Psyllid ID: psy16419


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340------
MSSGHMENDEEGRTAIKELNGQIVNEKPLKIEAATSRKGPNTPTTKVFVGNLSDNTRAPEVRELFVPYGTVVECDIVRNYGFVHIDSPDINKCIKELNGMMVDGKPMKVVVAGFISSILSCLNVIFFIRCGRGGHWSKECPRAGNFRSSGCYCKSKSSHKIYQDALVLWEDQDLWTGLVKGTSDLVVVIASPIHQAHCDSFLCCSRRFGAVGGPGPLDRFGYPREAYPRDPYPPPPPPSFLRDRMMGGYPMKFGLILIPRSQIESLDLCGHFKQTKTTIVWSPRYQSFGTVVVIEARNMPGFSSVGTFKIFIGNVNPGTSVELIRPLFEKYGKVVECDVVKNYGFV
ccccccccHHHHHHHHHHHcccEEccEEEEEEcccccccccccccEEEEEcccccccHHHHHHHHcccccEEEEEEEEcEEEEEcccHHHHHHHHHHcccEEccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccEEccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccHHHHHHHccccccccccEEcccccccccEEEEEEEcccccccccccEEEEEEcccccccHHHHHHHHHccccEEEEEEEcccccc
ccccccccHHHHHHHHHHHcccEEccEEEEEEccccccccccccEEEEEEcccccccHHHHHHHHHHcccEEEEEEEEcEEEEEcccHHHHHHHHHHcccEEccEEEEEEEccccccccccccccEEccccccccccHHccccccccccEEEEEccccccEccccHHHHHHHcccccEEcccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccHHHcccEEccHHHHHHHHHHHHHHHcccccEEcccEEEccEEEEEEcccccccccccEEEEEEEcccccccHHHHHHHHHHcccEEEEEEEEccccc
mssghmendeeGRTAIKELNgqivnekplkieaatsrkgpntpttkvfvgnlsdntrapevrelfvpygtvvecdivrnygfvhidspdINKCIKElngmmvdgkpMKVVVAGFISSILSCLNVIFFircgrgghwskecpragnfrssgcycksksshkIYQDALVLWEdqdlwtglvkgtSDLVVVIAspihqahcdsflccsrrfgavggpgpldrfgypreayprdpyppppppsflrdrmmggypmkfgliliprsqiesldlcghfkqtkttivwspryqsfgTVVVIEArnmpgfssvgTFKIFignvnpgtsvELIRPLFEKYGKvvecdvvknygfv
mssghmendeeGRTAIKelngqivnekplkieaatsrkgpntpttkvfvgnlsdntrapEVRELFVPYGTVVECDIVRNYGFVHIDSPDINKCIKELNGMMVDGKPMKVVVAGFISSILSCLNVIFFIRCGRGGHWSKECPRAGNFRSSGCYCKSKSSHKIYQDALVLWEDQDLWTGLVKGTSDLVVVIASPIHQAHCDSFLCCSRRFGAVGGPGPLDRFGYPREAYPRDPYPPPPPPSFLRDRMMGGYPMKFGLILIPRSQIESLDLCGHFKQTkttivwspryqSFGTVVVIEARNMPGFSSVGTFKIFIGNVNPGTSVELIRPLFEkygkvvecdvvknygfv
MSSGHMENDEEGRTAIKELNGQIVNEKPLKIEAATSRKGPNTPTTKVFVGNLSDNTRAPEVRELFVPYGTVVECDIVRNYGFVHIDSPDINKCIKELNGMMVDGKPMKVVVAGFISSILSCLNVIFFIRCGRGGHWSKECPRAGNFRSSGCYCKSKSSHKIYQDALVLWEDQDLWTGLVKGTSDLVVVIASPIHQAHCDSFLCCSRRFGAVGGPGPLDRFGypreayprdpyppppppSFLRDRMMGGYPMKFGLILIPRSQIESLDLCGHFKQTKTTIVWSPRYQSFGTVVVIEARNMPGFSSVGTFKIFIGNVNPGTSVELIRPLFEKYGKVVECDVVKNYGFV
**********************************************VFVGNLSDNTRAPEVRELFVPYGTVVECDIVRNYGFVHIDSPDINKCIKELNGMMVDGKPMKVVVAGFISSILSCLNVIFFIRCGRGGHWSKECPRAGNFRSSGCYCKSKSSHKIYQDALVLWEDQDLWTGLVKGTSDLVVVIASPIHQAHCDSFLCCSRRFGAVGGPGPLDRFG************************MGGYPMKFGLILIPRSQIESLDLCGHFKQTKTTIVWSPRYQSFGTVVVIEARNMPGFSSVGTFKIFIGNVNPGTSVELIRPLFEKYGKVVECDVVKNYGF*
***GHMENDEEGRTAIKELNGQIVNEKPLK*****************FVGNLSDNTRAPEVRELFVPYGTVVECDIVRNYGFVHIDSPDINKCIKELNGMMVDGKPMK************************************************************************************************************************************************FGLILIPRSQIESLDLCGHFKQTKTTIVWSPRYQSF*********************IFIGNVNPGTSVELIRPLFEKYGKVVECDVVKNYGFV
***********GRTAIKELNGQIVNEKPLKIEAATSRKGPNTPTTKVFVGNLSDNTRAPEVRELFVPYGTVVECDIVRNYGFVHIDSPDINKCIKELNGMMVDGKPMKVVVAGFISSILSCLNVIFFIRCGRGGHWSKECPRAGNFRSSGCYCKSKSSHKIYQDALVLWEDQDLWTGLVKGTSDLVVVIASPIHQAHCDSFLCCSRRFGAVGGPGPLDRFGYPREAYPRDPYPPPPPPSFLRDRMMGGYPMKFGLILIPRSQIESLDLCGHFKQTKTTIVWSPRYQSFGTVVVIEARNMPGFSSVGTFKIFIGNVNPGTSVELIRPLFEKYGKVVECDVVKNYGFV
**********EGRTAIKELNGQIVNEKPLKIEAATSRKGPNTPTTKVFVGNLSDNTRAPEVRELFVPYGTVVECDIVRNYGFVHIDSPDINKCIKELNGMMVDGKPMKVVVAGFISSI**CLNVIFFIRCGRGGHWSKECPRAGNFRSSGCYCKSKSSHKIYQDALVLWEDQDLWTGLVKGTSDLVVVIAS********************************REAYPRDPYPPPPPPSFLRDRMMGGYPMKFGLILIPRSQIESLDLCGHFKQTKTTIVWSPRYQSFGTVVVIEARNMPGFSSVGTFKIFIGNVNPGTSVELIRPLFEKYGKVVECDVVKNYGFV
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSGHMENDEEGRTAIKELNGQIVNEKPLKIEAATSRKGPNTPTTKVFVGNLSDNTRAPEVRELFVPYGTVVECDIVRNYGFVHIDSPDINKCIKELNGMMVDGKPMKVVVAGFISSILSCLNVIFFIRCGRGGHWSKECPRAGNFRSSGCYCKSKSSHKIYQDALVLWEDQDLWTGLVKGTSDLVVVIASPIHQAHCDSFLCCSRRFGAVGGPGPLDRFGYPREAYPRDPYPPPPPPSFLRDRMMGGYPMKFGLILIPRSQIESLDLCGHFKQTKTTIVWSPRYQSFGTVVVIEARNMPGFSSVGTFKIFIGNVNPGTSVELIRPLFEKYGKVVECDVVKNYGFV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query346 2.2.26 [Sep-21-2011]
Q94901352 RNA-binding protein lark yes N/A 0.398 0.392 0.614 9e-43
Q6IQ97419 RNA-binding protein 4.1 O no N/A 0.404 0.334 0.353 2e-16
Q8C7Q4361 RNA-binding protein 4 OS= yes N/A 0.387 0.371 0.338 4e-15
Q4R979364 RNA-binding protein 4 OS= N/A N/A 0.387 0.368 0.338 5e-15
Q9BWF3364 RNA-binding protein 4 OS= yes N/A 0.387 0.368 0.338 5e-15
Q3MHX3362 RNA-binding protein 4 OS= yes N/A 0.387 0.370 0.338 5e-15
Q06AT9359 RNA-binding protein 4B OS no N/A 0.387 0.373 0.338 5e-15
Q9BDY9359 RNA-binding protein 4 OS= no N/A 0.387 0.373 0.338 5e-15
Q9BQ04359 RNA-binding protein 4B OS no N/A 0.387 0.373 0.338 6e-15
Q64LC9357 RNA-binding protein 4B OS no N/A 0.387 0.375 0.338 6e-15
>sp|Q94901|LARK_DROME RNA-binding protein lark OS=Drosophila melanogaster GN=lark PE=1 SV=1 Back     alignment and function desciption
 Score =  174 bits (441), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 104/140 (74%), Gaps = 2/140 (1%)

Query: 5   HMENDEEGRTAIKELNGQIVNEKPLKIEAATSRKGPNTPTTKVFVGNLSDNTRAPEVREL 64
           HME +++GR AI+ LNG  +NE  +K+EAA SR+ PNTPTTK+FVGNL+D TRAPEVREL
Sbjct: 46  HMETEQQGRDAIQNLNGYTLNEFAIKVEAAKSRRAPNTPTTKIFVGNLTDKTRAPEVREL 105

Query: 65  FVPYGTVVECDIVRNYGFVHIDS-PDINKCIKELNGMMVDGKPMKVVVA-GFISSILSCL 122
           F  YGTVVECDIVRNYGFVH+D   D+   IKELNG +VDG+P+KV V+   +       
Sbjct: 106 FQKYGTVVECDIVRNYGFVHLDCVGDVQDAIKELNGRVVDGQPLKVQVSTSRVRPKPGMG 165

Query: 123 NVIFFIRCGRGGHWSKECPR 142
           +     RCGR GHWSKECPR
Sbjct: 166 DPEQCYRCGRSGHWSKECPR 185




Essential RNA-binding protein. May be required for circadian repression of eclosion. Also essential for nurse cell dumping during oogenesis, the process whereby the cytoplasmic contents of nurse cells are transferred to the oocyte late in it's development.
Drosophila melanogaster (taxid: 7227)
>sp|Q6IQ97|RBM41_DANRE RNA-binding protein 4.1 OS=Danio rerio GN=rbm4.1 PE=1 SV=1 Back     alignment and function description
>sp|Q8C7Q4|RBM4_MOUSE RNA-binding protein 4 OS=Mus musculus GN=Rbm4 PE=1 SV=1 Back     alignment and function description
>sp|Q4R979|RBM4_MACFA RNA-binding protein 4 OS=Macaca fascicularis GN=RBM4 PE=2 SV=1 Back     alignment and function description
>sp|Q9BWF3|RBM4_HUMAN RNA-binding protein 4 OS=Homo sapiens GN=RBM4 PE=1 SV=1 Back     alignment and function description
>sp|Q3MHX3|RBM4_BOVIN RNA-binding protein 4 OS=Bos taurus GN=RBM4 PE=2 SV=1 Back     alignment and function description
>sp|Q06AT9|RBM4B_PIG RNA-binding protein 4B OS=Sus scrofa GN=RBM4B PE=2 SV=1 Back     alignment and function description
>sp|Q9BDY9|RBM4_RABIT RNA-binding protein 4 OS=Oryctolagus cuniculus GN=RBM4 PE=2 SV=1 Back     alignment and function description
>sp|Q9BQ04|RBM4B_HUMAN RNA-binding protein 4B OS=Homo sapiens GN=RBM4B PE=1 SV=1 Back     alignment and function description
>sp|Q64LC9|RBM4B_RAT RNA-binding protein 4B OS=Rattus norvegicus GN=Rbm4b PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query346
383848340351 PREDICTED: RNA-binding protein lark-like 0.404 0.398 0.654 3e-46
350416927 458 PREDICTED: LOW QUALITY PROTEIN: RNA-bind 0.404 0.305 0.647 1e-45
332031363355 RNA-binding protein lark [Acromyrmex ech 0.404 0.394 0.633 5e-45
322797564324 hypothetical protein SINV_13630 [Solenop 0.404 0.432 0.633 8e-45
307187784331 RNA-binding protein lark [Camponotus flo 0.404 0.422 0.633 1e-44
307195687325 RNA-binding protein lark [Harpegnathos s 0.404 0.430 0.633 1e-44
345493962382 PREDICTED: RNA-binding protein lark-like 0.401 0.363 0.638 1e-44
357621997341 RNA-binding protein lark [Danaus plexipp 0.401 0.407 0.645 2e-44
91088839358 PREDICTED: similar to lark CG8597-PA [Tr 0.401 0.388 0.624 4e-44
112983834343 RNA-binding protein lark [Bombyx mori] g 0.401 0.405 0.638 4e-44
>gi|383848340|ref|XP_003699809.1| PREDICTED: RNA-binding protein lark-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  192 bits (487), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 112/142 (78%), Gaps = 2/142 (1%)

Query: 5   HMENDEEGRTAIKELNGQIVNEKPLKIEAATSRKGPNTPTTKVFVGNLSDNTRAPEVREL 64
           HMEN+E GR AI+ LNGQIV+ +P+K EAA SRKGPNTPTTK+FVGNL+DNT+AP+VREL
Sbjct: 49  HMENEEAGRNAIQNLNGQIVHGQPIKCEAAKSRKGPNTPTTKIFVGNLTDNTKAPQVREL 108

Query: 65  FVPYGTVVECDIVRNYGFVHIDSP-DINKCIKELNGMMVDGKPMKVVVA-GFISSILSCL 122
           F  YGTVVECDIVRNYGFVH+++  D+N  IKELNG MVDG+PMKV ++   +       
Sbjct: 109 FAKYGTVVECDIVRNYGFVHLEATGDVNDAIKELNGQMVDGQPMKVQISTSRVRQRPGMG 168

Query: 123 NVIFFIRCGRGGHWSKECPRAG 144
           +     RCGRGGHWSKECP+ G
Sbjct: 169 DPEQCYRCGRGGHWSKECPKGG 190




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350416927|ref|XP_003491172.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein lark-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332031363|gb|EGI70876.1| RNA-binding protein lark [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322797564|gb|EFZ19608.1| hypothetical protein SINV_13630 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307187784|gb|EFN72750.1| RNA-binding protein lark [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307195687|gb|EFN77529.1| RNA-binding protein lark [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|345493962|ref|XP_003427189.1| PREDICTED: RNA-binding protein lark-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|357621997|gb|EHJ73625.1| RNA-binding protein lark [Danaus plexippus] Back     alignment and taxonomy information
>gi|91088839|ref|XP_970745.1| PREDICTED: similar to lark CG8597-PA [Tribolium castaneum] gi|270012337|gb|EFA08785.1| hypothetical protein TcasGA2_TC006476 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|112983834|ref|NP_001037293.1| RNA-binding protein lark [Bombyx mori] gi|57236850|gb|AAW48898.1| lark-PA [Bombyx mori] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query346
FB|FBgn0011640352 lark "lark" [Drosophila melano 0.468 0.460 0.554 6.6e-42
UNIPROTKB|E9PLB0143 RBM4B "RNA-binding protein 4B" 0.283 0.685 0.323 1.6e-09
UNIPROTKB|E9PM61147 RBM4B "RNA-binding protein 4B" 0.280 0.659 0.326 2.7e-09
RGD|1306891143 Rbm4 "RNA binding motif protei 0.280 0.678 0.326 2.7e-09
UNIPROTKB|D6R9K7150 RBM4 "RNA-binding protein 4" [ 0.263 0.606 0.336 4.5e-09
UNIPROTKB|J3QRR5155 RBM4 "RNA-binding protein 4" [ 0.263 0.587 0.336 4.5e-09
ZFIN|ZDB-GENE-030131-3902419 rbm4.1 "RNA binding motif prot 0.404 0.334 0.353 1.3e-15
ZFIN|ZDB-GENE-040426-1811331 zgc:77262 "zgc:77262" [Danio r 0.294 0.308 0.396 8.4e-13
UNIPROTKB|F8WDX3129 RBM14 "RNA-binding protein 14" 0.147 0.395 0.446 5.6e-16
ZFIN|ZDB-GENE-040426-2455 556 rbm14b "RNA binding motif prot 0.393 0.244 0.361 1.1e-15
FB|FBgn0011640 lark "lark" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 444 (161.4 bits), Expect = 6.6e-42, P = 6.6e-42
 Identities = 91/164 (55%), Positives = 111/164 (67%)

Query:     5 HMENDEEGRTAIKELNGQIVNEKPLKIEAATSRKGPNTPTTKVFVGNLSDNTRAPEVREL 64
             HME +++GR AI+ LNG  +NE  +K+EAA SR+ PNTPTTK+FVGNL+D TRAPEVREL
Sbjct:    46 HMETEQQGRDAIQNLNGYTLNEFAIKVEAAKSRRAPNTPTTKIFVGNLTDKTRAPEVREL 105

Query:    65 FVPYGTVVECDIVRNYGFVHIDSP-DINKCIKELNGMMVDGKPMKVVVA-GFISSILSCL 122
             F  YGTVVECDIVRNYGFVH+D   D+   IKELNG +VDG+P+KV V+   +       
Sbjct:   106 FQKYGTVVECDIVRNYGFVHLDCVGDVQDAIKELNGRVVDGQPLKVQVSTSRVRPKPGMG 165

Query:   123 NVIFFIRCGRGGHWSKECPRAGNFRSSGCYCKSKSSHKIYQDAL 166
             +     RCGR GHWSKECPR       G    S  S   Y+D +
Sbjct:   166 DPEQCYRCGRSGHWSKECPRLYGSAGGGREPPSPLSAGGYRDRM 209


GO:0009790 "embryo development" evidence=IMP
GO:0008062 "eclosion rhythm" evidence=NAS;IMP;TAS
GO:0007623 "circadian rhythm" evidence=NAS;IMP
GO:0045804 "negative regulation of eclosion" evidence=IMP
GO:0003729 "mRNA binding" evidence=ISS
GO:0005737 "cytoplasm" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
GO:0045475 "locomotor rhythm" evidence=IMP;TAS
GO:0007562 "eclosion" evidence=TAS
GO:0040011 "locomotion" evidence=TAS
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0048477 "oogenesis" evidence=IMP
GO:0003723 "RNA binding" evidence=NAS
GO:0007303 "cytoplasmic transport, nurse cell to oocyte" evidence=IMP
GO:0008104 "protein localization" evidence=IMP
GO:0030036 "actin cytoskeleton organization" evidence=IMP
GO:0007067 "mitosis" evidence=IMP
GO:0071013 "catalytic step 2 spliceosome" evidence=IDA
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC
GO:0071011 "precatalytic spliceosome" evidence=IDA
UNIPROTKB|E9PLB0 RBM4B "RNA-binding protein 4B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PM61 RBM4B "RNA-binding protein 4B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1306891 Rbm4 "RNA binding motif protein 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D6R9K7 RBM4 "RNA-binding protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3QRR5 RBM4 "RNA-binding protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-3902 rbm4.1 "RNA binding motif protein 4.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1811 zgc:77262 "zgc:77262" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F8WDX3 RBM14 "RNA-binding protein 14" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2455 rbm14b "RNA binding motif protein 14b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query346
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 4e-26
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 2e-17
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 8e-17
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 2e-15
smart0036073 smart00360, RRM, RNA recognition motif 5e-15
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 2e-14
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 7e-14
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 1e-13
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 1e-12
cd1260767 cd12607, RRM2_RBM4, RNA recognition motif 2 in ver 5e-12
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 2e-11
pfam0007670 pfam00076, RRM_1, RNA recognition motif 2e-11
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 7e-11
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 2e-10
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 3e-10
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 4e-10
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 4e-10
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 3e-09
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 8e-09
cd1260767 cd12607, RRM2_RBM4, RNA recognition motif 2 in ver 2e-08
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 4e-08
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 4e-08
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 5e-08
smart0036073 smart00360, RRM, RNA recognition motif 2e-07
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 2e-07
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 3e-07
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 3e-07
pfam0007670 pfam00076, RRM_1, RNA recognition motif 4e-07
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 6e-07
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 7e-07
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 7e-07
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 8e-07
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 8e-07
cd1259670 cd12596, RRM1_SRSF6, RNA recognition motif 1 in ve 8e-07
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 1e-06
cd1259474 cd12594, RRM1_SRSF4, RNA recognition motif 1 in ve 1e-06
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 1e-06
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 1e-06
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 1e-06
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 2e-06
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 2e-06
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 2e-06
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 3e-06
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 3e-06
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 3e-06
cd1235074 cd12350, RRM3_SHARP, RNA recognition motif 3 in SM 4e-06
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 4e-06
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 4e-06
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 4e-06
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 5e-06
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 5e-06
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 5e-06
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 6e-06
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 7e-06
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 8e-06
cd1259570 cd12595, RRM1_SRSF5, RNA recognition motif 1 in ve 9e-06
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 1e-05
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 1e-05
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 2e-05
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 2e-05
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 3e-05
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 3e-05
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 3e-05
cd1235873 cd12358, RRM1_VICKZ, RNA recognition motif 1 in th 3e-05
cd1268075 cd12680, RRM_THOC4, RNA recognition motif in THO c 3e-05
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 4e-05
cd1258871 cd12588, RRM1_p54nrb, RNA recognition motif 1 in v 4e-05
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 5e-05
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 5e-05
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 5e-05
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 6e-05
cd1263681 cd12636, RRM2_Bruno_like, RNA recognition motif 2 6e-05
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 6e-05
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 6e-05
cd1260569 cd12605, RRM_RALYL, RNA recognition motif in verte 6e-05
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 8e-05
pfam1389356 pfam13893, RRM_5, RNA recognition motif 9e-05
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 9e-05
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 1e-04
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 1e-04
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 1e-04
cd1267874 cd12678, RRM_SLTM, RNA recognition motif in Scaffo 1e-04
cd1263581 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 1e-04
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 2e-04
cd1258871 cd12588, RRM1_p54nrb, RNA recognition motif 1 in v 2e-04
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 2e-04
cd1267976 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in 2e-04
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 2e-04
cd1258671 cd12586, RRM1_PSP1, RNA recognition motif 1 in ver 2e-04
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 2e-04
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 2e-04
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 2e-04
cd1262274 cd12622, RRM3_PUB1, RNA recognition motif 3 in yea 2e-04
cd1234271 cd12342, RRM_Nab3p, RNA recognition motif in yeast 2e-04
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 3e-04
cd1233872 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 3e-04
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 3e-04
cd1257379 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA 3e-04
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 5e-04
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 6e-04
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 6e-04
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 6e-04
cd1230575 cd12305, RRM_NELFE, RNA recognition motif in negat 6e-04
cd1249472 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in v 6e-04
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 6e-04
cd1259972 cd12599, RRM1_SF2_plant_like, RNA recognition moti 6e-04
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 7e-04
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 7e-04
cd1246380 cd12463, RRM_G3BP1, RNA recognition motif found in 7e-04
cd1260371 cd12603, RRM_hnRNPC, RNA recognition motif in vert 7e-04
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 8e-04
cd1226085 cd12260, RRM2_SREK1, RNA recognition motif 2 in sp 8e-04
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 8e-04
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 8e-04
cd1258771 cd12587, RRM1_PSF, RNA recognition motif 1 in vert 9e-04
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 9e-04
cd1260569 cd12605, RRM_RALYL, RNA recognition motif in verte 0.001
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 0.001
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 0.001
cd1249572 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in v 0.001
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 0.001
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 0.001
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 0.001
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 0.001
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 0.001
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 0.001
cd1249883 cd12498, RRM3_ACF, RNA recognition motif 3 in vert 0.001
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 0.001
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 0.002
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 0.002
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 0.002
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 0.002
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 0.002
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 0.002
cd1267282 cd12672, RRM_DAZL, RNA recognition motif in verteb 0.002
cd1259375 cd12593, RRM_RBM11, RNA recognition motif in verte 0.002
cd1223472 cd12234, RRM1_AtRSp31_like, RNA recognition motif 0.002
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 0.003
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 0.003
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 0.003
cd1235976 cd12359, RRM2_VICKZ, RNA recognition motif 2 in th 0.003
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 0.003
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 0.004
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 0.004
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 0.004
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 0.004
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 0.004
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 0.004
cd1255587 cd12555, RRM2_RBM15, RNA recognition motif 2 in ve 0.004
cd1260476 cd12604, RRM_RALY, RNA recognition motif in verteb 0.004
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
 Score = 98.5 bits (246), Expect = 4e-26
 Identities = 35/65 (53%), Positives = 43/65 (66%), Gaps = 1/65 (1%)

Query: 46  KVFVGNLSDNTRAPEVRELFVPYGTVVECDIVRNYGFVHIDSP-DINKCIKELNGMMVDG 104
           K+FVGNL D T + E+R LF  YGTV ECD+V+NYGFVH++   D    IK LNG    G
Sbjct: 1   KLFVGNLPDATTSEELRALFEKYGTVTECDVVKNYGFVHMEEEEDAEDAIKALNGYEFMG 60

Query: 105 KPMKV 109
           K + V
Sbjct: 61  KRINV 65


This subfamily corresponds to the RRM in CoAA (also known as RBM14 or PSP2) and RNA-binding protein 4 (RBM4). CoAA is a heterogeneous nuclear ribonucleoprotein (hnRNP)-like protein identified as a nuclear receptor coactivator. It mediates transcriptional coactivation and RNA splicing effects in a promoter-preferential manner, and is enhanced by thyroid hormone receptor-binding protein (TRBP). CoAA contains two N-terminal RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains), and a TRBP-interacting domain. RBM4 is a ubiquitously expressed splicing factor with two isoforms, RBM4A (also known as Lark homolog) and RBM4B (also known as RBM30), which are very similar in structure and sequence. RBM4 may also function as a translational regulator of stress-associated mRNAs as well as play a role in micro-RNA-mediated gene regulation. RBM4 contains two N-terminal RRMs, a CCHC-type zinc finger, and three alanine-rich regions within their C-terminal regions. This family also includes Drosophila RNA-binding protein lark (Dlark), a homolog of human RBM4. It plays an important role in embryonic development and in the circadian regulation of adult eclosion. Dlark shares high sequence similarity with RBM4 at the N-terminal region. However, Dlark has three proline-rich segments instead of three alanine-rich segments within the C-terminal region. . Length = 66

>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|241051 cd12607, RRM2_RBM4, RNA recognition motif 2 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241051 cd12607, RRM2_RBM4, RNA recognition motif 2 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241040 cd12596, RRM1_SRSF6, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 6 (SRSF6) Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|241038 cd12594, RRM1_SRSF4, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 4 (SRSF4) Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241039 cd12595, RRM1_SRSF5, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 5 (SRSF5) Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240804 cd12358, RRM1_VICKZ, RNA recognition motif 1 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit 4 (THOC4) and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|241049 cd12605, RRM_RALYL, RNA recognition motif in vertebrate RNA-binding Raly-like protein (RALYL) Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|241122 cd12678, RRM_SLTM, RNA recognition motif in Scaffold attachment factor (SAF)-like transcription modulator (SLTM) and similar proteins Back     alignment and domain information
>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241123 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in scaffold attachment factor B1 (SAFB1), scaffold attachment factor B2 (SAFB2), and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate paraspeckle protein 1 (PSP1) Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|241066 cd12622, RRM3_PUB1, RNA recognition motif 3 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240788 cd12342, RRM_Nab3p, RNA recognition motif in yeast nuclear polyadenylated RNA-binding protein 3 (Nab3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241017 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA-binding protein Musashi homolog 2 (Musashi-2) and similar proteins Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation factor E (NELF-E) and similar proteins Back     alignment and domain information
>gnl|CDD|240938 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240909 cd12463, RRM_G3BP1, RNA recognition motif found in ras GTPase-activating protein-binding protein 1 (G3BP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241047 cd12603, RRM_hnRNPC, RNA recognition motif in vertebrate heterogeneous nuclear ribonucleoprotein C1/C2 (hnRNP C1/C2) Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241031 cd12587, RRM1_PSF, RNA recognition motif 1 in vertebrate polypyrimidine tract-binding protein (PTB)-associated-splicing factor (PSF) Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|241049 cd12605, RRM_RALYL, RNA recognition motif in vertebrate RNA-binding Raly-like protein (RALYL) Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240942 cd12498, RRM3_ACF, RNA recognition motif 3 in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in azoospermia-like (DAZL) proteins Back     alignment and domain information
>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) Back     alignment and domain information
>gnl|CDD|240680 cd12234, RRM1_AtRSp31_like, RNA recognition motif in Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins from plants Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240805 cd12359, RRM2_VICKZ, RNA recognition motif 2 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240999 cd12555, RRM2_RBM15, RNA recognition motif 2 in vertebrate RNA binding motif protein 15 (RBM15) Back     alignment and domain information
>gnl|CDD|241048 cd12604, RRM_RALY, RNA recognition motif in vertebrate RNA-binding protein Raly Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 346
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.97
KOG0117|consensus506 99.95
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.95
KOG0145|consensus360 99.94
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.94
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 99.94
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.94
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.93
KOG0109|consensus346 99.93
KOG0127|consensus 678 99.92
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.92
KOG0109|consensus346 99.91
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.9
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.9
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.89
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.88
KOG0148|consensus321 99.88
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.87
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.86
KOG0144|consensus510 99.86
KOG0123|consensus369 99.86
KOG0148|consensus321 99.84
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.84
KOG0144|consensus 510 99.82
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.8
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 99.8
KOG0123|consensus369 99.79
KOG0110|consensus725 99.78
KOG0131|consensus203 99.76
KOG0105|consensus241 99.75
KOG0145|consensus360 99.75
KOG0117|consensus506 99.75
KOG0127|consensus 678 99.74
KOG0124|consensus 544 99.72
KOG0107|consensus195 99.72
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.71
KOG0131|consensus203 99.71
KOG4205|consensus311 99.67
KOG0110|consensus725 99.64
KOG0146|consensus371 99.62
KOG1457|consensus284 99.59
KOG0124|consensus544 99.57
KOG0106|consensus216 99.51
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.5
KOG0125|consensus376 99.5
KOG4206|consensus221 99.48
KOG0121|consensus153 99.47
PLN03120260 nucleic acid binding protein; Provisional 99.42
KOG4212|consensus 608 99.37
KOG0147|consensus549 99.37
KOG1190|consensus492 99.37
KOG4207|consensus256 99.36
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.35
PLN03213 759 repressor of silencing 3; Provisional 99.34
KOG0122|consensus270 99.32
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.31
KOG0147|consensus549 99.3
KOG0111|consensus298 99.3
PLN03121243 nucleic acid binding protein; Provisional 99.29
KOG0114|consensus124 99.28
KOG0149|consensus247 99.28
smart0036272 RRM_2 RNA recognition motif. 99.26
KOG0113|consensus335 99.25
KOG4212|consensus608 99.25
KOG0130|consensus170 99.24
KOG1456|consensus494 99.23
KOG1456|consensus494 99.22
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.19
KOG4205|consensus311 99.19
KOG0146|consensus371 99.13
smart0036071 RRM RNA recognition motif. 99.13
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.13
KOG0105|consensus241 99.1
KOG0126|consensus219 99.09
KOG0106|consensus216 99.08
KOG0108|consensus 435 99.04
KOG1457|consensus284 99.03
KOG4206|consensus221 99.03
KOG0132|consensus 894 98.93
KOG4211|consensus510 98.92
KOG0153|consensus377 98.92
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 98.91
smart0036170 RRM_1 RNA recognition motif. 98.91
KOG1190|consensus492 98.87
KOG0116|consensus419 98.82
KOG4661|consensus 940 98.77
KOG0125|consensus 376 98.75
KOG0415|consensus479 98.73
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 98.72
KOG4454|consensus267 98.6
KOG1548|consensus382 98.56
KOG0151|consensus 877 98.56
KOG0129|consensus520 98.52
KOG4211|consensus 510 98.49
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 98.45
KOG0113|consensus 335 98.45
KOG4209|consensus231 98.4
KOG0533|consensus243 98.4
KOG4208|consensus214 98.39
KOG0114|consensus124 98.39
KOG0120|consensus500 98.38
KOG0226|consensus290 98.38
KOG0128|consensus881 98.32
KOG4660|consensus 549 98.3
KOG0126|consensus 219 98.26
KOG0121|consensus153 98.18
smart0036272 RRM_2 RNA recognition motif. 98.13
KOG0120|consensus500 98.12
KOG1548|consensus382 98.1
COG0724 306 RNA-binding proteins (RRM domain) [General functio 98.1
KOG0112|consensus 975 98.07
KOG0122|consensus270 98.06
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.02
KOG0132|consensus 894 97.96
KOG4210|consensus285 97.95
KOG4676|consensus 479 97.91
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.88
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 97.85
KOG4210|consensus285 97.85
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 97.83
KOG0112|consensus 975 97.83
KOG0415|consensus 479 97.8
smart0036071 RRM RNA recognition motif. 97.76
KOG4661|consensus 940 97.71
KOG0153|consensus 377 97.7
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.69
smart0036170 RRM_1 RNA recognition motif. 97.51
KOG1365|consensus508 97.51
KOG0116|consensus419 97.48
COG5175480 MOT2 Transcriptional repressor [Transcription] 97.45
KOG0115|consensus275 97.45
KOG1365|consensus508 97.41
KOG0107|consensus195 97.38
KOG0130|consensus170 97.36
KOG2193|consensus 584 97.32
KOG0151|consensus 877 97.3
KOG2193|consensus 584 97.14
KOG0129|consensus520 97.08
KOG0111|consensus298 97.06
KOG0128|consensus881 97.0
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 96.92
KOG4207|consensus256 96.87
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 96.86
KOG4307|consensus 944 96.8
KOG1855|consensus484 96.64
KOG3152|consensus278 96.57
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 96.51
KOG0226|consensus290 96.5
KOG1995|consensus351 96.45
KOG4454|consensus267 96.39
KOG1996|consensus378 96.35
KOG2314|consensus 698 96.34
KOG0533|consensus 243 96.16
KOG2202|consensus260 96.15
PLN03120260 nucleic acid binding protein; Provisional 95.93
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 95.86
KOG4307|consensus944 95.74
KOG4660|consensus 549 95.68
KOG4209|consensus231 95.54
KOG4849|consensus 498 95.53
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 95.26
KOG2416|consensus718 95.24
PF15023166 DUF4523: Protein of unknown function (DUF4523) 95.13
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 95.04
PLN03121243 nucleic acid binding protein; Provisional 94.88
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 94.8
PLN03213 759 repressor of silencing 3; Provisional 94.78
KOG0115|consensus 275 94.77
KOG2591|consensus 684 94.29
KOG0108|consensus435 94.23
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 94.0
KOG4208|consensus214 93.84
KOG1855|consensus 484 93.33
KOG2253|consensus 668 93.02
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 92.56
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 92.42
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 90.65
KOG2135|consensus526 90.54
KOG2202|consensus260 90.4
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 90.25
KOG2068|consensus327 90.2
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 89.51
KOG3152|consensus 278 89.1
KOG4285|consensus350 88.66
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 87.68
KOG4676|consensus479 85.02
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 84.82
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 83.71
KOG4574|consensus 1007 83.26
PF0009818 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi 82.96
COG5175480 MOT2 Transcriptional repressor [Transcription] 81.62
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 80.64
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
Probab=99.97  E-value=3e-28  Score=230.84  Aligned_cols=113  Identities=24%  Similarity=0.483  Sum_probs=102.5

Q ss_pred             CeEEEecCHHHHHHHHHHhCCCeeCCeeeEEeecCCCCCCCCCCcEEEEcCCCCCCCHHHHHHhhcCCCCeEEEEEE---
Q psy16419          1 MSSGHMENDEEGRTAIKELNGQIVNEKPLKIEAATSRKGPNTPTTKVFVGNLSDNTRAPEVRELFVPYGTVVECDIV---   77 (346)
Q Consensus         1 ~aFV~F~~~e~A~~Al~~lng~~l~g~~i~v~~~~~~~~~~~~~~~lfV~nLp~~~~e~~L~~~F~~~G~v~~~~i~---   77 (346)
                      .|||+|.+.++|++||+.|||..|.|+.|.|.++.+.... ...++|||+|||..+++++|+++|++||.|..+.++   
T Consensus        47 ~afV~f~~~~~A~~Ai~~l~g~~l~g~~i~v~~a~~~~~~-~~~~~l~v~~l~~~~~~~~l~~~f~~~G~i~~~~~~~~~  125 (352)
T TIGR01661        47 YGFVNYVRPEDAEKAVNSLNGLRLQNKTIKVSYARPSSDS-IKGANLYVSGLPKTMTQHELESIFSPFGQIITSRILSDN  125 (352)
T ss_pred             EEEEEECcHHHHHHHHhhcccEEECCeeEEEEeecccccc-cccceEEECCccccCCHHHHHHHHhccCCEEEEEEEecC
Confidence            3899999999999999999999999999999998765432 456789999999999999999999999999999886   


Q ss_pred             -----CCEEEEEecC-HHHHHHHHHhCCcEECC--EEEEEEEeec
Q psy16419         78 -----RNYGFVHIDS-PDINKCIKELNGMMVDG--KPMKVVVAGF  114 (346)
Q Consensus        78 -----~g~afV~f~~-~~a~~Ai~~l~g~~~~g--~~l~v~~a~~  114 (346)
                           +|||||+|.+ ++|++|++.|||..+.|  .+|.|.++..
T Consensus       126 ~~~~~~g~~fv~f~~~~~A~~ai~~l~g~~~~g~~~~i~v~~a~~  170 (352)
T TIGR01661       126 VTGLSKGVGFIRFDKRDEADRAIKTLNGTTPSGCTEPITVKFANN  170 (352)
T ss_pred             CCCCcCcEEEEEECCHHHHHHHHHHhCCCccCCCceeEEEEECCC
Confidence                 6899999999 99999999999999987  5788888766



These proteins contain 3 RNA-recognition motifs (rrm: pfam00076).

>KOG0117|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>KOG2253|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG4574|consensus Back     alignment and domain information
>PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query346
2dnp_A90 Solution Structure Of Rna Binding Domain 2 In Rna-B 1e-10
2dnp_A90 Solution Structure Of Rna Binding Domain 2 In Rna-B 2e-08
2dnq_A90 Solution Structure Of Rna Binding Domain 1 In Rna-B 7e-09
2dgt_A92 Solution Structure Of The Second Rna Binding Domain 3e-08
2dgt_A92 Solution Structure Of The Second Rna Binding Domain 4e-06
2d9p_A103 Solution Structure Of Rna Binding Domain 4 In Polya 5e-05
1cvj_A190 X-Ray Crystal Structure Of The Poly(A)-Binding Prot 1e-04
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 1e-04
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 1e-04
3sde_B261 Crystal Structure Of A Paraspeckle-Protein Heterodi 5e-04
>pdb|2DNP|A Chain A, Solution Structure Of Rna Binding Domain 2 In Rna-Binding Protein 14 Length = 90 Back     alignment and structure

Iteration: 1

Score = 64.3 bits (155), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 1/72 (1%) Query: 39 GPNTPTTKVFVGNLSDNTRAPEVRELFVPYGTVVECDIVRNYGFVHID-SPDINKCIKEL 97 G + T K+FVGN+S + E+R LF G V+ECD+V++Y FVH++ D I +L Sbjct: 4 GSSGNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHMEKEADAKAAIAQL 63 Query: 98 NGMMVDGKPMKV 109 NG V GK + V Sbjct: 64 NGKEVKGKRINV 75
>pdb|2DNP|A Chain A, Solution Structure Of Rna Binding Domain 2 In Rna-Binding Protein 14 Length = 90 Back     alignment and structure
>pdb|2DNQ|A Chain A, Solution Structure Of Rna Binding Domain 1 In Rna-Binding Protein 30 Length = 90 Back     alignment and structure
>pdb|2DGT|A Chain A, Solution Structure Of The Second Rna Binding Domain In Rna- Binding Protein 30 Length = 92 Back     alignment and structure
>pdb|2DGT|A Chain A, Solution Structure Of The Second Rna Binding Domain In Rna- Binding Protein 30 Length = 92 Back     alignment and structure
>pdb|2D9P|A Chain A, Solution Structure Of Rna Binding Domain 4 In Polyadenylation Binding Protein 3 Length = 103 Back     alignment and structure
>pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 Back     alignment and structure
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure
>pdb|3SDE|B Chain B, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query346
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 1e-24
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 6e-12
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 3e-04
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 2e-23
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 5e-09
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 2e-23
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 7e-13
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 1e-05
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 1e-22
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 2e-14
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 5e-05
1b7f_A 168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 8e-05
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 6e-22
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-11
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-04
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 1e-21
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 3e-18
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 5e-06
2qfj_A 216 FBP-interacting repressor; protein-DNA complex; HE 8e-05
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 3e-21
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 6e-12
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 5e-21
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 8e-10
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 3e-06
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-20
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 4e-14
1fje_B 175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 3e-05
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-20
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 5e-14
1fxl_A 167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-05
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 3e-05
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 2e-20
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-20
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 4e-15
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 6e-05
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-04
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-04
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 4e-20
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 3e-08
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 5e-20
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 2e-08
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 5e-20
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 4e-14
3nmr_A 175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 6e-07
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 7e-06
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 6e-20
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 4e-09
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 1e-19
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 2e-09
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 5e-19
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 5e-10
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-05
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 7e-19
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 4e-12
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 3e-07
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 8e-19
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 2e-16
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 7e-07
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 1e-05
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 5e-18
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 7e-05
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 8e-05
2kt5_A124 RNA and export factor-binding protein 2; chaperone 6e-18
2kt5_A124 RNA and export factor-binding protein 2; chaperone 1e-04
2kt5_A124 RNA and export factor-binding protein 2; chaperone 2e-04
2cpj_A99 Non-POU domain-containing octamer-binding protein; 8e-18
2cpj_A99 Non-POU domain-containing octamer-binding protein; 1e-08
2i2y_A150 Fusion protein consists of immunoglobin G- binding 1e-17
2i2y_A150 Fusion protein consists of immunoglobin G- binding 8e-07
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 1e-17
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 3e-05
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 4e-04
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 1e-17
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 3e-05
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 2e-17
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 3e-06
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 4e-04
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 5e-17
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 8e-16
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-11
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 6e-06
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 6e-17
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 2e-05
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 7e-04
1x5o_A114 RNA binding motif, single-stranded interacting pro 8e-17
1x5o_A114 RNA binding motif, single-stranded interacting pro 8e-04
2f3j_A177 RNA and export factor binding protein 2; RRM domai 9e-17
2f3j_A177 RNA and export factor binding protein 2; RRM domai 9e-04
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-16
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 8e-05
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 2e-16
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 6e-05
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 2e-16
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 1e-05
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 3e-16
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 8e-05
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 2e-04
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 4e-16
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 4e-16
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 1e-07
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 5e-16
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 6e-16
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 4e-05
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 4e-04
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 6e-16
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 2e-04
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 6e-16
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 1e-04
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 9e-16
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 2e-05
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 1e-15
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 5e-06
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-15
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 9e-05
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 8e-04
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 1e-15
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 8e-05
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-15
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-07
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 2e-15
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 5e-08
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 2e-15
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 2e-06
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 2e-15
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 6e-05
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 3e-15
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 5e-06
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 3e-15
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 2e-09
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 8e-06
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 3e-15
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 2e-08
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 3e-15
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 8e-06
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 4e-15
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 9e-05
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 4e-15
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 1e-05
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 4e-15
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 2e-04
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 5e-15
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 1e-05
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 6e-15
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 5e-05
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 6e-15
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 3e-06
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-14
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-07
1x4e_A85 RNA binding motif, single-stranded interacting pro 1e-14
1x4e_A85 RNA binding motif, single-stranded interacting pro 2e-05
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 2e-14
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 1e-06
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 2e-14
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 6e-05
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 2e-14
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 3e-05
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 2e-14
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 1e-05
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 4e-14
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 2e-05
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 5e-14
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 5e-04
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 6e-14
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 3e-05
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 6e-14
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 2e-05
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 6e-14
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 8e-06
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 3e-04
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 7e-14
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 7e-14
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-05
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 7e-14
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 7e-04
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 1e-13
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 1e-13
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 4e-06
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 1e-13
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 1e-04
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 2e-13
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 3e-05
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 2e-13
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 3e-06
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 4e-13
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 2e-09
2cjk_A 167 Nuclear polyadenylated RNA-binding protein 4; HRP1 8e-07
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 9e-07
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 4e-13
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 5e-13
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 2e-09
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 8e-13
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 5e-07
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 2e-12
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 3e-04
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 2e-12
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 8e-08
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 1e-06
1l3k_A 196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 1e-06
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 2e-12
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 2e-12
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 1e-04
1x5p_A97 Negative elongation factor E; structure genomics, 5e-12
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 6e-12
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 6e-12
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 3e-06
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 7e-12
2cph_A107 RNA binding motif protein 19; RNA recognition moti 7e-12
2cph_A107 RNA binding motif protein 19; RNA recognition moti 3e-05
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 8e-12
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 2e-05
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 8e-12
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 2e-04
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 9e-12
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 1e-11
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-04
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 1e-11
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 5e-05
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 1e-11
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 9e-07
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 2e-11
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 9e-07
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 3e-11
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 6e-05
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 3e-11
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 2e-05
3q2s_C229 Cleavage and polyadenylation specificity factor S; 3e-11
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 3e-11
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 4e-04
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 4e-11
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 1e-04
3n9u_C156 Cleavage and polyadenylation specificity factor S; 4e-11
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 4e-11
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 1e-04
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 4e-11
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 6e-04
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 4e-11
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 3e-05
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 5e-11
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 5e-11
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 1e-07
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 6e-11
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 6e-11
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 7e-05
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 1e-10
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 1e-10
3p5t_L90 Cleavage and polyadenylation specificity factor S; 2e-10
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 2e-10
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 1e-07
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 2e-10
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 2e-10
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 7e-07
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 4e-10
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 3e-08
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 4e-10
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 6e-04
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 6e-10
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 5e-04
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 6e-10
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 6e-10
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 7e-10
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 9e-10
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 1e-09
2cqd_A116 RNA-binding region containing protein 1; RNA recog 1e-09
2cqd_A116 RNA-binding region containing protein 1; RNA recog 9e-07
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 1e-09
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 2e-07
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 2e-09
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 8e-04
2la6_A99 RNA-binding protein FUS; structural genomics, nort 3e-09
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 4e-09
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 7e-09
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 9e-07
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 1e-08
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 1e-08
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 7e-07
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 2e-08
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 2e-08
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-08
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-07
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 3e-08
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 4e-06
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 3e-08
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 8e-06
2div_A99 TRNA selenocysteine associated protein; structural 3e-08
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 2e-07
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 8e-06
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 2e-07
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 4e-07
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 4e-07
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 4e-07
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 4e-06
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 5e-07
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 6e-07
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 2e-06
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 8e-07
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 8e-06
2dis_A109 Unnamed protein product; structural genomics, RRM 1e-06
2dis_A109 Unnamed protein product; structural genomics, RRM 6e-05
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 1e-05
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 2e-05
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 2e-05
2dnl_A114 Cytoplasmic polyadenylation element binding protei 3e-05
2dnl_A114 Cytoplasmic polyadenylation element binding protei 4e-04
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 3e-05
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 3e-05
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 8e-05
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 2e-04
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 2e-04
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 2e-04
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 4e-04
2krb_A81 Eukaryotic translation initiation factor 3 subunit 6e-04
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 6e-04
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
 Score = 95.0 bits (237), Expect = 1e-24
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 36  SRKGPNTPTTKVFVGNLSDNTRAPEVRELFVPYGTVVECDIVRNYGFVHIDSP-DINKCI 94
           S       +TK+ VGN+S      E+R  F  YG V+ECDIV++Y FVH++   D  + I
Sbjct: 2   SSGSSGKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAI 61

Query: 95  KELNGMMVDGKPMKVVVA 112
           + L+     GK M V ++
Sbjct: 62  RGLDNTEFQGKRMHVQLS 79


>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query346
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.96
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.96
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.93
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.92
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.92
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.92
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.92
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.91
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.91
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.91
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.9
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.9
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.9
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.89
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.89
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.89
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.89
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.88
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.88
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.86
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.86
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.86
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.86
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.86
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.85
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.85
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.85
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.84
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.84
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.84
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.84
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.83
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.83
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.83
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.83
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.83
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.81
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.79
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.77
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.77
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.74
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.74
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.73
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.73
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.72
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.72
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.72
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.72
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.72
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.72
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.72
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.72
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.71
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.71
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.71
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.71
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.7
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.7
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.7
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.7
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.7
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.69
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.69
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.69
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.69
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.69
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.69
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.68
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.68
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.68
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.68
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.68
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.68
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.68
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.68
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.68
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.68
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.68
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.68
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.68
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.68
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.67
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.67
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.67
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.67
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.67
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.67
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.67
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.67
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.67
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.67
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.67
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.67
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.67
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.67
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.66
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.66
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.66
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.66
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.66
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.66
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.65
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.65
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.65
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.65
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.65
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.65
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.65
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.65
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.65
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.65
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.65
1x5p_A97 Negative elongation factor E; structure genomics, 99.65
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.64
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.64
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.64
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.64
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.64
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.64
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.64
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.64
2div_A99 TRNA selenocysteine associated protein; structural 99.64
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.63
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.63
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.63
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.63
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.63
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.63
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.63
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.63
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.62
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.62
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.62
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.62
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.62
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.62
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.62
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.62
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.62
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.61
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.61
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.61
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.61
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.61
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.61
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.61
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.61
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.61
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.6
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.6
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.6
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.6
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.6
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.6
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.6
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.59
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.59
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.58
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.58
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.58
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.58
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.58
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.58
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.35
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.57
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.57
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.57
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.57
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.57
2dis_A109 Unnamed protein product; structural genomics, RRM 99.56
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.56
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.56
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.56
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.55
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.55
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.55
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.55
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.55
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.55
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.55
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.54
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.54
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.54
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.53
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.53
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.53
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.53
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.51
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.51
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.51
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.51
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.51
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.48
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.47
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.47
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.45
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.42
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.42
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.41
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.38
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.32
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 99.28
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.28
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.28
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.27
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.26
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.25
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.23
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.23
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.22
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.21
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.21
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.2
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.19
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.18
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.18
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.18
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.17
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.16
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.15
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.15
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.15
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.15
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.15
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.15
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.14
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.12
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.11
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.1
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.1
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.09
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.09
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.08
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.08
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.07
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.07
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.06
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.06
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.06
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.06
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.05
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.05
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.04
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.04
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.04
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.04
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.03
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.03
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.03
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.03
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.03
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.02
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.02
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.02
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.02
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.02
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.01
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.01
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.01
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.01
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.01
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.01
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.01
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.0
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.0
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.0
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.0
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.0
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.0
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.0
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 98.99
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 98.99
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 98.99
2div_A99 TRNA selenocysteine associated protein; structural 98.99
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 98.99
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 98.99
2krb_A81 Eukaryotic translation initiation factor 3 subunit 98.99
2la6_A99 RNA-binding protein FUS; structural genomics, nort 98.98
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 98.98
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 98.98
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 98.98
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 98.97
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 98.97
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 98.97
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 98.97
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 98.97
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 98.97
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 98.97
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 98.96
2cqd_A116 RNA-binding region containing protein 1; RNA recog 98.96
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 98.96
2cph_A107 RNA binding motif protein 19; RNA recognition moti 98.96
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 98.96
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 98.96
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 98.96
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 98.95
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 98.95
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 98.95
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 98.95
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 98.95
3p5t_L90 Cleavage and polyadenylation specificity factor S; 98.95
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 98.94
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 98.94
2dis_A109 Unnamed protein product; structural genomics, RRM 98.94
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 98.94
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 98.93
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 98.93
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 98.93
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 98.92
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 98.92
3n9u_C156 Cleavage and polyadenylation specificity factor S; 98.92
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 98.92
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 98.91
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 98.91
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 98.91
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 98.9
1x5o_A114 RNA binding motif, single-stranded interacting pro 98.9
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.9
2dnl_A114 Cytoplasmic polyadenylation element binding protei 98.9
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 98.89
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 98.89
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 98.89
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 98.88
2kt5_A124 RNA and export factor-binding protein 2; chaperone 98.88
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 98.88
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 98.88
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 98.87
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 98.87
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 98.87
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 98.87
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 98.87
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 98.86
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 98.86
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 98.86
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 98.86
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 98.85
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 98.85
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 98.84
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 98.83
3q2s_C 229 Cleavage and polyadenylation specificity factor S; 98.83
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 98.83
1x5p_A97 Negative elongation factor E; structure genomics, 98.83
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 98.82
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.82
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 98.82
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 98.82
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 98.81
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 98.81
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 98.81
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 98.8
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 98.8
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 98.8
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 98.76
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 98.75
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 98.74
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 98.73
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 98.72
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 98.7
2f3j_A177 RNA and export factor binding protein 2; RRM domai 98.69
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 98.69
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 98.69
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 98.13
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 98.67
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 98.66
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 98.61
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 98.59
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.49
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.39
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.38
2dit_A112 HIV TAT specific factor 1 variant; structural geno 98.18
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 98.18
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 98.16
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 97.71
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 97.69
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 97.64
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 97.58
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 97.47
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.41
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.26
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 97.09
3ts2_A148 Protein LIN-28 homolog A; microrna biogenesis, pro 96.94
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 96.93
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 96.35
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 96.29
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 96.06
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 94.85
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 94.81
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 94.66
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 94.28
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 93.82
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 93.75
1a6b_B40 Momulv, zinc finger protein NCP10; nucleocapsid pr 93.67
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 93.33
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 92.51
1dsq_A26 Nucleic acid binding protein P14; CCHC type zinc f 92.45
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 92.05
1u6p_A56 GAG polyprotein; MLV, A-minor K-turn, stem loop, b 89.95
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 87.99
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 85.23
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 82.68
2ysa_A55 Retinoblastoma-binding protein 6; zinc finger, CCH 80.1
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
Probab=99.96  E-value=1.6e-28  Score=224.41  Aligned_cols=107  Identities=20%  Similarity=0.339  Sum_probs=101.0

Q ss_pred             CeEEEecCHHHHHHHHHHhCCCeeCCeeeEEeecCCCCCCCCCCcEEEEcCCCCCCCHHHHHHhhcCCCCeEEEEEE---
Q psy16419          1 MSSGHMENDEEGRTAIKELNGQIVNEKPLKIEAATSRKGPNTPTTKVFVGNLSDNTRAPEVRELFVPYGTVVECDIV---   77 (346)
Q Consensus         1 ~aFV~F~~~e~A~~Al~~lng~~l~g~~i~v~~~~~~~~~~~~~~~lfV~nLp~~~~e~~L~~~F~~~G~v~~~~i~---   77 (346)
                      .|||+|.+.++|++|++.|||..+.|+.|.|.+..       ..++|||+|||+.+++++|+++|+.||.|.++.++   
T Consensus        59 ~afV~f~~~~~A~~A~~~l~~~~~~g~~i~v~~~~-------~~~~l~v~nlp~~~t~~~l~~~f~~~G~i~~~~i~~~~  131 (284)
T 3smz_A           59 TAFVTLLNGEQAEAAINAFHQSRLRERELSVQLQP-------TDALLCVANLPPSLTQQQFEELVRPFGSLERCFLVYSE  131 (284)
T ss_dssp             EEEEEESSHHHHHHHHHHHTTCEETTEECEEEECC-------CSCEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECT
T ss_pred             EEEEEeCCHHHHHHHHHHcCCCeeCCeEEEEEecC-------CCCEEEEcCCCCcCCHHHHHHHHHhcCCeeEEEEEeeC
Confidence            48999999999999999999999999999999864       35799999999999999999999999999999887   


Q ss_pred             -----CCEEEEEecC-HHHHHHHHHhCCcEECCEEEEEEEeec
Q psy16419         78 -----RNYGFVHIDS-PDINKCIKELNGMMVDGKPMKVVVAGF  114 (346)
Q Consensus        78 -----~g~afV~f~~-~~a~~Ai~~l~g~~~~g~~l~v~~a~~  114 (346)
                           +|||||+|.+ ++|.+|+..|+|..++|++|.|.++.+
T Consensus       132 ~~g~~~g~afV~f~~~~~a~~A~~~l~~~~~~g~~i~v~~a~~  174 (284)
T 3smz_A          132 RTGQSKGYGFAEYMKKDSAARAKSDLLGKPLGPRTLYVHWTDA  174 (284)
T ss_dssp             TTCCEEEEEEEEESSHHHHHHHHHHHTTCEETTEECEEEECCG
T ss_pred             CCCccceEEEEEECCHHHHHHHHHHhCCCEeCCcEEEEEECCC
Confidence                 5799999999 999999999999999999999999877



>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1 Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1u6p_A GAG polyprotein; MLV, A-minor K-turn, stem loop, bulge, G-U mismatch, G-A MIS U mismatch, A-C mismatch, zinc finger, NC, viral protein-RN; HET: AP7; NMR {Moloney murine leukemia virus} SCOP: g.40.1.1 PDB: 1wwd_A 1wwe_A 1wwf_A 1wwg_A Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ysa_A Retinoblastoma-binding protein 6; zinc finger, CCHC, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 346
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-17
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-06
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 0.001
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 6e-17
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 1e-04
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 6e-13
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 0.001
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 2e-12
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 3e-04
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 5e-04
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 2e-12
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 0.001
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 2e-12
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 3e-04
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 3e-12
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 2e-04
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 3e-12
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 0.002
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 0.004
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 1e-11
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 0.004
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 3e-11
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 0.003
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 4e-11
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 0.002
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 6e-11
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 1e-10
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 1e-10
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 1e-10
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 1e-04
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 2e-10
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 0.003
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 2e-10
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 2e-10
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 2e-04
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 2e-10
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 7e-04
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 3e-10
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 0.001
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 3e-10
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 2e-04
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 0.001
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 3e-10
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 4e-10
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 0.002
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 5e-10
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 5e-10
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 0.002
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 8e-10
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 8e-10
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 9e-10
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-09
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 0.004
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 2e-09
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 2e-09
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 0.002
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 2e-09
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 3e-09
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 4e-09
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 6e-09
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 0.004
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 7e-09
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 8e-09
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 8e-09
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 8e-09
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 9e-09
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 0.002
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 9e-09
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 1e-08
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 1e-08
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 1e-08
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 0.003
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 2e-08
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 2e-08
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 3e-08
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 3e-08
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-08
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 4e-08
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 8e-08
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-07
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 1e-07
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 0.001
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 1e-07
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 2e-07
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 2e-07
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 3e-07
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 0.004
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 4e-07
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 6e-07
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 9e-07
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 1e-06
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 1e-06
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 1e-06
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 2e-06
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 2e-06
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 4e-06
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 4e-06
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 5e-04
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 5e-06
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 6e-06
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 6e-06
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 1e-05
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 2e-05
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 2e-05
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 2e-05
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 8e-05
d1u1qa_ 183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 5e-04
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 4e-05
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 5e-05
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 5e-05
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 9e-05
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-04
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 4e-04
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 5e-04
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 9e-04
d2exfa142 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunod 0.003
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Heterogeneous nuclear ribonucleoproteins C1/C2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 74.1 bits (182), Expect = 3e-17
 Identities = 18/82 (21%), Positives = 42/82 (51%), Gaps = 2/82 (2%)

Query: 33  AATSRKGPNTPTTKVFVGNLS-DNTRAPEVRELFVPYGTVVECDIVRNYGFVHIDSP-DI 90
            ++ +  P +  ++VF+GNL+    +  +V  +F  YG +V C + + + FV   +  + 
Sbjct: 4   GSSGKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNA 63

Query: 91  NKCIKELNGMMVDGKPMKVVVA 112
              +   +G M+ G+ + + +A
Sbjct: 64  RAAVAGEDGRMIAGQVLDINLA 85


>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Length = 42 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query346
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.88
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.77
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.76
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.76
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.75
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.75
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.75
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.75
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.74
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.74
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.74
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.74
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.73
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.73
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.73
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.73
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.73
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.72
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.72
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.72
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.72
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.72
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.72
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.72
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.72
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.71
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.71
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.71
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.71
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.7
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.7
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.7
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.7
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.7
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.69
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.69
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.69
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.69
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.69
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.69
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.68
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.68
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.68
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.68
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.68
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.68
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.68
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.67
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.67
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.67
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.67
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.67
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.67
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.66
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.66
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.65
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.65
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.65
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.65
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.65
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.65
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.65
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.65
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.64
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.64
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.64
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.64
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.62
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.61
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.6
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.6
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.6
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.6
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.6
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.59
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.56
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.55
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.55
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.53
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.46
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.45
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.41
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.41
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.34
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.3
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.29
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.28
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.25
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.23
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.22
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.21
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.21
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.2
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.19
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.19
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.18
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.18
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.17
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.17
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.17
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.16
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.16
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.16
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.16
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.14
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.14
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.14
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.14
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.14
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.14
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.13
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.13
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.13
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.12
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.12
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.12
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.12
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.12
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.11
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.11
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.11
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.1
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.09
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.09
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.09
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.09
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.09
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.08
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.08
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.07
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.07
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.07
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.06
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.05
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.05
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.04
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.04
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.03
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.03
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.03
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.03
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.01
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.01
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.01
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.01
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 98.99
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 98.99
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 98.99
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.98
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 98.97
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 98.94
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 98.94
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 98.93
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.93
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 98.9
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 98.89
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 98.89
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 98.89
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 98.84
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 98.84
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 98.83
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 98.79
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 98.78
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.77
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 98.68
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 98.65
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 98.65
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 98.57
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 98.37
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 97.77
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 97.68
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.35
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 97.34
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.06
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 96.98
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 93.02
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 92.9
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 87.72
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 87.69
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 83.56
d2exfa142 HIV nucleocapsid {Human immunodeficiency virus typ 81.5
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.88  E-value=3.3e-22  Score=168.66  Aligned_cols=70  Identities=27%  Similarity=0.515  Sum_probs=61.7

Q ss_pred             CcEEEEcCCCCCCCHHHHHHhhcCCCCeEEEEEE--------CCEEEEEecC-HHHHHHHHHhCCcEECCEEEEEEEeec
Q psy16419         44 TTKVFVGNLSDNTRAPEVRELFVPYGTVVECDIV--------RNYGFVHIDS-PDINKCIKELNGMMVDGKPMKVVVAGF  114 (346)
Q Consensus        44 ~~~lfV~nLp~~~~e~~L~~~F~~~G~v~~~~i~--------~g~afV~f~~-~~a~~Ai~~l~g~~~~g~~l~v~~a~~  114 (346)
                      .++|||+|||+.+|+++|+++|++||.|.++.++        +|||||+|.+ ++|.+|+. +++..++++.+.+....+
T Consensus         6 ~r~lfV~nLp~~~te~~L~~~F~~~G~v~~~~~~~~~~~~~~~g~afv~f~~~~~a~~a~~-~~~~~~~~~~~~~~~~~~   84 (183)
T d1u1qa_           6 LRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMN-ARPHKVDGRVVEPKRAVS   84 (183)
T ss_dssp             HHEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHH-TCSCEETTEECEEEECCC
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHcCCEEEEEeeecccCCCccCceecccCCHHHHHHHHH-hcCCcccccchhhhhhhh
Confidence            4799999999999999999999999999999887        6899999999 99999988 467778888877766544



>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Back     information, alignment and structure