Psyllid ID: psy16416
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 64 | ||||||
| 332025155 | 605 | Polypeptide N-acetylgalactosaminyltransf | 0.453 | 0.047 | 0.827 | 8e-07 | |
| 34042969 | 617 | UDP-GalNAc:polypeptide N-acetylgalactosa | 0.468 | 0.048 | 0.8 | 9e-07 | |
| 16648224 | 536 | GH23657p [Drosophila melanogaster] | 0.468 | 0.055 | 0.8 | 9e-07 | |
| 195472767 | 675 | GE18697 [Drosophila yakuba] gi|194174771 | 0.468 | 0.044 | 0.8 | 1e-06 | |
| 24581865 | 630 | polypeptide GalNAc transferase 5, isofor | 0.468 | 0.047 | 0.8 | 1e-06 | |
| 194856530 | 630 | GG24317 [Drosophila erecta] gi|190660637 | 0.468 | 0.047 | 0.8 | 1e-06 | |
| 195386582 | 632 | GJ24116 [Drosophila virilis] gi|19414844 | 0.468 | 0.047 | 0.8 | 1e-06 | |
| 195147490 | 630 | GL18803 [Drosophila persimilis] gi|19410 | 0.468 | 0.047 | 0.8 | 1e-06 | |
| 194761562 | 675 | GF15722 [Drosophila ananassae] gi|190616 | 0.468 | 0.044 | 0.8 | 1e-06 | |
| 125985507 | 630 | GA16368 [Drosophila pseudoobscura pseudo | 0.468 | 0.047 | 0.8 | 1e-06 |
| >gi|332025155|gb|EGI65335.1| Polypeptide N-acetylgalactosaminyltransferase 5 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
Score = 57.8 bits (138), Expect = 8e-07, Method: Composition-based stats.
Identities = 24/29 (82%), Positives = 26/29 (89%)
Query: 1 MPLDYYYLGEVKNAETLNCLDTMGRKTGE 29
MPLDYYYLG+VKN ET CLDTMGR+TGE
Sbjct: 469 MPLDYYYLGDVKNIETQTCLDTMGRRTGE 497
|
Source: Acromyrmex echinatior Species: Acromyrmex echinatior Genus: Acromyrmex Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|34042969|gb|AAQ56702.1| UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|16648224|gb|AAL25377.1| GH23657p [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195472767|ref|XP_002088670.1| GE18697 [Drosophila yakuba] gi|194174771|gb|EDW88382.1| GE18697 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|24581865|ref|NP_608906.2| polypeptide GalNAc transferase 5, isoform A [Drosophila melanogaster] gi|195342664|ref|XP_002037920.1| GM18035 [Drosophila sechellia] gi|51315874|sp|Q6WV17.2|GALT5_DROME RecName: Full=Polypeptide N-acetylgalactosaminyltransferase 5; Short=pp-GaNTase 5; AltName: Full=Protein-UDP acetylgalactosaminyltransferase 5; AltName: Full=UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 5 gi|22945641|gb|AAF52218.2| polypeptide GalNAc transferase 5, isoform A [Drosophila melanogaster] gi|194132770|gb|EDW54338.1| GM18035 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|194856530|ref|XP_001968770.1| GG24317 [Drosophila erecta] gi|190660637|gb|EDV57829.1| GG24317 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|195386582|ref|XP_002051983.1| GJ24116 [Drosophila virilis] gi|194148440|gb|EDW64138.1| GJ24116 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|195147490|ref|XP_002014712.1| GL18803 [Drosophila persimilis] gi|194106665|gb|EDW28708.1| GL18803 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
| >gi|194761562|ref|XP_001962998.1| GF15722 [Drosophila ananassae] gi|190616695|gb|EDV32219.1| GF15722 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|125985507|ref|XP_001356517.1| GA16368 [Drosophila pseudoobscura pseudoobscura] gi|54644841|gb|EAL33581.1| GA16368 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 64 | ||||||
| FB|FBgn0031681 | 630 | pgant5 "polypeptide GalNAc tra | 0.468 | 0.047 | 0.8 | 1.5e-09 | |
| UNIPROTKB|Q08DM9 | 556 | GALNT13 "Uncharacterized prote | 0.734 | 0.084 | 0.470 | 0.00018 | |
| UNIPROTKB|J9NYT5 | 556 | GALNT13 "Uncharacterized prote | 0.734 | 0.084 | 0.470 | 0.00018 | |
| UNIPROTKB|Q8IUC8 | 556 | GALNT13 "Polypeptide N-acetylg | 0.734 | 0.084 | 0.470 | 0.00018 | |
| MGI|MGI:2139447 | 556 | Galnt13 "UDP-N-acetyl-alpha-D- | 0.734 | 0.084 | 0.470 | 0.00018 | |
| RGD|735044 | 556 | Galnt13 "UDP-N-acetyl-alpha-D- | 0.734 | 0.084 | 0.470 | 0.00018 | |
| UNIPROTKB|F1PK73 | 561 | GALNT13 "Uncharacterized prote | 0.734 | 0.083 | 0.470 | 0.00019 | |
| UNIPROTKB|Q08ER7 | 561 | GALNT13 "Polypeptide N-acetylg | 0.734 | 0.083 | 0.470 | 0.00019 | |
| UNIPROTKB|E1C6M1 | 556 | GALNT13 "Uncharacterized prote | 0.734 | 0.084 | 0.450 | 0.00039 | |
| ZFIN|ZDB-GENE-030131-2360 | 557 | galnt1 "UDP-N-acetyl-alpha-D-g | 0.781 | 0.089 | 0.464 | 0.00063 |
| FB|FBgn0031681 pgant5 "polypeptide GalNAc transferase 5" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 133 (51.9 bits), Expect = 1.5e-09, Sum P(2) = 1.5e-09
Identities = 24/30 (80%), Positives = 26/30 (86%)
Query: 1 MPLDYYYLGEVKNAETLNCLDTMGRKTGEK 30
MPLDYYYLGE++NAET CLDTMGRK EK
Sbjct: 495 MPLDYYYLGEIRNAETETCLDTMGRKYNEK 524
|
|
| UNIPROTKB|Q08DM9 GALNT13 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NYT5 GALNT13 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8IUC8 GALNT13 "Polypeptide N-acetylgalactosaminyltransferase 13" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2139447 Galnt13 "UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|735044 Galnt13 "UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 (GalNAc-T13)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PK73 GALNT13 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q08ER7 GALNT13 "Polypeptide N-acetylgalactosaminyltransferase 13" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C6M1 GALNT13 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-2360 galnt1 "UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 64 | |||
| KOG3737|consensus | 603 | 97.77 | ||
| PF00652 | 124 | Ricin_B_lectin: Ricin-type beta-trefoil lectin dom | 97.34 | |
| KOG3736|consensus | 578 | 96.86 | ||
| cd00161 | 124 | RICIN Ricin-type beta-trefoil; Carbohydrate-bindin | 96.65 | |
| PF00652 | 124 | Ricin_B_lectin: Ricin-type beta-trefoil lectin dom | 95.45 | |
| cd00161 | 124 | RICIN Ricin-type beta-trefoil; Carbohydrate-bindin | 94.75 | |
| smart00458 | 117 | RICIN Ricin-type beta-trefoil. Carbohydrate-bindin | 94.46 | |
| smart00458 | 117 | RICIN Ricin-type beta-trefoil. Carbohydrate-bindin | 92.28 | |
| PF14200 | 105 | RicinB_lectin_2: Ricin-type beta-trefoil lectin do | 88.07 | |
| PF14200 | 105 | RicinB_lectin_2: Ricin-type beta-trefoil lectin do | 87.55 | |
| KOG3738|consensus | 559 | 86.22 |
| >KOG3737|consensus | Back alignment and domain information |
|---|
Probab=97.77 E-value=9.8e-06 Score=64.84 Aligned_cols=36 Identities=28% Similarity=0.383 Sum_probs=33.1
Q ss_pred CCceeeeEEeCCCCCcccCCCCCCCCceeEEcCCCC
Q psy16416 4 DYYYLGEVKNAETLNCLDTMGRKTGEKNVKNTRTGP 39 (64)
Q Consensus 4 D~~a~GeIRN~gS~lCLDt~gr~~g~~lGL~~C~~~ 39 (64)
....|||||++++..|||+||...+.++||.+|.|-
T Consensus 477 ~N~~WGE~R~~at~~ClDsMG~~p~g~mglt~CHg~ 512 (603)
T KOG3737|consen 477 KNVDWGEIRGFATAYCLDSMGKTPGGFMGLTPCHGM 512 (603)
T ss_pred CCCcchhccCcccchhHHhcCCCCCCccccccccCC
Confidence 345899999999999999999999999999999875
|
|
| >PF00652 Ricin_B_lectin: Ricin-type beta-trefoil lectin domain; InterPro: IPR000772 Ricin is a legume lectin from the seeds of the castor bean plant, Ricinus communis | Back alignment and domain information |
|---|
| >KOG3736|consensus | Back alignment and domain information |
|---|
| >cd00161 RICIN Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication | Back alignment and domain information |
|---|
| >PF00652 Ricin_B_lectin: Ricin-type beta-trefoil lectin domain; InterPro: IPR000772 Ricin is a legume lectin from the seeds of the castor bean plant, Ricinus communis | Back alignment and domain information |
|---|
| >cd00161 RICIN Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication | Back alignment and domain information |
|---|
| >smart00458 RICIN Ricin-type beta-trefoil | Back alignment and domain information |
|---|
| >smart00458 RICIN Ricin-type beta-trefoil | Back alignment and domain information |
|---|
| >PF14200 RicinB_lectin_2: Ricin-type beta-trefoil lectin domain-like; PDB: 2X2S_C 2X2T_A 2VSE_B 2VSA_A 3EF2_A 2IHO_A 3HZB_H 1YBI_B 3PHZ_A 3NBE_A | Back alignment and domain information |
|---|
| >PF14200 RicinB_lectin_2: Ricin-type beta-trefoil lectin domain-like; PDB: 2X2S_C 2X2T_A 2VSE_B 2VSA_A 3EF2_A 2IHO_A 3HZB_H 1YBI_B 3PHZ_A 3NBE_A | Back alignment and domain information |
|---|
| >KOG3738|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 64 | ||||
| 1xhb_A | 472 | The Crystal Structure Of Udp-Galnac: Polypeptide Al | 5e-04 |
| >pdb|1XHB|A Chain A, The Crystal Structure Of Udp-Galnac: Polypeptide Alpha-N- Acetylgalactosaminyltransferase-T1 Length = 472 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 64 | |||
| 1xhb_A | 472 | Polypeptide N-acetylgalactosaminyltransferase 1; g | 98.16 | |
| 2d7i_A | 570 | Polypeptide N-acetylgalactosaminyltransferase 10; | 98.05 | |
| 2ffu_A | 501 | Ppgalnact-2, polypeptide N-acetylgalactosaminyltra | 97.87 | |
| 1knl_A | 130 | Endo-1,4-beta-xylanase A; carbohydrate binding mod | 97.71 | |
| 1vcl_A | 432 | Hemolytic lectin CEL-III; hemolysis, hemagglutinat | 96.65 | |
| 1abr_B | 267 | Abrin-A; glycosidase/carbohydrate complex, lectin, | 96.62 | |
| 3a07_A | 118 | Actinohivin; carbohydrate-binding module family 13 | 96.5 | |
| 2d1z_A | 436 | Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en | 96.49 | |
| 1abr_B | 267 | Abrin-A; glycosidase/carbohydrate complex, lectin, | 96.24 | |
| 3a21_A | 614 | Putative secreted alpha-galactosidase; beta-alpha- | 96.21 | |
| 2aai_B | 262 | Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG | 96.14 | |
| 3c9z_A | 258 | Agglutinin II, SNA-II; beta-trefoil, ricin-B domai | 95.99 | |
| 1m2t_B | 263 | Mistletoe lectin I B chain; ribosome inactivation, | 95.95 | |
| 3c9z_A | 258 | Agglutinin II, SNA-II; beta-trefoil, ricin-B domai | 95.93 | |
| 1m2t_B | 263 | Mistletoe lectin I B chain; ribosome inactivation, | 95.82 | |
| 3a07_A | 118 | Actinohivin; carbohydrate-binding module family 13 | 95.73 | |
| 1vcl_A | 432 | Hemolytic lectin CEL-III; hemolysis, hemagglutinat | 95.65 | |
| 1knl_A | 130 | Endo-1,4-beta-xylanase A; carbohydrate binding mod | 95.55 | |
| 2ao3_A | 130 | 29-kDa galactose-binding lectin; earthworm lumbric | 95.5 | |
| 1ggp_B | 254 | TKL-1, protein (lectin 1 B chain); sugar binding p | 95.38 | |
| 3pg0_A | 165 | Threefoil; symmetric design, beta-trefoil, enginee | 95.26 | |
| 1xhb_A | 472 | Polypeptide N-acetylgalactosaminyltransferase 1; g | 95.19 | |
| 2aai_B | 262 | Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG | 94.91 | |
| 2dry_A | 130 | 29-kDa galactose-binding lectin; earthworm lumbric | 94.64 | |
| 2vlc_A | 570 | Cinnamomin, type 2 ribosome-inactivating protein c | 94.59 | |
| 1ggp_B | 254 | TKL-1, protein (lectin 1 B chain); sugar binding p | 94.49 | |
| 2dry_A | 130 | 29-kDa galactose-binding lectin; earthworm lumbric | 93.92 | |
| 2vlc_A | 570 | Cinnamomin, type 2 ribosome-inactivating protein c | 93.55 | |
| 3pg0_A | 165 | Threefoil; symmetric design, beta-trefoil, enginee | 93.03 | |
| 2ffu_A | 501 | Ppgalnact-2, polypeptide N-acetylgalactosaminyltra | 92.41 | |
| 2d1z_A | 436 | Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en | 91.77 | |
| 2d7i_A | 570 | Polypeptide N-acetylgalactosaminyltransferase 10; | 91.51 | |
| 2ao3_A | 130 | 29-kDa galactose-binding lectin; earthworm lumbric | 90.94 | |
| 3vsf_A | 526 | Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactana | 88.67 | |
| 3a21_A | 614 | Putative secreted alpha-galactosidase; beta-alpha- | 88.29 | |
| 3nbc_A | 148 | Ricin B-like lectin; lactose, sugar BIND protein; | 84.81 | |
| 3nbc_A | 148 | Ricin B-like lectin; lactose, sugar BIND protein; | 83.94 | |
| 3vsf_A | 526 | Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactana | 83.03 | |
| 3phz_A | 286 | Ricin B-related lectin; beta trefoil, saccharide b | 81.68 |
| >1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 | Back alignment and structure |
|---|
Probab=98.16 E-value=1.3e-06 Score=62.39 Aligned_cols=39 Identities=44% Similarity=0.675 Sum_probs=34.2
Q ss_pred CCCCCceeeeEEeCCCCCcccCCCCCCCCceeEEcCCCC
Q psy16416 1 MPLDYYYLGEVKNAETLNCLDTMGRKTGEKNVKNTRTGP 39 (64)
Q Consensus 1 lP~D~~a~GeIRN~gS~lCLDt~gr~~g~~lGL~~C~~~ 39 (64)
+|.+..++|+|||.++++|||.++..++.+++|++|.|.
T Consensus 337 ~p~~~~~~g~i~~~~~~~Cld~~~~~~g~~v~l~~C~~~ 375 (472)
T 1xhb_A 337 IPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGM 375 (472)
T ss_dssp SCSSEEEEECEEETTTCEEEECTTCCTTEECEEEECCSC
T ss_pred ccccccccceEEECCCCccccccCCCCCCeEEEEeCCCC
Confidence 355566899999999999999999888999999999874
|
| >2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* | Back alignment and structure |
|---|
| >2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* | Back alignment and structure |
|---|
| >1knl_A Endo-1,4-beta-xylanase A; carbohydrate binding module, CBM13 xylan binding domain, LEC ricin B-like, beta-trefoil fold, hydrolase; 1.20A {Streptomyces lividans} SCOP: b.42.2.1 PDB: 1knm_A* 1mc9_A* | Back alignment and structure |
|---|
| >1vcl_A Hemolytic lectin CEL-III; hemolysis, hemagglutination, pore-forming, calcium, toxin; HET: BTB; 1.70A {Cucumaria echinata} SCOP: b.42.2.1 b.42.2.1 d.281.1.1 PDB: 2z48_A* 2z49_A* | Back alignment and structure |
|---|
| >1abr_B Abrin-A; glycosidase/carbohydrate complex, lectin, lectin (agglutinin), glycoprotein, plant SEED protein, plant toxin; HET: NDG NGZ MAN BMA BGC; 2.14A {Abrus precatorius} SCOP: b.42.2.1 b.42.2.1 PDB: 2zr1_B* 2q3n_B* | Back alignment and structure |
|---|
| >3a07_A Actinohivin; carbohydrate-binding module family 13, antiviral protein, LE; 1.19A {Actinomycete} | Back alignment and structure |
|---|
| >2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A | Back alignment and structure |
|---|
| >1abr_B Abrin-A; glycosidase/carbohydrate complex, lectin, lectin (agglutinin), glycoprotein, plant SEED protein, plant toxin; HET: NDG NGZ MAN BMA BGC; 2.14A {Abrus precatorius} SCOP: b.42.2.1 b.42.2.1 PDB: 2zr1_B* 2q3n_B* | Back alignment and structure |
|---|
| >3a21_A Putative secreted alpha-galactosidase; beta-alpha-barrel, greek KEY motif, beta-jellyroll, beta-TRE hydrolase; HET: GOL 1PG EPE; 1.51A {Streptomyces avermitilis} PDB: 3a22_A* 3a23_A* | Back alignment and structure |
|---|
| >2aai_B Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG BMA MAN; 2.50A {Ricinus communis} SCOP: b.42.2.1 b.42.2.1 PDB: 3rti_B* 3rtj_B* 1rzo_B* | Back alignment and structure |
|---|
| >3c9z_A Agglutinin II, SNA-II; beta-trefoil, ricin-B domain, glycosylation, glycoprotein, L sugar binding protein, plant protein; HET: NAG FUC SO4; 1.35A {Sambucus nigra} PDB: 3ca0_A* 3ca1_A* 3ca3_A* 3ca4_A* 3ca5_A* 3ca6_A* 3cah_A* 1hwm_B* 1hwn_B* 1hwo_B* 1hwp_B* | Back alignment and structure |
|---|
| >1m2t_B Mistletoe lectin I B chain; ribosome inactivation, ribosome inhibitor, hydrolase; HET: NAG FUC ADE; 1.89A {Viscum album} SCOP: b.42.2.1 b.42.2.1 PDB: 2r9k_B* 3d7w_B* 3cef_B* 1sz6_B* 1pum_B* 1puu_B* 2rg9_B* 3o5w_B* 1onk_B* 1oql_B* 1tfm_B* 1pc8_B* 1yf8_B* 1ce7_B* 2mll_B* | Back alignment and structure |
|---|
| >3c9z_A Agglutinin II, SNA-II; beta-trefoil, ricin-B domain, glycosylation, glycoprotein, L sugar binding protein, plant protein; HET: NAG FUC SO4; 1.35A {Sambucus nigra} PDB: 3ca0_A* 3ca1_A* 3ca3_A* 3ca4_A* 3ca5_A* 3ca6_A* 3cah_A* 1hwm_B* 1hwn_B* 1hwo_B* 1hwp_B* | Back alignment and structure |
|---|
| >1m2t_B Mistletoe lectin I B chain; ribosome inactivation, ribosome inhibitor, hydrolase; HET: NAG FUC ADE; 1.89A {Viscum album} SCOP: b.42.2.1 b.42.2.1 PDB: 2r9k_B* 3d7w_B* 3cef_B* 1sz6_B* 1pum_B* 1puu_B* 2rg9_B* 3o5w_B* 1onk_B* 1oql_B* 1tfm_B* 1pc8_B* 1yf8_B* 1ce7_B* 2mll_B* | Back alignment and structure |
|---|
| >3a07_A Actinohivin; carbohydrate-binding module family 13, antiviral protein, LE; 1.19A {Actinomycete} | Back alignment and structure |
|---|
| >1vcl_A Hemolytic lectin CEL-III; hemolysis, hemagglutination, pore-forming, calcium, toxin; HET: BTB; 1.70A {Cucumaria echinata} SCOP: b.42.2.1 b.42.2.1 d.281.1.1 PDB: 2z48_A* 2z49_A* | Back alignment and structure |
|---|
| >1knl_A Endo-1,4-beta-xylanase A; carbohydrate binding module, CBM13 xylan binding domain, LEC ricin B-like, beta-trefoil fold, hydrolase; 1.20A {Streptomyces lividans} SCOP: b.42.2.1 PDB: 1knm_A* 1mc9_A* | Back alignment and structure |
|---|
| >1ggp_B TKL-1, protein (lectin 1 B chain); sugar binding protein; 2.70A {Trichosanthes kirilowii} SCOP: b.42.2.1 b.42.2.1 | Back alignment and structure |
|---|
| >3pg0_A Threefoil; symmetric design, beta-trefoil, engineered module, sugar BIN NOVO protein; HET: BTB GOL; 1.62A {Artificial gene} | Back alignment and structure |
|---|
| >1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 | Back alignment and structure |
|---|
| >2aai_B Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG BMA MAN; 2.50A {Ricinus communis} SCOP: b.42.2.1 b.42.2.1 PDB: 3rti_B* 3rtj_B* 1rzo_B* | Back alignment and structure |
|---|
| >2dry_A 29-kDa galactose-binding lectin; earthworm lumbricus terrestris, sialic acid, in vitro evolution, beta-trefoil fold, sugar binding protein; HET: PGE; 1.80A {Lumbricus terrestris} PDB: 2drz_A* 2ds0_A* 2zqn_A* 2zqo_A* | Back alignment and structure |
|---|
| >2vlc_A Cinnamomin, type 2 ribosome-inactivating protein cinnamomin III; ribosome inhibiting proteins, toxin, hydrolase, plant defense; HET: AS5 BMA XYP XYS; 2.95A {Cinnamomum camphora} | Back alignment and structure |
|---|
| >1ggp_B TKL-1, protein (lectin 1 B chain); sugar binding protein; 2.70A {Trichosanthes kirilowii} SCOP: b.42.2.1 b.42.2.1 | Back alignment and structure |
|---|
| >2dry_A 29-kDa galactose-binding lectin; earthworm lumbricus terrestris, sialic acid, in vitro evolution, beta-trefoil fold, sugar binding protein; HET: PGE; 1.80A {Lumbricus terrestris} PDB: 2drz_A* 2ds0_A* 2zqn_A* 2zqo_A* | Back alignment and structure |
|---|
| >2vlc_A Cinnamomin, type 2 ribosome-inactivating protein cinnamomin III; ribosome inhibiting proteins, toxin, hydrolase, plant defense; HET: AS5 BMA XYP XYS; 2.95A {Cinnamomum camphora} | Back alignment and structure |
|---|
| >3pg0_A Threefoil; symmetric design, beta-trefoil, engineered module, sugar BIN NOVO protein; HET: BTB GOL; 1.62A {Artificial gene} | Back alignment and structure |
|---|
| >2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* | Back alignment and structure |
|---|
| >2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A | Back alignment and structure |
|---|
| >2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* | Back alignment and structure |
|---|
| >3vsf_A Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactanase, sugar binding protein; 2.76A {Clostridium thermocellum} PDB: 3vsz_A* 3vt0_A* 3vt1_B* 3vt2_A* | Back alignment and structure |
|---|
| >3a21_A Putative secreted alpha-galactosidase; beta-alpha-barrel, greek KEY motif, beta-jellyroll, beta-TRE hydrolase; HET: GOL 1PG EPE; 1.51A {Streptomyces avermitilis} PDB: 3a22_A* 3a23_A* | Back alignment and structure |
|---|
| >3nbc_A Ricin B-like lectin; lactose, sugar BIND protein; HET: LAT; 1.01A {Clitocybe nebularis} PDB: 3nbd_A* 3nbe_A* | Back alignment and structure |
|---|
| >3nbc_A Ricin B-like lectin; lactose, sugar BIND protein; HET: LAT; 1.01A {Clitocybe nebularis} PDB: 3nbd_A* 3nbe_A* | Back alignment and structure |
|---|
| >3vsf_A Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactanase, sugar binding protein; 2.76A {Clostridium thermocellum} PDB: 3vsz_A* 3vt0_A* 3vt1_B* 3vt2_A* | Back alignment and structure |
|---|
| >3phz_A Ricin B-related lectin; beta trefoil, saccharide binding lectin, 2,6-sialyl-lactosam sugar binding protein; HET: NAG GAL SIA; 1.70A {Polyporus squamosus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 64 | ||||
| d1xhba1 | 131 | b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosa | 9e-08 |
| >d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 131 | Back information, alignment and structure |
|---|
class: All beta proteins fold: beta-Trefoil superfamily: Ricin B-like lectins family: Ricin B-like domain: Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 43.3 bits (101), Expect = 9e-08
Identities = 16/30 (53%), Positives = 20/30 (66%)
Query: 1 MPLDYYYLGEVKNAETLNCLDTMGRKTGEK 30
+P Y+ LGE++N ET CLD M RK EK
Sbjct: 2 IPRHYFSLGEIRNVETNQCLDNMARKENEK 31
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 64 | |||
| d1xhba1 | 131 | Polypeptide N-acetylgalactosaminyltransferase 1, C | 99.02 | |
| d1vcla2 | 133 | Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar | 98.23 | |
| d1vcla1 | 150 | Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar | 98.17 | |
| d1knma_ | 129 | Xylan binding domain, CBM13 (Endo-1,4-beta-xylanas | 97.55 | |
| d1vcla1 | 150 | Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar | 97.1 | |
| d1hwmb1 | 133 | Plant cytotoxin B-chain (lectin) {Sambucus ebulus, | 96.7 | |
| d1ggpb1 | 126 | Plant cytotoxin B-chain (lectin) {Mongolian snake- | 96.42 | |
| d1rzob1 | 135 | Plant cytotoxin B-chain (lectin) {Castor bean (Ric | 96.31 | |
| d1vcla2 | 133 | Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar | 96.23 | |
| d1ggpb2 | 128 | Plant cytotoxin B-chain (lectin) {Mongolian snake- | 96.21 | |
| d1dqga_ | 134 | Mannose receptor {Mouse (Mus musculus) [TaxId: 100 | 96.14 | |
| d1xhba1 | 131 | Polypeptide N-acetylgalactosaminyltransferase 1, C | 96.08 | |
| d1ggpb1 | 126 | Plant cytotoxin B-chain (lectin) {Mongolian snake- | 96.07 | |
| d1abrb1 | 140 | Plant cytotoxin B-chain (lectin) {Abrus precatoriu | 96.04 | |
| d1m2tb1 | 136 | Plant cytotoxin B-chain (lectin) {European mistlet | 96.01 | |
| d1m2tb2 | 126 | Plant cytotoxin B-chain (lectin) {European mistlet | 95.79 | |
| d1ggpb2 | 128 | Plant cytotoxin B-chain (lectin) {Mongolian snake- | 95.34 | |
| d2aaib2 | 127 | Plant cytotoxin B-chain (lectin) {Castor bean (Ric | 95.33 | |
| d1hwmb2 | 131 | Plant cytotoxin B-chain (lectin) {Sambucus ebulus, | 95.29 | |
| d1knma_ | 129 | Xylan binding domain, CBM13 (Endo-1,4-beta-xylanas | 95.15 | |
| d1dqga_ | 134 | Mannose receptor {Mouse (Mus musculus) [TaxId: 100 | 94.92 | |
| d1abrb2 | 127 | Plant cytotoxin B-chain (lectin) {Abrus precatoriu | 94.69 | |
| d1hwmb1 | 133 | Plant cytotoxin B-chain (lectin) {Sambucus ebulus, | 94.62 | |
| d2aaib2 | 127 | Plant cytotoxin B-chain (lectin) {Castor bean (Ric | 94.38 | |
| d1sr4a_ | 167 | Cytolethal distending toxin subunit A {Haemophilus | 93.76 | |
| d1m2tb2 | 126 | Plant cytotoxin B-chain (lectin) {European mistlet | 92.99 | |
| d1rzob1 | 135 | Plant cytotoxin B-chain (lectin) {Castor bean (Ric | 92.08 | |
| d2ihoa1 | 154 | Agglutinin MOA, N-terminal domain {Fairy-ring mush | 91.67 | |
| d2zqna1 | 130 | 29-kDa galactose-binding lectin {Lumbricus terrest | 91.57 | |
| d1abrb2 | 127 | Plant cytotoxin B-chain (lectin) {Abrus precatoriu | 91.41 | |
| d1hwmb2 | 131 | Plant cytotoxin B-chain (lectin) {Sambucus ebulus, | 90.98 | |
| d1abrb1 | 140 | Plant cytotoxin B-chain (lectin) {Abrus precatoriu | 88.94 | |
| d1m2tb1 | 136 | Plant cytotoxin B-chain (lectin) {European mistlet | 88.87 | |
| d2zqna1 | 130 | 29-kDa galactose-binding lectin {Lumbricus terrest | 87.69 | |
| d2ihoa1 | 154 | Agglutinin MOA, N-terminal domain {Fairy-ring mush | 83.52 |
| >d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: beta-Trefoil superfamily: Ricin B-like lectins family: Ricin B-like domain: Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.02 E-value=5.9e-11 Score=72.49 Aligned_cols=39 Identities=44% Similarity=0.675 Sum_probs=36.7
Q ss_pred CCCCCceeeeEEeCCCCCcccCCCCCCCCceeEEcCCCC
Q psy16416 1 MPLDYYYLGEVKNAETLNCLDTMGRKTGEKNVKNTRTGP 39 (64)
Q Consensus 1 lP~D~~a~GeIRN~gS~lCLDt~gr~~g~~lGL~~C~~~ 39 (64)
||.++++||+|||.++++|||++++.++.+++|++|.+.
T Consensus 2 ~p~~~~~~G~Irn~~s~~CLd~~~~~~g~~v~l~~C~~~ 40 (131)
T d1xhba1 2 IPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGM 40 (131)
T ss_dssp SCSSEEEEECEEETTTCEEEECTTCCTTEECEEEECCSC
T ss_pred CCCCcEEEEEEEECCCCccEecCCCCCCCeEEEEEcCCC
Confidence 699999999999999999999999999999999999875
|
| >d1vcla2 b.42.2.1 (A:151-283) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} | Back information, alignment and structure |
|---|
| >d1vcla1 b.42.2.1 (A:1-150) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} | Back information, alignment and structure |
|---|
| >d1knma_ b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces lividans [TaxId: 1916]} | Back information, alignment and structure |
|---|
| >d1vcla1 b.42.2.1 (A:1-150) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} | Back information, alignment and structure |
|---|
| >d1hwmb1 b.42.2.1 (B:3-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} | Back information, alignment and structure |
|---|
| >d1ggpb1 b.42.2.1 (B:11-140) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} | Back information, alignment and structure |
|---|
| >d1rzob1 b.42.2.1 (B:2001-2135) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d1vcla2 b.42.2.1 (A:151-283) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} | Back information, alignment and structure |
|---|
| >d1ggpb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} | Back information, alignment and structure |
|---|
| >d1dqga_ b.42.2.2 (A:) Mannose receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ggpb1 b.42.2.1 (B:11-140) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} | Back information, alignment and structure |
|---|
| >d1abrb1 b.42.2.1 (B:1-140) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} | Back information, alignment and structure |
|---|
| >d1m2tb1 b.42.2.1 (B:249-384) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} | Back information, alignment and structure |
|---|
| >d1m2tb2 b.42.2.1 (B:385-510) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} | Back information, alignment and structure |
|---|
| >d1ggpb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} | Back information, alignment and structure |
|---|
| >d2aaib2 b.42.2.1 (B:136-262) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d1hwmb2 b.42.2.1 (B:136-266) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} | Back information, alignment and structure |
|---|
| >d1knma_ b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces lividans [TaxId: 1916]} | Back information, alignment and structure |
|---|
| >d1dqga_ b.42.2.2 (A:) Mannose receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1abrb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} | Back information, alignment and structure |
|---|
| >d1hwmb1 b.42.2.1 (B:3-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} | Back information, alignment and structure |
|---|
| >d2aaib2 b.42.2.1 (B:136-262) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d1sr4a_ b.42.2.1 (A:) Cytolethal distending toxin subunit A {Haemophilus ducreyi [TaxId: 730]} | Back information, alignment and structure |
|---|
| >d1m2tb2 b.42.2.1 (B:385-510) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} | Back information, alignment and structure |
|---|
| >d1rzob1 b.42.2.1 (B:2001-2135) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d2ihoa1 b.42.2.1 (A:2-155) Agglutinin MOA, N-terminal domain {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]} | Back information, alignment and structure |
|---|
| >d2zqna1 b.42.2.1 (A:131-260) 29-kDa galactose-binding lectin {Lumbricus terrestris [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d1abrb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} | Back information, alignment and structure |
|---|
| >d1hwmb2 b.42.2.1 (B:136-266) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} | Back information, alignment and structure |
|---|
| >d1abrb1 b.42.2.1 (B:1-140) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} | Back information, alignment and structure |
|---|
| >d1m2tb1 b.42.2.1 (B:249-384) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} | Back information, alignment and structure |
|---|
| >d2zqna1 b.42.2.1 (A:131-260) 29-kDa galactose-binding lectin {Lumbricus terrestris [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d2ihoa1 b.42.2.1 (A:2-155) Agglutinin MOA, N-terminal domain {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]} | Back information, alignment and structure |
|---|