTH-LPVLITSDLVYATIVLLMGLSNGYLANITFIC 85 (88)
Q Consensus 7 iF~l~Gr~la~~~~~p~~~~~~l~~~s~~R~ifIPlfllcn~~~~~~-~~~~~~~D~~~~i~~~lfglTNGyl~tl~m~~ 85 (88)
++|++||.++++.+||.++++++++++++|++|||+|++||++|+++ +|+.++||+++++++++||+||||++|++|||
T Consensus 193 ~gD~iGR~l~~~~~~~~~~~~~l~~~s~~R~~fiPlf~~cn~~p~~~~~~~~~~~d~~~~i~~~l~g~TNGyl~tl~m~~ 272 (309)
T PF01733_consen 193 LGDFIGRFLASWPRWPGPSPRWLWILSLLRFLFIPLFLLCNVQPRPRYLPVLFNSDAWFIILMLLFGFTNGYLSTLAMMY 272 (309)
T ss_dssp --------------------------------------------------------------------------HHHH--
T ss_pred HHHHhcchhcceeEecccccccHHHHHHHHHHHHHHHHHHHhhcccccCCCcccchHHHHHHHHHHHHccchhhhceeee
Confidence 68999999999999997788888899999999999999999998854 68999999999999999999999999999999
Q ss_pred ccC
Q psy16410 86 AAK 88 (88)
Q Consensus 86 ~P~ 88 (88)
||+
T Consensus 273 ~p~ 275 (309)
T PF01733_consen 273 APK 275 (309)
T ss_dssp ---
T ss_pred CCC
Confidence 996
|
Murine and human cDNAs from one novel DER gene (DER12) have been characterised to identify its product and to examine its role in the growth response []. Both sequences encode a hydrophobic 36kDa protein that is predicted to contain 8 transmembrane (TM) domains. The protein has been localised to the nucleolus, where its concentration increases following mitogen stimulation []. Although the function of the protein is unknown, its identification as a nucleolar gene transcriptionally activated by growth factors implicates it as participating in the proliferative response []. Sequence analysis reveals the protein to share a high degree of similarity with the C-terminal portion of equilibrative nucleoside transporters. These proteins are integral membrane proteins which enable the movement of hydrophilic nucleosides and nucleoside analogs down their concentration gradients across cell membranes. ENT family members have been identified in humans, mice, fish, tunicates, slime molds, and bacteria []. ; GO: 0005337 nucleoside transmembrane transporter activity, 0006810 transport, 0016020 membrane; PDB: 1HXI_A. |
| >TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT) | Back alignment and domain information |
|---|
| >KOG1479|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00