Psyllid ID: psy16416


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60----
MPLDYYYLGEVKNAETLNCLDTMGRKTGEKNVKNTRTGPKCFDNYTAEDNKYIIIYLDRQHPRT
cccccccccccccccccHHHHHHcHHcccccEEEEccccccccccccccccEEEEEEccccccc
ccccEEEEccEEcccccccccccccccccEEEEEcccccccccccccccccEEEEEEccccccc
mpldyyylgevknaetlncldtmgrktgeknvkntrtgpkcfdnytaedNKYIIIYLDRQHPRT
mpldyyylgevknaetlncldtmgrktgeknvkntrtgpkcfdnytaednkyIIIYLDRQHPRT
MPLDYYYLGEVKNAETLNCLDTMGRKTGEKNVKNTRTGPKCFDNYTAEDNKYIIIYLDRQHPRT
***DYYYLGEVKNAETLNCLDTMG************TGPKCFDNYTAEDNKYIIIYLD******
*PLDYYYLGEVKNAETLNCLDTMGRKTGEKNVKNTRTGPKCFDNYTAEDNKYIIIYLDRQ****
MPLDYYYLGEVKNAETLNCLDTMGRKTGEKNVKNTRTGPKCFDNYTAEDNKYIIIYLDRQHPRT
MPLDYYYLGEVKNAETLNCLDTMGRKTGEKNVKNTRTGPKCFDNYTAEDNKYIIIYLDRQ****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPLDYYYLGEVKNAETLNCLDTMGRKTGEKNVKNTRTGPKCFDNYTAEDNKYIIIYLDRQHPRT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query64 2.2.26 [Sep-21-2011]
Q6WV17630 Polypeptide N-acetylgalac yes N/A 0.468 0.047 0.8 2e-08
>sp|Q6WV17|GALT5_DROME Polypeptide N-acetylgalactosaminyltransferase 5 OS=Drosophila melanogaster GN=pgant5 PE=2 SV=2 Back     alignment and function desciption
 Score = 57.4 bits (137), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 26/30 (86%)

Query: 1   MPLDYYYLGEVKNAETLNCLDTMGRKTGEK 30
           MPLDYYYLGE++NAET  CLDTMGRK  EK
Sbjct: 495 MPLDYYYLGEIRNAETETCLDTMGRKYNEK 524




Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. It can both act as a peptide transferase that transfers GalNAc onto unmodified peptide substrates, and as a glycopeptide transferase that requires the prior addition of a GalNAc on a peptide before adding additional GalNAc moieties. Prefers EA2 as substrate.
Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 4EC: 1

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query64
332025155 605 Polypeptide N-acetylgalactosaminyltransf 0.453 0.047 0.827 8e-07
34042969 617 UDP-GalNAc:polypeptide N-acetylgalactosa 0.468 0.048 0.8 9e-07
16648224 536 GH23657p [Drosophila melanogaster] 0.468 0.055 0.8 9e-07
195472767 675 GE18697 [Drosophila yakuba] gi|194174771 0.468 0.044 0.8 1e-06
24581865 630 polypeptide GalNAc transferase 5, isofor 0.468 0.047 0.8 1e-06
194856530 630 GG24317 [Drosophila erecta] gi|190660637 0.468 0.047 0.8 1e-06
195386582 632 GJ24116 [Drosophila virilis] gi|19414844 0.468 0.047 0.8 1e-06
195147490 630 GL18803 [Drosophila persimilis] gi|19410 0.468 0.047 0.8 1e-06
194761562 675 GF15722 [Drosophila ananassae] gi|190616 0.468 0.044 0.8 1e-06
125985507 630 GA16368 [Drosophila pseudoobscura pseudo 0.468 0.047 0.8 1e-06
>gi|332025155|gb|EGI65335.1| Polypeptide N-acetylgalactosaminyltransferase 5 [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score = 57.8 bits (138), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 24/29 (82%), Positives = 26/29 (89%)

Query: 1   MPLDYYYLGEVKNAETLNCLDTMGRKTGE 29
           MPLDYYYLG+VKN ET  CLDTMGR+TGE
Sbjct: 469 MPLDYYYLGDVKNIETQTCLDTMGRRTGE 497




Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|34042969|gb|AAQ56702.1| UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|16648224|gb|AAL25377.1| GH23657p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195472767|ref|XP_002088670.1| GE18697 [Drosophila yakuba] gi|194174771|gb|EDW88382.1| GE18697 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|24581865|ref|NP_608906.2| polypeptide GalNAc transferase 5, isoform A [Drosophila melanogaster] gi|195342664|ref|XP_002037920.1| GM18035 [Drosophila sechellia] gi|51315874|sp|Q6WV17.2|GALT5_DROME RecName: Full=Polypeptide N-acetylgalactosaminyltransferase 5; Short=pp-GaNTase 5; AltName: Full=Protein-UDP acetylgalactosaminyltransferase 5; AltName: Full=UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 5 gi|22945641|gb|AAF52218.2| polypeptide GalNAc transferase 5, isoform A [Drosophila melanogaster] gi|194132770|gb|EDW54338.1| GM18035 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|194856530|ref|XP_001968770.1| GG24317 [Drosophila erecta] gi|190660637|gb|EDV57829.1| GG24317 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195386582|ref|XP_002051983.1| GJ24116 [Drosophila virilis] gi|194148440|gb|EDW64138.1| GJ24116 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195147490|ref|XP_002014712.1| GL18803 [Drosophila persimilis] gi|194106665|gb|EDW28708.1| GL18803 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|194761562|ref|XP_001962998.1| GF15722 [Drosophila ananassae] gi|190616695|gb|EDV32219.1| GF15722 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|125985507|ref|XP_001356517.1| GA16368 [Drosophila pseudoobscura pseudoobscura] gi|54644841|gb|EAL33581.1| GA16368 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query64
FB|FBgn0031681630 pgant5 "polypeptide GalNAc tra 0.468 0.047 0.8 1.5e-09
UNIPROTKB|Q08DM9556 GALNT13 "Uncharacterized prote 0.734 0.084 0.470 0.00018
UNIPROTKB|J9NYT5556 GALNT13 "Uncharacterized prote 0.734 0.084 0.470 0.00018
UNIPROTKB|Q8IUC8556 GALNT13 "Polypeptide N-acetylg 0.734 0.084 0.470 0.00018
MGI|MGI:2139447556 Galnt13 "UDP-N-acetyl-alpha-D- 0.734 0.084 0.470 0.00018
RGD|735044556 Galnt13 "UDP-N-acetyl-alpha-D- 0.734 0.084 0.470 0.00018
UNIPROTKB|F1PK73561 GALNT13 "Uncharacterized prote 0.734 0.083 0.470 0.00019
UNIPROTKB|Q08ER7561 GALNT13 "Polypeptide N-acetylg 0.734 0.083 0.470 0.00019
UNIPROTKB|E1C6M1556 GALNT13 "Uncharacterized prote 0.734 0.084 0.450 0.00039
ZFIN|ZDB-GENE-030131-2360557 galnt1 "UDP-N-acetyl-alpha-D-g 0.781 0.089 0.464 0.00063
FB|FBgn0031681 pgant5 "polypeptide GalNAc transferase 5" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 133 (51.9 bits), Expect = 1.5e-09, Sum P(2) = 1.5e-09
 Identities = 24/30 (80%), Positives = 26/30 (86%)

Query:     1 MPLDYYYLGEVKNAETLNCLDTMGRKTGEK 30
             MPLDYYYLGE++NAET  CLDTMGRK  EK
Sbjct:   495 MPLDYYYLGEIRNAETETCLDTMGRKYNEK 524


GO:0004653 "polypeptide N-acetylgalactosaminyltransferase activity" evidence=ISS;IDA;NAS
GO:0009312 "oligosaccharide biosynthetic process" evidence=IDA
GO:0005795 "Golgi stack" evidence=NAS
UNIPROTKB|Q08DM9 GALNT13 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9NYT5 GALNT13 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IUC8 GALNT13 "Polypeptide N-acetylgalactosaminyltransferase 13" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2139447 Galnt13 "UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|735044 Galnt13 "UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 (GalNAc-T13)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PK73 GALNT13 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q08ER7 GALNT13 "Polypeptide N-acetylgalactosaminyltransferase 13" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C6M1 GALNT13 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-2360 galnt1 "UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6WV17GALT5_DROME2, ., 4, ., 1, ., 4, 10.80.46870.0476yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 64
KOG3737|consensus603 97.77
PF00652124 Ricin_B_lectin: Ricin-type beta-trefoil lectin dom 97.34
KOG3736|consensus578 96.86
cd00161124 RICIN Ricin-type beta-trefoil; Carbohydrate-bindin 96.65
PF00652124 Ricin_B_lectin: Ricin-type beta-trefoil lectin dom 95.45
cd00161124 RICIN Ricin-type beta-trefoil; Carbohydrate-bindin 94.75
smart00458117 RICIN Ricin-type beta-trefoil. Carbohydrate-bindin 94.46
smart00458117 RICIN Ricin-type beta-trefoil. Carbohydrate-bindin 92.28
PF14200105 RicinB_lectin_2: Ricin-type beta-trefoil lectin do 88.07
PF14200105 RicinB_lectin_2: Ricin-type beta-trefoil lectin do 87.55
KOG3738|consensus559 86.22
>KOG3737|consensus Back     alignment and domain information
Probab=97.77  E-value=9.8e-06  Score=64.84  Aligned_cols=36  Identities=28%  Similarity=0.383  Sum_probs=33.1

Q ss_pred             CCceeeeEEeCCCCCcccCCCCCCCCceeEEcCCCC
Q psy16416          4 DYYYLGEVKNAETLNCLDTMGRKTGEKNVKNTRTGP   39 (64)
Q Consensus         4 D~~a~GeIRN~gS~lCLDt~gr~~g~~lGL~~C~~~   39 (64)
                      ....|||||++++..|||+||...+.++||.+|.|-
T Consensus       477 ~N~~WGE~R~~at~~ClDsMG~~p~g~mglt~CHg~  512 (603)
T KOG3737|consen  477 KNVDWGEIRGFATAYCLDSMGKTPGGFMGLTPCHGM  512 (603)
T ss_pred             CCCcchhccCcccchhHHhcCCCCCCccccccccCC
Confidence            345899999999999999999999999999999875



>PF00652 Ricin_B_lectin: Ricin-type beta-trefoil lectin domain; InterPro: IPR000772 Ricin is a legume lectin from the seeds of the castor bean plant, Ricinus communis Back     alignment and domain information
>KOG3736|consensus Back     alignment and domain information
>cd00161 RICIN Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication Back     alignment and domain information
>PF00652 Ricin_B_lectin: Ricin-type beta-trefoil lectin domain; InterPro: IPR000772 Ricin is a legume lectin from the seeds of the castor bean plant, Ricinus communis Back     alignment and domain information
>cd00161 RICIN Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication Back     alignment and domain information
>smart00458 RICIN Ricin-type beta-trefoil Back     alignment and domain information
>smart00458 RICIN Ricin-type beta-trefoil Back     alignment and domain information
>PF14200 RicinB_lectin_2: Ricin-type beta-trefoil lectin domain-like; PDB: 2X2S_C 2X2T_A 2VSE_B 2VSA_A 3EF2_A 2IHO_A 3HZB_H 1YBI_B 3PHZ_A 3NBE_A Back     alignment and domain information
>PF14200 RicinB_lectin_2: Ricin-type beta-trefoil lectin domain-like; PDB: 2X2S_C 2X2T_A 2VSE_B 2VSA_A 3EF2_A 2IHO_A 3HZB_H 1YBI_B 3PHZ_A 3NBE_A Back     alignment and domain information
>KOG3738|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query64
1xhb_A472 The Crystal Structure Of Udp-Galnac: Polypeptide Al 5e-04
>pdb|1XHB|A Chain A, The Crystal Structure Of Udp-Galnac: Polypeptide Alpha-N- Acetylgalactosaminyltransferase-T1 Length = 472 Back     alignment and structure

Iteration: 1

Score = 39.3 bits (90), Expect = 5e-04, Method: Composition-based stats. Identities = 16/30 (53%), Positives = 20/30 (66%) Query: 1 MPLDYYYLGEVKNAETLNCLDTMGRKTGEK 30 +P Y+ LGE++N ET CLD M RK EK Sbjct: 337 IPRHYFSLGEIRNVETNQCLDNMARKENEK 366

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query64
1xhb_A472 Polypeptide N-acetylgalactosaminyltransferase 1; g 98.16
2d7i_A570 Polypeptide N-acetylgalactosaminyltransferase 10; 98.05
2ffu_A501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 97.87
1knl_A130 Endo-1,4-beta-xylanase A; carbohydrate binding mod 97.71
1vcl_A 432 Hemolytic lectin CEL-III; hemolysis, hemagglutinat 96.65
1abr_B 267 Abrin-A; glycosidase/carbohydrate complex, lectin, 96.62
3a07_A118 Actinohivin; carbohydrate-binding module family 13 96.5
2d1z_A436 Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en 96.49
1abr_B 267 Abrin-A; glycosidase/carbohydrate complex, lectin, 96.24
3a21_A614 Putative secreted alpha-galactosidase; beta-alpha- 96.21
2aai_B 262 Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG 96.14
3c9z_A 258 Agglutinin II, SNA-II; beta-trefoil, ricin-B domai 95.99
1m2t_B 263 Mistletoe lectin I B chain; ribosome inactivation, 95.95
3c9z_A 258 Agglutinin II, SNA-II; beta-trefoil, ricin-B domai 95.93
1m2t_B 263 Mistletoe lectin I B chain; ribosome inactivation, 95.82
3a07_A118 Actinohivin; carbohydrate-binding module family 13 95.73
1vcl_A 432 Hemolytic lectin CEL-III; hemolysis, hemagglutinat 95.65
1knl_A130 Endo-1,4-beta-xylanase A; carbohydrate binding mod 95.55
2ao3_A130 29-kDa galactose-binding lectin; earthworm lumbric 95.5
1ggp_B 254 TKL-1, protein (lectin 1 B chain); sugar binding p 95.38
3pg0_A165 Threefoil; symmetric design, beta-trefoil, enginee 95.26
1xhb_A472 Polypeptide N-acetylgalactosaminyltransferase 1; g 95.19
2aai_B 262 Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG 94.91
2dry_A130 29-kDa galactose-binding lectin; earthworm lumbric 94.64
2vlc_A 570 Cinnamomin, type 2 ribosome-inactivating protein c 94.59
1ggp_B254 TKL-1, protein (lectin 1 B chain); sugar binding p 94.49
2dry_A130 29-kDa galactose-binding lectin; earthworm lumbric 93.92
2vlc_A 570 Cinnamomin, type 2 ribosome-inactivating protein c 93.55
3pg0_A165 Threefoil; symmetric design, beta-trefoil, enginee 93.03
2ffu_A501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 92.41
2d1z_A436 Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en 91.77
2d7i_A570 Polypeptide N-acetylgalactosaminyltransferase 10; 91.51
2ao3_A130 29-kDa galactose-binding lectin; earthworm lumbric 90.94
3vsf_A 526 Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactana 88.67
3a21_A614 Putative secreted alpha-galactosidase; beta-alpha- 88.29
3nbc_A148 Ricin B-like lectin; lactose, sugar BIND protein; 84.81
3nbc_A148 Ricin B-like lectin; lactose, sugar BIND protein; 83.94
3vsf_A526 Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactana 83.03
3phz_A 286 Ricin B-related lectin; beta trefoil, saccharide b 81.68
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Back     alignment and structure
Probab=98.16  E-value=1.3e-06  Score=62.39  Aligned_cols=39  Identities=44%  Similarity=0.675  Sum_probs=34.2

Q ss_pred             CCCCCceeeeEEeCCCCCcccCCCCCCCCceeEEcCCCC
Q psy16416          1 MPLDYYYLGEVKNAETLNCLDTMGRKTGEKNVKNTRTGP   39 (64)
Q Consensus         1 lP~D~~a~GeIRN~gS~lCLDt~gr~~g~~lGL~~C~~~   39 (64)
                      +|.+..++|+|||.++++|||.++..++.+++|++|.|.
T Consensus       337 ~p~~~~~~g~i~~~~~~~Cld~~~~~~g~~v~l~~C~~~  375 (472)
T 1xhb_A          337 IPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGM  375 (472)
T ss_dssp             SCSSEEEEECEEETTTCEEEECTTCCTTEECEEEECCSC
T ss_pred             ccccccccceEEECCCCccccccCCCCCCeEEEEeCCCC
Confidence            355566899999999999999999888999999999874



>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Back     alignment and structure
>1knl_A Endo-1,4-beta-xylanase A; carbohydrate binding module, CBM13 xylan binding domain, LEC ricin B-like, beta-trefoil fold, hydrolase; 1.20A {Streptomyces lividans} SCOP: b.42.2.1 PDB: 1knm_A* 1mc9_A* Back     alignment and structure
>1vcl_A Hemolytic lectin CEL-III; hemolysis, hemagglutination, pore-forming, calcium, toxin; HET: BTB; 1.70A {Cucumaria echinata} SCOP: b.42.2.1 b.42.2.1 d.281.1.1 PDB: 2z48_A* 2z49_A* Back     alignment and structure
>1abr_B Abrin-A; glycosidase/carbohydrate complex, lectin, lectin (agglutinin), glycoprotein, plant SEED protein, plant toxin; HET: NDG NGZ MAN BMA BGC; 2.14A {Abrus precatorius} SCOP: b.42.2.1 b.42.2.1 PDB: 2zr1_B* 2q3n_B* Back     alignment and structure
>3a07_A Actinohivin; carbohydrate-binding module family 13, antiviral protein, LE; 1.19A {Actinomycete} Back     alignment and structure
>2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A Back     alignment and structure
>1abr_B Abrin-A; glycosidase/carbohydrate complex, lectin, lectin (agglutinin), glycoprotein, plant SEED protein, plant toxin; HET: NDG NGZ MAN BMA BGC; 2.14A {Abrus precatorius} SCOP: b.42.2.1 b.42.2.1 PDB: 2zr1_B* 2q3n_B* Back     alignment and structure
>3a21_A Putative secreted alpha-galactosidase; beta-alpha-barrel, greek KEY motif, beta-jellyroll, beta-TRE hydrolase; HET: GOL 1PG EPE; 1.51A {Streptomyces avermitilis} PDB: 3a22_A* 3a23_A* Back     alignment and structure
>2aai_B Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG BMA MAN; 2.50A {Ricinus communis} SCOP: b.42.2.1 b.42.2.1 PDB: 3rti_B* 3rtj_B* 1rzo_B* Back     alignment and structure
>3c9z_A Agglutinin II, SNA-II; beta-trefoil, ricin-B domain, glycosylation, glycoprotein, L sugar binding protein, plant protein; HET: NAG FUC SO4; 1.35A {Sambucus nigra} PDB: 3ca0_A* 3ca1_A* 3ca3_A* 3ca4_A* 3ca5_A* 3ca6_A* 3cah_A* 1hwm_B* 1hwn_B* 1hwo_B* 1hwp_B* Back     alignment and structure
>1m2t_B Mistletoe lectin I B chain; ribosome inactivation, ribosome inhibitor, hydrolase; HET: NAG FUC ADE; 1.89A {Viscum album} SCOP: b.42.2.1 b.42.2.1 PDB: 2r9k_B* 3d7w_B* 3cef_B* 1sz6_B* 1pum_B* 1puu_B* 2rg9_B* 3o5w_B* 1onk_B* 1oql_B* 1tfm_B* 1pc8_B* 1yf8_B* 1ce7_B* 2mll_B* Back     alignment and structure
>3c9z_A Agglutinin II, SNA-II; beta-trefoil, ricin-B domain, glycosylation, glycoprotein, L sugar binding protein, plant protein; HET: NAG FUC SO4; 1.35A {Sambucus nigra} PDB: 3ca0_A* 3ca1_A* 3ca3_A* 3ca4_A* 3ca5_A* 3ca6_A* 3cah_A* 1hwm_B* 1hwn_B* 1hwo_B* 1hwp_B* Back     alignment and structure
>1m2t_B Mistletoe lectin I B chain; ribosome inactivation, ribosome inhibitor, hydrolase; HET: NAG FUC ADE; 1.89A {Viscum album} SCOP: b.42.2.1 b.42.2.1 PDB: 2r9k_B* 3d7w_B* 3cef_B* 1sz6_B* 1pum_B* 1puu_B* 2rg9_B* 3o5w_B* 1onk_B* 1oql_B* 1tfm_B* 1pc8_B* 1yf8_B* 1ce7_B* 2mll_B* Back     alignment and structure
>3a07_A Actinohivin; carbohydrate-binding module family 13, antiviral protein, LE; 1.19A {Actinomycete} Back     alignment and structure
>1vcl_A Hemolytic lectin CEL-III; hemolysis, hemagglutination, pore-forming, calcium, toxin; HET: BTB; 1.70A {Cucumaria echinata} SCOP: b.42.2.1 b.42.2.1 d.281.1.1 PDB: 2z48_A* 2z49_A* Back     alignment and structure
>1knl_A Endo-1,4-beta-xylanase A; carbohydrate binding module, CBM13 xylan binding domain, LEC ricin B-like, beta-trefoil fold, hydrolase; 1.20A {Streptomyces lividans} SCOP: b.42.2.1 PDB: 1knm_A* 1mc9_A* Back     alignment and structure
>1ggp_B TKL-1, protein (lectin 1 B chain); sugar binding protein; 2.70A {Trichosanthes kirilowii} SCOP: b.42.2.1 b.42.2.1 Back     alignment and structure
>3pg0_A Threefoil; symmetric design, beta-trefoil, engineered module, sugar BIN NOVO protein; HET: BTB GOL; 1.62A {Artificial gene} Back     alignment and structure
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Back     alignment and structure
>2aai_B Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG BMA MAN; 2.50A {Ricinus communis} SCOP: b.42.2.1 b.42.2.1 PDB: 3rti_B* 3rtj_B* 1rzo_B* Back     alignment and structure
>2dry_A 29-kDa galactose-binding lectin; earthworm lumbricus terrestris, sialic acid, in vitro evolution, beta-trefoil fold, sugar binding protein; HET: PGE; 1.80A {Lumbricus terrestris} PDB: 2drz_A* 2ds0_A* 2zqn_A* 2zqo_A* Back     alignment and structure
>2vlc_A Cinnamomin, type 2 ribosome-inactivating protein cinnamomin III; ribosome inhibiting proteins, toxin, hydrolase, plant defense; HET: AS5 BMA XYP XYS; 2.95A {Cinnamomum camphora} Back     alignment and structure
>1ggp_B TKL-1, protein (lectin 1 B chain); sugar binding protein; 2.70A {Trichosanthes kirilowii} SCOP: b.42.2.1 b.42.2.1 Back     alignment and structure
>2dry_A 29-kDa galactose-binding lectin; earthworm lumbricus terrestris, sialic acid, in vitro evolution, beta-trefoil fold, sugar binding protein; HET: PGE; 1.80A {Lumbricus terrestris} PDB: 2drz_A* 2ds0_A* 2zqn_A* 2zqo_A* Back     alignment and structure
>2vlc_A Cinnamomin, type 2 ribosome-inactivating protein cinnamomin III; ribosome inhibiting proteins, toxin, hydrolase, plant defense; HET: AS5 BMA XYP XYS; 2.95A {Cinnamomum camphora} Back     alignment and structure
>3pg0_A Threefoil; symmetric design, beta-trefoil, engineered module, sugar BIN NOVO protein; HET: BTB GOL; 1.62A {Artificial gene} Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Back     alignment and structure
>2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Back     alignment and structure
>3vsf_A Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactanase, sugar binding protein; 2.76A {Clostridium thermocellum} PDB: 3vsz_A* 3vt0_A* 3vt1_B* 3vt2_A* Back     alignment and structure
>3a21_A Putative secreted alpha-galactosidase; beta-alpha-barrel, greek KEY motif, beta-jellyroll, beta-TRE hydrolase; HET: GOL 1PG EPE; 1.51A {Streptomyces avermitilis} PDB: 3a22_A* 3a23_A* Back     alignment and structure
>3nbc_A Ricin B-like lectin; lactose, sugar BIND protein; HET: LAT; 1.01A {Clitocybe nebularis} PDB: 3nbd_A* 3nbe_A* Back     alignment and structure
>3nbc_A Ricin B-like lectin; lactose, sugar BIND protein; HET: LAT; 1.01A {Clitocybe nebularis} PDB: 3nbd_A* 3nbe_A* Back     alignment and structure
>3vsf_A Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactanase, sugar binding protein; 2.76A {Clostridium thermocellum} PDB: 3vsz_A* 3vt0_A* 3vt1_B* 3vt2_A* Back     alignment and structure
>3phz_A Ricin B-related lectin; beta trefoil, saccharide binding lectin, 2,6-sialyl-lactosam sugar binding protein; HET: NAG GAL SIA; 1.70A {Polyporus squamosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 64
d1xhba1131 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosa 9e-08
>d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 131 Back     information, alignment and structure

class: All beta proteins
fold: beta-Trefoil
superfamily: Ricin B-like lectins
family: Ricin B-like
domain: Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 43.3 bits (101), Expect = 9e-08
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 1  MPLDYYYLGEVKNAETLNCLDTMGRKTGEK 30
          +P  Y+ LGE++N ET  CLD M RK  EK
Sbjct: 2  IPRHYFSLGEIRNVETNQCLDNMARKENEK 31


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query64
d1xhba1131 Polypeptide N-acetylgalactosaminyltransferase 1, C 99.02
d1vcla2133 Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar 98.23
d1vcla1150 Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar 98.17
d1knma_129 Xylan binding domain, CBM13 (Endo-1,4-beta-xylanas 97.55
d1vcla1150 Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar 97.1
d1hwmb1133 Plant cytotoxin B-chain (lectin) {Sambucus ebulus, 96.7
d1ggpb1126 Plant cytotoxin B-chain (lectin) {Mongolian snake- 96.42
d1rzob1135 Plant cytotoxin B-chain (lectin) {Castor bean (Ric 96.31
d1vcla2133 Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar 96.23
d1ggpb2128 Plant cytotoxin B-chain (lectin) {Mongolian snake- 96.21
d1dqga_134 Mannose receptor {Mouse (Mus musculus) [TaxId: 100 96.14
d1xhba1131 Polypeptide N-acetylgalactosaminyltransferase 1, C 96.08
d1ggpb1126 Plant cytotoxin B-chain (lectin) {Mongolian snake- 96.07
d1abrb1140 Plant cytotoxin B-chain (lectin) {Abrus precatoriu 96.04
d1m2tb1136 Plant cytotoxin B-chain (lectin) {European mistlet 96.01
d1m2tb2126 Plant cytotoxin B-chain (lectin) {European mistlet 95.79
d1ggpb2128 Plant cytotoxin B-chain (lectin) {Mongolian snake- 95.34
d2aaib2127 Plant cytotoxin B-chain (lectin) {Castor bean (Ric 95.33
d1hwmb2131 Plant cytotoxin B-chain (lectin) {Sambucus ebulus, 95.29
d1knma_129 Xylan binding domain, CBM13 (Endo-1,4-beta-xylanas 95.15
d1dqga_134 Mannose receptor {Mouse (Mus musculus) [TaxId: 100 94.92
d1abrb2127 Plant cytotoxin B-chain (lectin) {Abrus precatoriu 94.69
d1hwmb1133 Plant cytotoxin B-chain (lectin) {Sambucus ebulus, 94.62
d2aaib2127 Plant cytotoxin B-chain (lectin) {Castor bean (Ric 94.38
d1sr4a_167 Cytolethal distending toxin subunit A {Haemophilus 93.76
d1m2tb2126 Plant cytotoxin B-chain (lectin) {European mistlet 92.99
d1rzob1135 Plant cytotoxin B-chain (lectin) {Castor bean (Ric 92.08
d2ihoa1154 Agglutinin MOA, N-terminal domain {Fairy-ring mush 91.67
d2zqna1130 29-kDa galactose-binding lectin {Lumbricus terrest 91.57
d1abrb2127 Plant cytotoxin B-chain (lectin) {Abrus precatoriu 91.41
d1hwmb2131 Plant cytotoxin B-chain (lectin) {Sambucus ebulus, 90.98
d1abrb1140 Plant cytotoxin B-chain (lectin) {Abrus precatoriu 88.94
d1m2tb1136 Plant cytotoxin B-chain (lectin) {European mistlet 88.87
d2zqna1130 29-kDa galactose-binding lectin {Lumbricus terrest 87.69
d2ihoa1154 Agglutinin MOA, N-terminal domain {Fairy-ring mush 83.52
>d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: beta-Trefoil
superfamily: Ricin B-like lectins
family: Ricin B-like
domain: Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.02  E-value=5.9e-11  Score=72.49  Aligned_cols=39  Identities=44%  Similarity=0.675  Sum_probs=36.7

Q ss_pred             CCCCCceeeeEEeCCCCCcccCCCCCCCCceeEEcCCCC
Q psy16416          1 MPLDYYYLGEVKNAETLNCLDTMGRKTGEKNVKNTRTGP   39 (64)
Q Consensus         1 lP~D~~a~GeIRN~gS~lCLDt~gr~~g~~lGL~~C~~~   39 (64)
                      ||.++++||+|||.++++|||++++.++.+++|++|.+.
T Consensus         2 ~p~~~~~~G~Irn~~s~~CLd~~~~~~g~~v~l~~C~~~   40 (131)
T d1xhba1           2 IPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGM   40 (131)
T ss_dssp             SCSSEEEEECEEETTTCEEEECTTCCTTEECEEEECCSC
T ss_pred             CCCCcEEEEEEEECCCCccEecCCCCCCCeEEEEEcCCC
Confidence            699999999999999999999999999999999999875



>d1vcla2 b.42.2.1 (A:151-283) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1vcla1 b.42.2.1 (A:1-150) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1knma_ b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1vcla1 b.42.2.1 (A:1-150) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1hwmb1 b.42.2.1 (B:3-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Back     information, alignment and structure
>d1ggpb1 b.42.2.1 (B:11-140) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Back     information, alignment and structure
>d1rzob1 b.42.2.1 (B:2001-2135) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Back     information, alignment and structure
>d1vcla2 b.42.2.1 (A:151-283) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1ggpb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Back     information, alignment and structure
>d1dqga_ b.42.2.2 (A:) Mannose receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ggpb1 b.42.2.1 (B:11-140) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Back     information, alignment and structure
>d1abrb1 b.42.2.1 (B:1-140) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Back     information, alignment and structure
>d1m2tb1 b.42.2.1 (B:249-384) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Back     information, alignment and structure
>d1m2tb2 b.42.2.1 (B:385-510) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Back     information, alignment and structure
>d1ggpb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Back     information, alignment and structure
>d2aaib2 b.42.2.1 (B:136-262) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Back     information, alignment and structure
>d1hwmb2 b.42.2.1 (B:136-266) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Back     information, alignment and structure
>d1knma_ b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1dqga_ b.42.2.2 (A:) Mannose receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1abrb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Back     information, alignment and structure
>d1hwmb1 b.42.2.1 (B:3-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Back     information, alignment and structure
>d2aaib2 b.42.2.1 (B:136-262) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Back     information, alignment and structure
>d1sr4a_ b.42.2.1 (A:) Cytolethal distending toxin subunit A {Haemophilus ducreyi [TaxId: 730]} Back     information, alignment and structure
>d1m2tb2 b.42.2.1 (B:385-510) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Back     information, alignment and structure
>d1rzob1 b.42.2.1 (B:2001-2135) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Back     information, alignment and structure
>d2ihoa1 b.42.2.1 (A:2-155) Agglutinin MOA, N-terminal domain {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]} Back     information, alignment and structure
>d2zqna1 b.42.2.1 (A:131-260) 29-kDa galactose-binding lectin {Lumbricus terrestris [TaxId: 6398]} Back     information, alignment and structure
>d1abrb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Back     information, alignment and structure
>d1hwmb2 b.42.2.1 (B:136-266) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Back     information, alignment and structure
>d1abrb1 b.42.2.1 (B:1-140) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Back     information, alignment and structure
>d1m2tb1 b.42.2.1 (B:249-384) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Back     information, alignment and structure
>d2zqna1 b.42.2.1 (A:131-260) 29-kDa galactose-binding lectin {Lumbricus terrestris [TaxId: 6398]} Back     information, alignment and structure
>d2ihoa1 b.42.2.1 (A:2-155) Agglutinin MOA, N-terminal domain {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]} Back     information, alignment and structure