Psyllid ID: psy16410


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
MVGKHWILGLLRYWEKSYSAAPRNNGWWVLLFSISRFVFMPLVLLCNIQPRTHLPVLITSDLVYATIVLLMGLSNGYLANITFICAAK
cEEEHHHHHHcHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEccHHHHHHHHHHHHHHcHHHHHHHHHHccc
ccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccEEEccHHHHHHHHHHHHHHccHHHHHHHEEccc
MVGKHWILGLLRYWEKsysaaprnngWWVLLFSISRFVFMPLVLlcniqprthlpvliTSDLVYATIVLLMGLSNGYLANITFICAAK
MVGKHWILGLLRYWEKSYSAAPRNNGWWVLLFSISRFVFMPLVLLCNIQPRTHLPVLITSDLVYATIVLLMGLSNGYLANITFICAAK
MVGKHWILGLLRYWEKSYSAAPRNNGWWVLLFSISRFVFMPLVLLCNIQPRTHLPVLITSDLVYATIVLLMGLSNGYLANITFICAAK
***KHWILGLLRYWEKSYSAAPRNNGWWVLLFSISRFVFMPLVLLCNIQPRTHLPVLITSDLVYATIVLLMGLSNGYLANITFICA**
MVGKHWILGLLRYWEKSYSAAPRNNGWWVLLFSISRFVFMPLVLLCNIQPRTHLPVLITSDLVYATIVLLMGLSNGYLANITFICAAK
MVGKHWILGLLRYWEKSYSAAPRNNGWWVLLFSISRFVFMPLVLLCNIQPRTHLPVLITSDLVYATIVLLMGLSNGYLANITFICAAK
*VGKHWILGLLRYWEKSYSAAPRNNGWWVLLFSISRFVFMPLVLLCNIQPRTHLPVLITSDLVYATIVLLMGLSNGYLANITFICAAK
iiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiii
iiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiii
SSSSSSSSSSSSSSSSSSSSSSSSiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHi
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGKHWILGLLRYWEKSYSAAPRNNGWWVLLFSISRFVFMPLVLLCNIQPRTHLPVLITSDLVYATIVLLMGLSNGYLANITFICAAK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query88 2.2.26 [Sep-21-2011]
Q99P65475 Equilibrative nucleoside yes N/A 0.625 0.115 0.5 3e-07
Q14542456 Equilibrative nucleoside yes N/A 0.761 0.146 0.358 1e-06
Q80WK7475 Equilibrative nucleoside yes N/A 0.659 0.122 0.440 5e-06
Q99808456 Equilibrative nucleoside no N/A 0.681 0.131 0.383 8e-06
O54699456 Equilibrative nucleoside no N/A 0.818 0.157 0.333 2e-05
Q61672456 Equilibrative nucleoside no N/A 0.602 0.116 0.377 3e-05
O54698457 Equilibrative nucleoside no N/A 0.681 0.131 0.35 4e-05
A1A4N1474 Equilibrative nucleoside no N/A 0.602 0.111 0.462 5e-05
>sp|Q99P65|S29A3_MOUSE Equilibrative nucleoside transporter 3 OS=Mus musculus GN=Slc29a3 PE=1 SV=1 Back     alignment and function desciption
 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 34  ISRFVFMPLVLLCNIQPRTHL-PVLITSDLVYATIVLLMGLSNGYLANITFICAAK 88
           +SRF  +PL LLCN QPR+HL  VL  SD+       L+GLSNGYL+ +  I   K
Sbjct: 384 VSRFCLVPLFLLCNYQPRSHLTKVLFQSDIYPVLFTCLLGLSNGYLSTLVLIYGPK 439




Mediates both influx and efflux of nucleosides across the membrane (equilibrative transporter). Mediates transport of adenine, adenosine and uridine.
Mus musculus (taxid: 10090)
>sp|Q14542|S29A2_HUMAN Equilibrative nucleoside transporter 2 OS=Homo sapiens GN=SLC29A2 PE=1 SV=3 Back     alignment and function description
>sp|Q80WK7|S29A3_RAT Equilibrative nucleoside transporter 3 OS=Rattus norvegicus GN=Slc29a3 PE=1 SV=2 Back     alignment and function description
>sp|Q99808|S29A1_HUMAN Equilibrative nucleoside transporter 1 OS=Homo sapiens GN=SLC29A1 PE=1 SV=3 Back     alignment and function description
>sp|O54699|S29A2_RAT Equilibrative nucleoside transporter 2 OS=Rattus norvegicus GN=Slc29a2 PE=2 SV=1 Back     alignment and function description
>sp|Q61672|S29A2_MOUSE Equilibrative nucleoside transporter 2 OS=Mus musculus GN=Slc29a2 PE=1 SV=2 Back     alignment and function description
>sp|O54698|S29A1_RAT Equilibrative nucleoside transporter 1 OS=Rattus norvegicus GN=Slc29a1 PE=2 SV=3 Back     alignment and function description
>sp|A1A4N1|S29A3_BOVIN Equilibrative nucleoside transporter 3 OS=Bos taurus GN=SLC29A3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query88
307182978 385 Equilibrative nucleoside transporter 1 [ 0.909 0.207 0.421 5e-12
196015010 439 hypothetical protein TRIADDRAFT_61352 [T 0.659 0.132 0.568 7e-12
91081805 453 PREDICTED: similar to AGAP009114-PA [Tri 0.738 0.143 0.523 1e-11
383856861 491 PREDICTED: equilibrative nucleoside tran 0.715 0.128 0.476 2e-11
322791070 472 hypothetical protein SINV_80532 [Solenop 0.738 0.137 0.446 3e-11
307201187 471 Equilibrative nucleoside transporter 1 [ 0.715 0.133 0.507 3e-11
332018550 471 Equilibrative nucleoside transporter 1 [ 0.738 0.138 0.461 6e-11
156552507 470 PREDICTED: equilibrative nucleoside tran 0.738 0.138 0.461 2e-09
196014916 308 hypothetical protein TRIADDRAFT_61363 [T 0.761 0.217 0.470 3e-09
380011800 473 PREDICTED: equilibrative nucleoside tran 0.715 0.133 0.460 5e-09
>gi|307182978|gb|EFN69965.1| Equilibrative nucleoside transporter 1 [Camponotus floridanus] Back     alignment and taxonomy information
 Score = 75.1 bits (183), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 52/83 (62%), Gaps = 3/83 (3%)

Query: 5   HWILGLLRYWEKSYSAA---PRNNGWWVLLFSISRFVFMPLVLLCNIQPRTHLPVLITSD 61
           + I GL  Y  +  S     P+ N W V+  S++R VF+P+++ CN QPR HLPV I +D
Sbjct: 263 YLIFGLGDYAGRVLSGIFQWPKGNPWLVMFMSVARSVFIPVIMFCNAQPRHHLPVYIHND 322

Query: 62  LVYATIVLLMGLSNGYLANITFI 84
           + Y  I ++  ++NGYL N+TFI
Sbjct: 323 IYYILITVMFAITNGYLCNLTFI 345




Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|196015010|ref|XP_002117363.1| hypothetical protein TRIADDRAFT_61352 [Trichoplax adhaerens] gi|190580116|gb|EDV20202.1| hypothetical protein TRIADDRAFT_61352 [Trichoplax adhaerens] Back     alignment and taxonomy information
>gi|91081805|ref|XP_974174.1| PREDICTED: similar to AGAP009114-PA [Tribolium castaneum] gi|270006294|gb|EFA02742.1| hypothetical protein TcasGA2_TC008473 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383856861|ref|XP_003703925.1| PREDICTED: equilibrative nucleoside transporter 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|322791070|gb|EFZ15670.1| hypothetical protein SINV_80532 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307201187|gb|EFN81093.1| Equilibrative nucleoside transporter 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332018550|gb|EGI59139.1| Equilibrative nucleoside transporter 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|156552507|ref|XP_001602781.1| PREDICTED: equilibrative nucleoside transporter 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|196014916|ref|XP_002117316.1| hypothetical protein TRIADDRAFT_61363 [Trichoplax adhaerens] gi|190580069|gb|EDV20155.1| hypothetical protein TRIADDRAFT_61363 [Trichoplax adhaerens] Back     alignment and taxonomy information
>gi|380011800|ref|XP_003689982.1| PREDICTED: equilibrative nucleoside transporter 3-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query88
ZFIN|ZDB-GENE-050913-138440 slc29a1 "solute carrier family 0.681 0.136 0.416 3.8e-09
ZFIN|ZDB-GENE-050220-15450 slc29a2 "solute carrier family 0.556 0.108 0.489 6.5e-09
UNIPROTKB|E1C1Q3457 SLC29A1 "Uncharacterized prote 0.545 0.105 0.458 1.8e-08
UNIPROTKB|F1RQU4482 SLC29A1 "Uncharacterized prote 0.681 0.124 0.383 2e-08
MGI|MGI:1918529475 Slc29a3 "solute carrier family 0.625 0.115 0.5 3.2e-08
UNIPROTKB|Q3ZC83456 SLC29A1 "Solute carrier family 0.681 0.131 0.383 6.3e-08
UNIPROTKB|Q14542456 SLC29A2 "Equilibrative nucleos 0.795 0.153 0.380 6.3e-08
UNIPROTKB|F1PAA1456 SLC29A1 "Uncharacterized prote 0.681 0.131 0.383 1.3e-07
UNIPROTKB|J9P3J4456 SLC29A1 "Uncharacterized prote 0.681 0.131 0.383 1.3e-07
UNIPROTKB|F1NMA1461 SLC29A3 "Uncharacterized prote 0.772 0.147 0.391 1.7e-07
ZFIN|ZDB-GENE-050913-138 slc29a1 "solute carrier family 29 (nucleoside transporters), member 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 143 (55.4 bits), Expect = 3.8e-09, P = 3.8e-09
 Identities = 25/60 (41%), Positives = 39/60 (65%)

Query:    22 PRNNGWWVLLFSISRFVFMPLVLLCNIQPRTHLPVLITSDLVYATIVLLMGLSNGYLANI 81
             P  +  W+ +  I+R VF+PL +LCN+QPR+ LPV+ + D  Y   ++    SNGYLA++
Sbjct:   338 PGKDSIWLPILVIARVVFVPLFILCNVQPRSFLPVVFSHDAWYIIFMIFFSFSNGYLASL 397




GO:0005337 "nucleoside transmembrane transporter activity" evidence=IEA
GO:0006810 "transport" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
ZFIN|ZDB-GENE-050220-15 slc29a2 "solute carrier family 29 (nucleoside transporters), member 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C1Q3 SLC29A1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1RQU4 SLC29A1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1918529 Slc29a3 "solute carrier family 29 (nucleoside transporters), member 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZC83 SLC29A1 "Solute carrier family 29 (Nucleoside transporters), member 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q14542 SLC29A2 "Equilibrative nucleoside transporter 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PAA1 SLC29A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P3J4 SLC29A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NMA1 SLC29A3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query88
TIGR00939437 TIGR00939, 2a57, Equilibrative Nucleoside Transpor 2e-12
pfam01733305 pfam01733, Nucleoside_tran, Nucleoside transporter 1e-11
>gnl|CDD|233199 TIGR00939, 2a57, Equilibrative Nucleoside Transporter (ENT) Back     alignment and domain information
 Score = 60.5 bits (147), Expect = 2e-12
 Identities = 25/67 (37%), Positives = 38/67 (56%)

Query: 22  PRNNGWWVLLFSISRFVFMPLVLLCNIQPRTHLPVLITSDLVYATIVLLMGLSNGYLANI 81
           P  +  W+ + S  R +F+PL LLCN   R+ LPV    D  +  ++LL G SNGYL ++
Sbjct: 333 PDEDSRWLPILSFLRVLFIPLFLLCNYPQRSRLPVFFPGDAYFIILMLLFGFSNGYLGSL 392

Query: 82  TFICAAK 88
           +   A +
Sbjct: 393 SMCLAPR 399


[Transport and binding proteins, Nucleosides, purines and pyrimidines]. Length = 437

>gnl|CDD|216670 pfam01733, Nucleoside_tran, Nucleoside transporter Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 88
PF01733309 Nucleoside_tran: Nucleoside transporter; InterPro: 99.93
TIGR00939437 2a57 Equilibrative Nucleoside Transporter (ENT). 99.92
KOG1479|consensus406 99.85
>PF01733 Nucleoside_tran: Nucleoside transporter; InterPro: IPR002259 Delayed-early response (DER) gene products include growth progression factors and several unknown products of novel cDNAs Back     alignment and domain information
Probab=99.93  E-value=1.4e-27  Score=176.69  Aligned_cols=82  Identities=38%  Similarity=0.791  Sum_probs=4.0

Q ss_pred             hhhhhhhhhhcceecccCChhHHHHHHHHHHHHHHHHHHhcccCCCC-cCceeechHHHHHHHHHHHhhhhhhhhhhhee
Q psy16410          7 ILGLLRYWEKSYSAAPRNNGWWVLLFSISRFVFMPLVLLCNIQPRTH-LPVLITSDLVYATIVLLMGLSNGYLANITFIC   85 (88)
Q Consensus         7 iF~l~Gr~la~~~~~p~~~~~~l~~~s~~R~ifIPlfllcn~~~~~~-~~~~~~~D~~~~i~~~lfglTNGyl~tl~m~~   85 (88)
                      ++|++||.++++.+||.++++++++++++|++|||+|++||++|+++ +|+.++||+++++++++||+||||++|++|||
T Consensus       193 ~gD~iGR~l~~~~~~~~~~~~~l~~~s~~R~~fiPlf~~cn~~p~~~~~~~~~~~d~~~~i~~~l~g~TNGyl~tl~m~~  272 (309)
T PF01733_consen  193 LGDFIGRFLASWPRWPGPSPRWLWILSLLRFLFIPLFLLCNVQPRPRYLPVLFNSDAWFIILMLLFGFTNGYLSTLAMMY  272 (309)
T ss_dssp             --------------------------------------------------------------------------HHHH--
T ss_pred             HHHHhcchhcceeEecccccccHHHHHHHHHHHHHHHHHHHhhcccccCCCcccchHHHHHHHHHHHHccchhhhceeee
Confidence            68999999999999997788888899999999999999999998854 68999999999999999999999999999999


Q ss_pred             ccC
Q psy16410         86 AAK   88 (88)
Q Consensus        86 ~P~   88 (88)
                      ||+
T Consensus       273 ~p~  275 (309)
T PF01733_consen  273 APK  275 (309)
T ss_dssp             ---
T ss_pred             CCC
Confidence            996



Murine and human cDNAs from one novel DER gene (DER12) have been characterised to identify its product and to examine its role in the growth response []. Both sequences encode a hydrophobic 36kDa protein that is predicted to contain 8 transmembrane (TM) domains. The protein has been localised to the nucleolus, where its concentration increases following mitogen stimulation []. Although the function of the protein is unknown, its identification as a nucleolar gene transcriptionally activated by growth factors implicates it as participating in the proliferative response []. Sequence analysis reveals the protein to share a high degree of similarity with the C-terminal portion of equilibrative nucleoside transporters. These proteins are integral membrane proteins which enable the movement of hydrophilic nucleosides and nucleoside analogs down their concentration gradients across cell membranes. ENT family members have been identified in humans, mice, fish, tunicates, slime molds, and bacteria []. ; GO: 0005337 nucleoside transmembrane transporter activity, 0006810 transport, 0016020 membrane; PDB: 1HXI_A.

>TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT) Back     alignment and domain information
>KOG1479|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00