Psyllid ID: psy16503


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240----
MNETDIKKFLDESVNGVIYFSMGSIIQGKSFPSDKRKAFLRAFEQIPQRVIWKWEGENMSGKIDKILLKSWAPQRDILDHPNVKVFISHGGFLGTTEALYSGVPIIGIPMFGDQKANIRVVEKAGFGVTLPYDQITEETVLVALRTVLGNPSYKKRAEKVARLFQDRPMPPLDTAIYWIEHVIRHGGGAHLRPASLELYWWQYILLDVIIALILLIAAMVWSIQWLVRYALITYYNTVDDKKRN
ccHHHHHHHHHHccccEEEEEcccccccccccHHHHHHHHHHHHccccEEEEEEcccccccccccEEEEccccccccccccccEEEEEccccHHHHHHHHHcccEEcccccccHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc
ccHHHHHHHHHcccccEEEEEcccccccccccHHHHHHHHHHHHccccEEEEEEccccccccccccEEEEEccccccccccccEEEEEccccccHHHHHHccccEEcccccccccHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc
MNETDIKKFLDESVNGVIYFSMgsiiqgksfpsdKRKAFLRAFEQIPQRVIWKWegenmsgkIDKILLkswapqrdildhpnvkvfishggflgttealysgvpiigipmfgdqkANIRVVEKagfgvtlpydqitEETVLVALRTVLGNPSYKKRAEKVARLfqdrpmppldtaIYWIEHVIrhgggahlrpaSLELYWWQYILLDVIIALILLIAAMVWSIQWLVRYALITYYNtvddkkrn
mnetdikkFLDESVNGVIYFSMGSIIQGKSFPSDKRKAFLRAFEQIpqrviwkwegenmSGKIDKILLKSWAPQRDILDHPNVKVFISHGGFLGTTEALYSGVPIIGIPMFGDQKANIRVVEKAGFGVTLPYDQITEETVLVALRtvlgnpsykkRAEKVarlfqdrpmppLDTAIYWIEHVIRHGGGAHLRPASLELYWWQYILLDVIIALILLIAAMVWSIQWLVRYALITYyntvddkkrn
MNETDIKKFLDESVNGVIYFSMGSIIQGKSFPSDKRKAFLRAFEQIPQRVIWKWEGENMSGKIDKILLKSWAPQRDILDHPNVKVFISHGGFLGTTEALYSGVPIIGIPMFGDQKANIRVVEKAGFGVTLPYDQITEETVLVALRTVLGNPSYKKRAEKVARLFQDRPMPPLDTAIYWIEHVIRHGGGAHLRPASLELYWWQYilldviialilliaaMVWSIQWLVRYALITYYNTVDDKKRN
*******KFLDESVNGVIYFSMGSIIQGKSFPSDKRKAFLRAFEQIPQRVIWKWEGENMSGKIDKILLKSWAPQRDILDHPNVKVFISHGGFLGTTEALYSGVPIIGIPMFGDQKANIRVVEKAGFGVTLPYDQITEETVLVALRTVLGNPSYKKRAEKVARLFQDRPMPPLDTAIYWIEHVIRHGGGAHLRPASLELYWWQYILLDVIIALILLIAAMVWSIQWLVRYALITYYNTV******
*NETDIKKFLDESVNGVIYFSMGSIIQGKSFPSDKRKAFLRAFEQIPQRVIWKWEGENMSGKIDKILLKSWAPQRDILDHPNVKVFISHGGFLGTTEALYSGVPIIGIPMFGDQKANIRVVEKAGFGVTLPYDQITEETVLVALRTVLGNPSYKKRAEKVARLFQDRPMPPLDTAIYWIEHVIRHGGGAHLRPASLELYWWQYILLDVIIALILLIAAMVWSIQWLVRYALITY***V******
MNETDIKKFLDESVNGVIYFSMGSIIQGKSFPSDKRKAFLRAFEQIPQRVIWKWEGENMSGKIDKILLKSWAPQRDILDHPNVKVFISHGGFLGTTEALYSGVPIIGIPMFGDQKANIRVVEKAGFGVTLPYDQITEETVLVALRTVLGNPSYKKRAEKVARLFQDRPMPPLDTAIYWIEHVIRHGGGAHLRPASLELYWWQYILLDVIIALILLIAAMVWSIQWLVRYALITYYNTVDDKKRN
*****I*KFLDESVNGVIYFSMGSIIQGKSFPSDKRKAFLRAFEQIPQRVIWKWEGENMSGKIDKILLKSWAPQRDILDHPNVKVFISHGGFLGTTEALYSGVPIIGIPMFGDQKANIRVVEKAGFGVTLPYDQITEETVLVALRTVLGNPSYKKRAEKVARLFQDRPMPPLDTAIYWIEHVIRHGGGAHLRPASLELYWWQYILLDVIIALILLIAAMVWSIQWLVRYALITYYNTV******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNETDIKKFLDESVNGVIYFSMGSIIQGKSFPSDKRKAFLRAFEQIPQRVIWKWEGENMSGKIDKILLKSWAPQRDILDHPNVKVFISHGGFLGTTEALYSGVPIIGIPMFGDQKANIRVVEKAGFGVTLPYDQITEETVLVALRTVLGNPSYKKRAEKVARLFQDRPMPPLDTAIYWIEHVIRHGGGAHLRPASLELYWWQYILLDVIIALILLIAAMVWSIQWLVRYALITYYNTVDDKKRN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query244 2.2.26 [Sep-21-2011]
P36514502 UDP-glucuronosyltransfera yes N/A 0.971 0.472 0.383 1e-47
Q9Y4X1527 UDP-glucuronosyltransfera no N/A 0.893 0.413 0.406 3e-46
Q5RFJ3527 UDP-glucuronosyltransfera no N/A 0.971 0.449 0.379 4e-46
Q6K1J1530 UDP-glucuronosyltransfera no N/A 0.885 0.407 0.397 4e-46
Q6UWM9527 UDP-glucuronosyltransfera no N/A 0.971 0.449 0.375 1e-45
P36512531 UDP-glucuronosyltransfera no N/A 0.877 0.403 0.406 3e-45
Q8BWQ1534 UDP-glucuronosyltransfera no N/A 0.975 0.445 0.373 5e-45
O97951529 UDP-glucuronosyltransfera N/A N/A 0.922 0.425 0.381 7e-45
O77649530 UDP-glucuronosyltransfera N/A N/A 0.922 0.424 0.390 9e-45
Q9GLD9529 UDP-glucuronosyltransfera no N/A 0.922 0.425 0.385 1e-44
>sp|P36514|UD2C1_RABIT UDP-glucuronosyltransferase 2C1 (Fragment) OS=Oryctolagus cuniculus GN=UGT2C1 PE=2 SV=1 Back     alignment and function desciption
 Score =  189 bits (481), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 92/240 (38%), Positives = 148/240 (61%), Gaps = 3/240 (1%)

Query: 5   DIKKFLDESVN-GVIYFSMGSIIQGKSFPSDKRKAFLRAFEQIPQRVIWKWEGENMSGKI 63
           ++++F+  S N GV+ F++GS+IQ  +   ++      A  QIPQ+V+W++ G+  +   
Sbjct: 264 ELEEFVQSSGNDGVVVFTLGSMIQ--NLTEERSNLIASALAQIPQKVLWRYTGKKPATLG 321

Query: 64  DKILLKSWAPQRDILDHPNVKVFISHGGFLGTTEALYSGVPIIGIPMFGDQKANIRVVEK 123
               L  W PQ D+L HP  + FI+HGG  G  EA+Y GVP++GIP+FGDQ  NI  V+ 
Sbjct: 322 PNTRLFEWIPQNDLLGHPKTRAFITHGGTNGLYEAIYHGVPMVGIPLFGDQPDNIARVKA 381

Query: 124 AGFGVTLPYDQITEETVLVALRTVLGNPSYKKRAEKVARLFQDRPMPPLDTAIYWIEHVI 183
            G  V +    +T  ++L AL+ V+ NPSYK+ A K++R+  D+P+ PLD A++WIE V+
Sbjct: 382 KGAAVDVDLRIMTTSSLLKALKDVINNPSYKENAMKLSRIHHDQPLKPLDRAVFWIEFVM 441

Query: 184 RHGGGAHLRPASLELYWWQYILLDVIIALILLIAAMVWSIQWLVRYALITYYNTVDDKKR 243
           RH G  HLR A+ +L W+QY  LDV++ L+  +A +++  +    +    +  T + +KR
Sbjct: 442 RHKGARHLRVAAHDLTWFQYYSLDVVVFLLTCVATIIFLAKKCCLFFYRRFCKTGNKRKR 501




UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.
Oryctolagus cuniculus (taxid: 9986)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 1EC: 7
>sp|Q9Y4X1|UD2A1_HUMAN UDP-glucuronosyltransferase 2A1 OS=Homo sapiens GN=UGT2A1 PE=1 SV=2 Back     alignment and function description
>sp|Q5RFJ3|UD2A3_PONAB UDP-glucuronosyltransferase 2A3 OS=Pongo abelii GN=UGT2A3 PE=2 SV=1 Back     alignment and function description
>sp|Q6K1J1|UDB31_CANFA UDP-glucuronosyltransferase 2B31 OS=Canis familiaris GN=UGT2B31 PE=1 SV=1 Back     alignment and function description
>sp|Q6UWM9|UD2A3_HUMAN UDP-glucuronosyltransferase 2A3 OS=Homo sapiens GN=UGT2A3 PE=2 SV=2 Back     alignment and function description
>sp|P36512|UDB13_RABIT UDP-glucuronosyltransferase 2B13 OS=Oryctolagus cuniculus GN=UGT2B13 PE=2 SV=1 Back     alignment and function description
>sp|Q8BWQ1|UD2A3_MOUSE UDP-glucuronosyltransferase 2A3 OS=Mus musculus GN=Ugt2a3 PE=2 SV=1 Back     alignment and function description
>sp|O97951|UDB18_MACFA UDP-glucuronosyltransferase 2B18 OS=Macaca fascicularis GN=UGT2B18 PE=1 SV=1 Back     alignment and function description
>sp|O77649|UDB20_MACFA UDP-glucuronosyltransferase 2B20 OS=Macaca fascicularis GN=UGT2B20 PE=1 SV=1 Back     alignment and function description
>sp|Q9GLD9|UDB33_MACMU UDP-glucuronosyltransferase 2B33 OS=Macaca mulatta GN=UGT2B33 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query244
328714170 519 PREDICTED: UDP-glucuronosyltransferase 2 0.918 0.431 0.488 6e-67
193678784 516 PREDICTED: UDP-glucuronosyltransferase 2 0.979 0.463 0.462 6e-66
189236219 515 PREDICTED: similar to glucosyl/glucurono 0.971 0.460 0.481 6e-66
193713623 514 PREDICTED: UDP-glucuronosyltransferase 2 0.979 0.464 0.462 4e-65
157134141 521 glucosyl/glucuronosyl transferases [Aede 0.885 0.414 0.518 8e-65
270006529 504 hypothetical protein TcasGA2_TC030780 [T 0.856 0.414 0.523 7e-64
157134143 526 glucosyl/glucuronosyl transferases [Aede 0.979 0.454 0.471 2e-62
91090214 519 PREDICTED: similar to glucosyl/glucurono 0.840 0.394 0.512 9e-62
189240914 524 PREDICTED: similar to glucosyl/glucurono 0.840 0.391 0.536 1e-61
270013462 983 hypothetical protein TcasGA2_TC012061 [T 0.840 0.208 0.536 1e-61
>gi|328714170|ref|XP_001946621.2| PREDICTED: UDP-glucuronosyltransferase 2B15-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  259 bits (662), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 110/225 (48%), Positives = 165/225 (73%), Gaps = 1/225 (0%)

Query: 3   ETDIKKFLDESVNGVIYFSMGSIIQGKSFPSDKRKAFLRAFEQIPQRVIWKWEGENMSGK 62
           E DI+K++DE+ NGVIYF MGS+++G++F  +KR+ FL  F++IPQR++WKWEGE + GK
Sbjct: 279 EEDIQKYIDEAENGVIYFCMGSLLRGETFSPEKRQMFLNVFKKIPQRILWKWEGE-LPGK 337

Query: 63  IDKILLKSWAPQRDILDHPNVKVFISHGGFLGTTEALYSGVPIIGIPMFGDQKANIRVVE 122
              ++++ W PQRDIL HPNVK+FISHGG LGTTEA+Y GVPI+ +P+FGDQ  NI+ V 
Sbjct: 338 PSNVMIRKWMPQRDILAHPNVKLFISHGGLLGTTEAVYEGVPILSMPIFGDQMTNIKAVV 397

Query: 123 KAGFGVTLPYDQITEETVLVALRTVLGNPSYKKRAEKVARLFQDRPMPPLDTAIYWIEHV 182
             G    + Y  + E+ + + + ++L NP Y+++A++++  F+DRPM PL+TA+YW E+V
Sbjct: 398 SKGAAEMINYGDLNEDDIFIKITSMLTNPKYRQKAKELSEAFRDRPMSPLETAVYWTEYV 457

Query: 183 IRHGGGAHLRPASLELYWWQYILLDVIIALILLIAAMVWSIQWLV 227
           IRH G  HLR A++ + W+QY L+DV++ + L I  M     +L+
Sbjct: 458 IRHKGAPHLRSAAVGMPWYQYCLIDVLVVIFLSITTMFVLFYYLI 502




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|193678784|ref|XP_001951823.1| PREDICTED: UDP-glucuronosyltransferase 2B14-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|189236219|ref|XP_971626.2| PREDICTED: similar to glucosyl/glucuronosyl transferases [Tribolium castaneum] Back     alignment and taxonomy information
>gi|193713623|ref|XP_001945411.1| PREDICTED: UDP-glucuronosyltransferase 2A1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|157134141|ref|XP_001663166.1| glucosyl/glucuronosyl transferases [Aedes aegypti] gi|108881418|gb|EAT45643.1| AAEL003102-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|270006529|gb|EFA02977.1| hypothetical protein TcasGA2_TC030780 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|157134143|ref|XP_001663167.1| glucosyl/glucuronosyl transferases [Aedes aegypti] gi|108881419|gb|EAT45644.1| AAEL003099-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|91090214|ref|XP_967924.1| PREDICTED: similar to glucosyl/glucuronosyl transferases [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189240914|ref|XP_967845.2| PREDICTED: similar to glucosyl/glucuronosyl transferases [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270013462|gb|EFA09910.1| hypothetical protein TcasGA2_TC012061 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query244
FB|FBgn0040256517 Ugt86Dd "Ugt86Dd" [Drosophila 0.811 0.382 0.449 1.2e-47
FB|FBgn0027073532 CG4302 [Drosophila melanogaste 0.811 0.372 0.449 2.6e-47
FB|FBgn0040259528 Ugt86Da "Ugt86Da" [Drosophila 0.815 0.376 0.427 1e-45
FB|FBgn0034605530 CG15661 [Drosophila melanogast 0.815 0.375 0.417 1.3e-45
FB|FBgn0038886537 CG6475 [Drosophila melanogaste 0.811 0.368 0.419 1.3e-45
FB|FBgn0040257521 Ugt86Dc "Ugt86Dc" [Drosophila 0.946 0.443 0.392 1.3e-45
FB|FBgn0032684530 CG10178 [Drosophila melanogast 0.918 0.422 0.376 9.1e-45
ZFIN|ZDB-GENE-080227-13535 ugt1b4 "UDP glucuronosyltransf 0.807 0.368 0.43 1.9e-44
ZFIN|ZDB-GENE-080227-11531 ugt1b2 "UDP glucuronosyltransf 0.807 0.370 0.43 1.9e-44
ZFIN|ZDB-GENE-080227-14528 ugt1b5 "UDP glucuronosyltransf 0.807 0.373 0.43 1.9e-44
FB|FBgn0040256 Ugt86Dd "Ugt86Dd" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 498 (180.4 bits), Expect = 1.2e-47, P = 1.2e-47
 Identities = 89/198 (44%), Positives = 136/198 (68%)

Query:     5 DIKKFLDESVNGVIYFSMGSIIQGKSFPSDKRKAFLRAFEQIPQRVIWKWEGENMSGKID 64
             DIK+F++ S +GVIYFSMGS ++ K  P + R   L+ F ++ QRV+WK+E ++M GK  
Sbjct:   275 DIKQFIEGSPHGVIYFSMGSNVKSKDLPQETRDTLLKTFAKLKQRVLWKFEDDDMPGKPA 334

Query:    65 KILLKSWAPQRDILDHPNVKVFISHGGFLGTTEALYSGVPIIGIPMFGDQKANIRVVEKA 124
              +L+K W PQ DIL HPNVK+FISHGG L +TE++Y G PI+G+P F DQ  N++  ++ 
Sbjct:   335 NVLIKKWYPQPDILAHPNVKLFISHGGLLSSTESVYFGKPILGLPCFYDQHMNVQRAQRV 394

Query:   125 GFGVTLPYDQITEETVLVALRTVLGNPSYKKRAEKVARLFQDRPMPPLDTAIYWIEHVIR 184
             GFG+ L  + + +E +  A++T+L +PSY K +  ++  ++D+P   +D A++W E+VIR
Sbjct:   395 GFGLGLDLNNLKQEDLEKAIQTLLTDPSYAKASLAISERYRDQPQSAVDRAVWWTEYVIR 454

Query:   185 HGGGAHLRPASLELYWWQ 202
             H G  HLR  S +L + Q
Sbjct:   455 HNGAPHLRATSRDLNFIQ 472




GO:0015020 "glucuronosyltransferase activity" evidence=ISS
GO:0008152 "metabolic process" evidence=IEA
FB|FBgn0027073 CG4302 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0040259 Ugt86Da "Ugt86Da" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0034605 CG15661 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038886 CG6475 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0040257 Ugt86Dc "Ugt86Dc" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0032684 CG10178 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080227-13 ugt1b4 "UDP glucuronosyltransferase 1 family, polypeptide B4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080227-11 ugt1b2 "UDP glucuronosyltransferase 1 family, polypeptide B2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080227-14 ugt1b5 "UDP glucuronosyltransferase 1 family, polypeptide B5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.4.10.691

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query244
pfam00201500 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosy 2e-60
PHA03392507 PHA03392, egt, ecdysteroid UDP-glucosyltransferase 9e-53
COG1819406 COG1819, COG1819, Glycosyl transferases, related t 6e-24
cd03784401 cd03784, GT1_Gtf_like, This family includes the Gt 1e-22
TIGR01426392 TIGR01426, MGT, glycosyltransferase, MGT family 2e-19
PLN02167475 PLN02167, PLN02167, UDP-glycosyltransferase family 4e-12
PLN02410451 PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl 6e-12
PLN03007482 PLN03007, PLN03007, UDP-glucosyltransferase family 2e-10
PLN00164480 PLN00164, PLN00164, glucosyltransferase; Provision 2e-10
PLN02448459 PLN02448, PLN02448, UDP-glycosyltransferase family 4e-10
PLN02152455 PLN02152, PLN02152, indole-3-acetate beta-glucosyl 7e-10
PLN02534491 PLN02534, PLN02534, UDP-glycosyltransferase 1e-09
PLN02555480 PLN02555, PLN02555, limonoid glucosyltransferase 1e-09
PLN02207468 PLN02207, PLN02207, UDP-glycosyltransferase 2e-09
PLN02992481 PLN02992, PLN02992, coniferyl-alcohol glucosyltran 3e-09
PLN02554481 PLN02554, PLN02554, UDP-glycosyltransferase family 5e-09
PLN02210456 PLN02210, PLN02210, UDP-glucosyl transferase 8e-09
PLN03004451 PLN03004, PLN03004, UDP-glycosyltransferase 4e-08
PLN02670472 PLN02670, PLN02670, transferase, transferring glyc 5e-08
PLN03015470 PLN03015, PLN03015, UDP-glucosyl transferase 3e-07
PLN02173449 PLN02173, PLN02173, UDP-glucosyl transferase famil 3e-07
PLN02562448 PLN02562, PLN02562, UDP-glycosyltransferase 4e-07
PLN02863477 PLN02863, PLN02863, UDP-glucoronosyl/UDP-glucosyl 5e-07
PLN02764453 PLN02764, PLN02764, glycosyltransferase family pro 7e-06
COG0707357 COG0707, MurG, UDP-N-acetylglucosamine:LPS N-acety 7e-05
PLN00414446 PLN00414, PLN00414, glycosyltransferase family pro 2e-04
TIGR00661321 TIGR00661, MJ1255, conserved hypothetical protein 0.001
pfam13528317 pfam13528, Glyco_trans_1_3, Glycosyl transferase f 0.001
TIGR01133348 TIGR01133, murG, undecaprenyldiphospho-muramoylpen 0.001
cd03785350 cd03785, GT1_MurG, MurG is an N-acetylglucosaminyl 0.003
>gnl|CDD|201077 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosyl transferase Back     alignment and domain information
 Score =  197 bits (503), Expect = 2e-60
 Identities = 85/206 (41%), Positives = 129/206 (62%), Gaps = 2/206 (0%)

Query: 15  NGVIYFSMGSIIQGKSFPSDKRKAFLRAFEQIPQRVIWKWEGENMSGKIDKILLKSWAPQ 74
           +GV+ FS+GS++   + P +K      A  QIPQ+V+W+++G   S       L  W PQ
Sbjct: 276 HGVVVFSLGSMV--SNIPEEKANEIASALAQIPQKVLWRFDGTKPSTLGRNTRLVKWLPQ 333

Query: 75  RDILDHPNVKVFISHGGFLGTTEALYSGVPIIGIPMFGDQKANIRVVEKAGFGVTLPYDQ 134
            D+L HP  + F++H G  G  EA+  GVP++G+P+FGDQ  N + +E  G  VTL    
Sbjct: 334 NDLLGHPKTRAFVTHAGSNGVYEAICHGVPMVGMPLFGDQMDNAKHMEAKGAAVTLNVLT 393

Query: 135 ITEETVLVALRTVLGNPSYKKRAEKVARLFQDRPMPPLDTAIYWIEHVIRHGGGAHLRPA 194
           +T E +L AL+TV+ +PSYK+   +++ +  D+P+ PLD A++WIE V+RH G  HLRPA
Sbjct: 394 MTSEDLLNALKTVINDPSYKENIMRLSSIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRPA 453

Query: 195 SLELYWWQYILLDVIIALILLIAAMV 220
           + +L W+QY  LDVI  L+  +A + 
Sbjct: 454 AHDLTWYQYHSLDVIGFLLACVATVA 479


Length = 500

>gnl|CDD|223071 PHA03392, egt, ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|224732 COG1819, COG1819, Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|99960 cd03784, GT1_Gtf_like, This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>gnl|CDD|233407 TIGR01426, MGT, glycosyltransferase, MGT family Back     alignment and domain information
>gnl|CDD|215112 PLN02167, PLN02167, UDP-glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|178032 PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|178584 PLN03007, PLN03007, UDP-glucosyltransferase family protein Back     alignment and domain information
>gnl|CDD|215084 PLN00164, PLN00164, glucosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|215247 PLN02448, PLN02448, UDP-glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|177813 PLN02152, PLN02152, indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>gnl|CDD|215293 PLN02534, PLN02534, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|178170 PLN02555, PLN02555, limonoid glucosyltransferase Back     alignment and domain information
>gnl|CDD|177857 PLN02207, PLN02207, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|178572 PLN02992, PLN02992, coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>gnl|CDD|215304 PLN02554, PLN02554, UDP-glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|215127 PLN02210, PLN02210, UDP-glucosyl transferase Back     alignment and domain information
>gnl|CDD|178581 PLN03004, PLN03004, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|178275 PLN02670, PLN02670, transferase, transferring glycosyl groups Back     alignment and domain information
>gnl|CDD|178589 PLN03015, PLN03015, UDP-glucosyl transferase Back     alignment and domain information
>gnl|CDD|177830 PLN02173, PLN02173, UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|215305 PLN02562, PLN02562, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|215465 PLN02863, PLN02863, UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|178364 PLN02764, PLN02764, glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|223779 COG0707, MurG, UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|177807 PLN00414, PLN00414, glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|233077 TIGR00661, MJ1255, conserved hypothetical protein Back     alignment and domain information
>gnl|CDD|222200 pfam13528, Glyco_trans_1_3, Glycosyl transferase family 1 Back     alignment and domain information
>gnl|CDD|233284 TIGR01133, murG, undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>gnl|CDD|99961 cd03785, GT1_MurG, MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 244
PF00201500 UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera 100.0
PHA03392507 egt ecdysteroid UDP-glucosyltransferase; Provision 100.0
KOG1192|consensus496 100.0
PLN02670472 transferase, transferring glycosyl groups 100.0
PLN02554481 UDP-glycosyltransferase family protein 100.0
PLN02207468 UDP-glycosyltransferase 100.0
PLN03004451 UDP-glycosyltransferase 100.0
PLN02208442 glycosyltransferase family protein 100.0
PLN02562448 UDP-glycosyltransferase 100.0
PLN02410451 UDP-glucoronosyl/UDP-glucosyl transferase family p 99.98
PLN02152455 indole-3-acetate beta-glucosyltransferase 99.98
PLN02992481 coniferyl-alcohol glucosyltransferase 99.98
PLN03007482 UDP-glucosyltransferase family protein 99.97
PLN02555480 limonoid glucosyltransferase 99.97
PLN02167475 UDP-glycosyltransferase family protein 99.97
PLN02863477 UDP-glucoronosyl/UDP-glucosyl transferase family p 99.97
PLN02210456 UDP-glucosyl transferase 99.97
PLN00164480 glucosyltransferase; Provisional 99.97
PLN02764453 glycosyltransferase family protein 99.97
PLN02448459 UDP-glycosyltransferase family protein 99.97
PLN03015470 UDP-glucosyl transferase 99.97
PLN02173449 UDP-glucosyl transferase family protein 99.97
PLN00414446 glycosyltransferase family protein 99.97
COG1819406 Glycosyl transferases, related to UDP-glucuronosyl 99.96
PLN02534491 UDP-glycosyltransferase 99.95
cd03784401 GT1_Gtf_like This family includes the Gtfs, a grou 99.95
TIGR01426392 MGT glycosyltransferase, MGT family. This model de 99.95
PRK12446352 undecaprenyldiphospho-muramoylpentapeptide beta-N- 99.73
COG0707357 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosami 99.73
PF04101167 Glyco_tran_28_C: Glycosyltransferase family 28 C-t 99.72
PF13528318 Glyco_trans_1_3: Glycosyl transferase family 1 99.69
TIGR00661321 MJ1255 conserved hypothetical protein. This model 99.68
PRK00726357 murG undecaprenyldiphospho-muramoylpentapeptide be 99.61
cd03785350 GT1_MurG MurG is an N-acetylglucosaminyltransferas 99.43
PRK13608391 diacylglycerol glucosyltransferase; Provisional 99.42
PRK13609380 diacylglycerol glucosyltransferase; Provisional 99.37
PLN02605382 monogalactosyldiacylglycerol synthase 99.3
TIGR01133348 murG undecaprenyldiphospho-muramoylpentapeptide be 99.29
COG4671400 Predicted glycosyl transferase [General function p 99.13
TIGR03590279 PseG pseudaminic acid biosynthesis-associated prot 99.13
TIGR03492396 conserved hypothetical protein. This protein famil 99.02
KOG3349|consensus170 99.01
COG3980318 spsG Spore coat polysaccharide biosynthesis protei 98.89
PRK00025380 lpxB lipid-A-disaccharide synthase; Reviewed 98.84
TIGR00215385 lpxB lipid-A-disaccharide synthase. Lipid-A precur 98.82
cd03814364 GT1_like_2 This family is most closely related to 98.69
COG5017161 Uncharacterized conserved protein [Function unknow 98.6
PF00534172 Glycos_transf_1: Glycosyl transferases group 1; In 98.55
PRK05749425 3-deoxy-D-manno-octulosonic-acid transferase; Revi 98.54
cd03795357 GT1_like_4 This family is most closely related to 98.53
cd03823359 GT1_ExpE7_like This family is most closely related 98.49
cd03800398 GT1_Sucrose_synthase This family is most closely r 98.48
cd03801374 GT1_YqgM_like This family is most closely related 98.44
cd03786363 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th 98.43
TIGR00236365 wecB UDP-N-acetylglucosamine 2-epimerase. Epimeras 98.42
cd04962371 GT1_like_5 This family is most closely related to 98.42
cd03794394 GT1_wbuB_like This family is most closely related 98.39
cd05844367 GT1_like_7 Glycosyltransferases catalyze the trans 98.35
cd03821375 GT1_Bme6_like This family is most closely related 98.33
PRK15484380 lipopolysaccharide 1,2-N-acetylglucosaminetransfer 98.33
cd03804351 GT1_wbaZ_like This family is most closely related 98.32
cd03820348 GT1_amsD_like This family is most closely related 98.32
PF13844468 Glyco_transf_41: Glycosyl transferase family 41; P 98.29
cd03808359 GT1_cap1E_like This family is most closely related 98.29
cd04946407 GT1_AmsK_like This family is most closely related 98.25
PLN02871465 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase 98.24
cd03822366 GT1_ecORF704_like This family is most closely rela 98.23
cd03798377 GT1_wlbH_like This family is most closely related 98.23
cd03807365 GT1_WbnK_like This family is most closely related 98.21
TIGR03449405 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino 98.2
cd03817374 GT1_UGDG_like This family is most closely related 98.19
PRK15427406 colanic acid biosynthesis glycosyltransferase WcaL 98.17
cd03825365 GT1_wcfI_like This family is most closely related 98.15
TIGR03088374 stp2 sugar transferase, PEP-CTERM/EpsH1 system ass 98.11
COG1519419 KdtA 3-deoxy-D-manno-octulosonic-acid transferase 98.11
cd04951360 GT1_WbdM_like This family is most closely related 98.09
cd03818396 GT1_ExpC_like This family is most closely related 98.09
cd03799355 GT1_amsK_like This is a family of GT1 glycosyltran 98.08
TIGR02149388 glgA_Coryne glycogen synthase, Corynebacterium fam 98.05
cd03809365 GT1_mtfB_like This family is most closely related 97.99
PRK14089347 ipid-A-disaccharide synthase; Provisional 97.97
PRK10307412 putative glycosyl transferase; Provisional 97.96
cd04949372 GT1_gtfA_like This family is most closely related 97.95
cd03792372 GT1_Trehalose_phosphorylase Trehalose phosphorylas 97.93
cd03811353 GT1_WabH_like This family is most closely related 97.92
cd03805392 GT1_ALG2_like This family is most closely related 97.92
TIGR02472439 sucr_P_syn_N sucrose-phosphate synthase, putative, 97.89
cd03813475 GT1_like_3 This family is most closely related to 97.88
cd03812358 GT1_CapH_like This family is most closely related 97.86
cd03819355 GT1_WavL_like This family is most closely related 97.85
cd03816415 GT1_ALG1_like This family is most closely related 97.84
PF02350346 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; 97.83
TIGR03087397 stp1 sugar transferase, PEP-CTERM/EpsH1 system ass 97.82
PRK09922359 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D 97.82
TIGR02918500 accessory Sec system glycosylation protein GtfA. M 97.66
cd04955363 GT1_like_6 This family is most closely related to 97.6
TIGR03568365 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, 97.53
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 97.52
TIGR02468 1050 sucrsPsyn_pln sucrose phosphate synthase/possible 97.46
cd03796398 GT1_PIG-A_like This family is most closely related 97.44
cd03802335 GT1_AviGT4_like This family is most closely relate 97.27
PRK09814333 beta-1,6-galactofuranosyltransferase; Provisional 97.26
PF04007335 DUF354: Protein of unknown function (DUF354); Inte 97.19
PHA01633335 putative glycosyl transferase group 1 97.14
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 97.1
PHA01630331 putative group 1 glycosyl transferase 97.08
PLN02275371 transferase, transferring glycosyl groups 97.07
PF1352492 Glyco_trans_1_2: Glycosyl transferases group 1 96.95
KOG4626|consensus966 96.94
cd03791476 GT1_Glycogen_synthase_DULL1_like This family is mo 96.93
PF13692135 Glyco_trans_1_4: Glycosyl transferases group 1; PD 96.86
COG0381383 WecB UDP-N-acetylglucosamine 2-epimerase [Cell env 96.84
PRK10125405 putative glycosyl transferase; Provisional 96.75
PRK15490578 Vi polysaccharide biosynthesis protein TviE; Provi 96.69
cd04950373 GT1_like_1 Glycosyltransferases catalyze the trans 96.64
cd03806419 GT1_ALG11_like This family is most closely related 96.62
TIGR02470784 sucr_synth sucrose synthase. This model represents 96.58
TIGR02095473 glgA glycogen/starch synthases, ADP-glucose type. 96.57
PLN00142815 sucrose synthase 96.39
TIGR03713519 acc_sec_asp1 accessory Sec system protein Asp1. Th 96.31
PLN02949463 transferase, transferring glycosyl groups 96.22
PRK00654466 glgA glycogen synthase; Provisional 96.02
PRK14098489 glycogen synthase; Provisional 96.01
TIGR02193319 heptsyl_trn_I lipopolysaccharide heptosyltransfera 95.89
PF02684373 LpxB: Lipid-A-disaccharide synthetase; InterPro: I 95.19
PRK10017426 colanic acid biosynthesis protein; Provisional 95.15
TIGR02919438 accessory Sec system glycosyltransferase GtfB. Mem 95.1
PRK01021608 lpxB lipid-A-disaccharide synthase; Reviewed 95.06
PRK14099485 glycogen synthase; Provisional 94.75
PF06258311 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterP 94.62
PLN02501794 digalactosyldiacylglycerol synthase 94.55
PLN02846462 digalactosyldiacylglycerol synthase 94.49
PF04464369 Glyphos_transf: CDP-Glycerol:Poly(glycerophosphate 94.3
cd01635229 Glycosyltransferase_GTB_type Glycosyltransferases 94.25
PLN02939977 transferase, transferring glycosyl groups 94.06
PF0672297 DUF1205: Protein of unknown function (DUF1205); In 93.15
PF05159269 Capsule_synth: Capsule polysaccharide biosynthesis 93.04
cd03788460 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a 92.98
COG0763381 LpxB Lipid A disaccharide synthetase [Cell envelop 92.98
PLN023161036 synthase/transferase 92.66
PRK10964322 ADP-heptose:LPS heptosyl transferase I; Provisiona 92.47
COG3660329 Predicted nucleoside-diphosphate-sugar epimerase [ 92.42
COG4370412 Uncharacterized protein conserved in bacteria [Fun 91.87
TIGR02400456 trehalose_OtsA alpha,alpha-trehalose-phosphate syn 91.45
COG0438381 RfaG Glycosyltransferase [Cell envelope biogenesis 91.44
PRK10422352 lipopolysaccharide core biosynthesis protein; Prov 90.44
PRK02155291 ppnK NAD(+)/NADH kinase family protein; Provisiona 90.27
cd03789279 GT1_LPS_heptosyltransferase Lipopolysaccharide hep 90.11
PF01075247 Glyco_transf_9: Glycosyltransferase family 9 (hept 89.83
TIGR00730178 conserved hypothetical protein, DprA/Smf-related, 89.34
TIGR02201344 heptsyl_trn_III lipopolysaccharide heptosyltransfe 88.95
COG0859334 RfaF ADP-heptose:LPS heptosyltransferase [Cell env 88.53
PF07429360 Glyco_transf_56: 4-alpha-L-fucosyltransferase glyc 87.95
PRK14077287 pnk inorganic polyphosphate/ATP-NAD kinase; Provis 87.9
TIGR02398487 gluc_glyc_Psyn glucosylglycerol-phosphate synthase 87.74
TIGR00725159 conserved hypothetical protein, DprA/Smf-related, 87.58
PRK14501 726 putative bifunctional trehalose-6-phosphate syntha 87.32
KOG0853|consensus495 87.13
cd03793590 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, 87.09
PRK04885265 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 86.43
TIGR02195334 heptsyl_trn_II lipopolysaccharide heptosyltransfer 86.26
PRK10916348 ADP-heptose:LPS heptosyltransferase II; Provisiona 86.08
PRK02649305 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 84.19
PRK03372306 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 83.75
PRK01231295 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 83.1
PRK03378292 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 82.39
COG1817346 Uncharacterized protein conserved in archaea [Func 81.14
PRK01911292 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 80.76
>PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule Back     alignment and domain information
Probab=100.00  E-value=6.9e-60  Score=434.80  Aligned_cols=232  Identities=47%  Similarity=0.863  Sum_probs=142.9

Q ss_pred             chHHHHHHhc-CCCceEEEEcCCCCCCCCCCHHHHHHHHHHHhcCCCeEEEEecCCCCCCCCCCEEEeccCChhhhhCCC
Q psy16503          3 ETDIKKFLDE-SVNGVIYFSMGSIIQGKSFPSDKRKAFLRAFEQIPQRVIWKWEGENMSGKIDKILLKSWAPQRDILDHP   81 (244)
Q Consensus         3 p~~l~~~l~~-~~~~vI~vs~Gs~~~~~~~~~~~~~~i~~al~~~~~~viw~~~~~~~~~~~~nv~~~~~~pq~~lL~h~   81 (244)
                      |++++.|+++ +++|+|||||||...  .++.+..+.++++|+++|++|||++++......|+|+++.+|+||.++|+||
T Consensus       263 ~~~~~~~~~~~~~~~vv~vsfGs~~~--~~~~~~~~~~~~~~~~~~~~~iW~~~~~~~~~l~~n~~~~~W~PQ~~lL~hp  340 (500)
T PF00201_consen  263 PEELWNFLDSSGKKGVVYVSFGSIVS--SMPEEKLKEIAEAFENLPQRFIWKYEGEPPENLPKNVLIVKWLPQNDLLAHP  340 (500)
T ss_dssp             HHHHHHHTSTTTTTEEEEEE-TSSST--T-HHHHHHHHHHHHHCSTTEEEEEETCSHGCHHHTTEEEESS--HHHHHTST
T ss_pred             ccccchhhhccCCCCEEEEecCcccc--hhHHHHHHHHHHHHhhCCCcccccccccccccccceEEEeccccchhhhhcc
Confidence            5789999998 568999999999974  4788889999999999999999999985556678999999999999999999


Q ss_pred             CeeEEEecCChhhHHHHHHhCCcEEecCCCcchhhHHHHHHHcCceeecCCCCCCHHHHHHHHHHHhCChhHHHHHHHHH
Q psy16503         82 NVKVFISHGGFLGTTEALYSGVPIIGIPMFGDQKANIRVVEKAGFGVTLPYDQITEETVLVALRTVLGNPSYKKRAEKVA  161 (244)
Q Consensus        82 ~~~l~IthgG~~s~~Eal~~gvP~i~vP~~~dQ~~na~~~~~~G~g~~l~~~~~~~~~l~~ai~~ll~~~~y~~~a~~~s  161 (244)
                      ++++||||||+||+.||+++|||+|++|+++||+.||+++++.|+|+.++.++++.++|.++|+++++|++|++||++++
T Consensus       341 ~v~~fitHgG~~s~~Ea~~~gvP~l~~P~~~DQ~~na~~~~~~G~g~~l~~~~~~~~~l~~ai~~vl~~~~y~~~a~~ls  420 (500)
T PF00201_consen  341 RVKLFITHGGLNSTQEALYHGVPMLGIPLFGDQPRNAARVEEKGVGVVLDKNDLTEEELRAAIREVLENPSYKENAKRLS  420 (500)
T ss_dssp             TEEEEEES--HHHHHHHHHCT--EEE-GCSTTHHHHHHHHHHTTSEEEEGGGC-SHHHHHHHHHHHHHSHHHHHHHHHHH
T ss_pred             cceeeeeccccchhhhhhhccCCccCCCCcccCCccceEEEEEeeEEEEEecCCcHHHHHHHHHHHHhhhHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhCCCCChHHHHHHHHHHHHHcCCCCCCCcccCCccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcc
Q psy16503        162 RLFQDRPMPPLDTAIYWIEHVIRHGGGAHLRPASLELYWWQYILLDVIIALILLIAAMVWSIQWLVRYALITYYN  236 (244)
Q Consensus       162 ~~~~~~~~~~~~~a~~~ie~~~~~~~~~~l~~~~~~~~~~~~~~lDv~~~~~~~~~~~~~~~~~~~~~~~~~~~~  236 (244)
                      ++++++|.+|.++|++|+||++||+|++||++.+.+|+|||||+|||+++++++++++++++++++++++++..+
T Consensus       421 ~~~~~~p~~p~~~~~~~ie~v~~~~~~~~l~~~~~~l~~~~~~~lDv~~~~~~~~~~~~~~~~~~~~~~~~~~~~  495 (500)
T PF00201_consen  421 SLFRDRPISPLERAVWWIEYVARHGGAPHLRSPARDLSFYQYYLLDVIAFLLLIILLIIYIIFKICRFVCRKCVK  495 (500)
T ss_dssp             HTTT-----------------------------------------------------------------------
T ss_pred             HHHhcCCCCHHHHHHHHHHHHHhcCCCcccCChhhcCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            999999999999999999999999999999999999999999999999988888777777777766665555433



This family currently consist of: Mammalian UDP-glucuronosyl transferases (2.4.1.17 from EC) (UDPGT) []. A large family of membrane-bound microsomal enzymes which catalyze the transfer of glucuronic acid to a wide variety of exogenous and endogenous lipophilic substrates. These enzymes are of major importance in the detoxification and subsequent elimination of xenobiotics such as drugs and carcinogens. A large number of putative UDPGT from Caenorhabditis elegans. Mammalian 2-hydroxyacylsphingosine 1-beta-galactosyltransferase [] (2.4.1.45 from EC) (also known as UDP-galactose-ceramide galactosyltransferase). This enzyme catalyzes the transfer of galactose to ceramide, a key enzymatic step in the biosynthesis of galactocerebrosides, which are abundant sphingolipids of the myelin membrane of the central nervous system and peripheral nervous system. Plants flavonol O(3)-glucosyltransferase (2.4.1.91 from EC). An enzyme [] that catalyzes the transfer of glucose from UDP-glucose to a flavanol. This reaction is essential and one of the last steps in anthocyanin pigment biosynthesis. Baculoviruses ecdysteroid UDP-glucosyltransferase (2.4.1 from EC) [] (egt). This enzyme catalyzes the transfer of glucose from UDP-glucose to ectysteroids which are insect molting hormones. The expression of egt in the insect host interferes with the normal insect development by blocking the molting process. Prokaryotic zeaxanthin glucosyltransferase (2.4.1 from EC) (gene crtX), an enzyme involved in carotenoid biosynthesis and that catalyses the glycosylation reaction which converts zeaxanthin to zeaxanthin-beta-diglucoside. Streptomyces macrolide glycosyltransferases (2.4.1 from EC) []. These enzymes specifically inactivates macrolide anitibiotics via 2'-O-glycosylation using UDP-glucose. These enzymes share a conserved domain of about 50 amino acid residues located in their C-terminal section.; GO: 0016758 transferase activity, transferring hexosyl groups, 0008152 metabolic process; PDB: 3HBJ_A 3HBF_A 2PQ6_A 3IA7_B 3RSC_A 3IAA_B 2IYA_A 2IYF_B 2O6L_A 2VCH_A ....

>PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>KOG1192|consensus Back     alignment and domain information
>PLN02670 transferase, transferring glycosyl groups Back     alignment and domain information
>PLN02554 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02207 UDP-glycosyltransferase Back     alignment and domain information
>PLN03004 UDP-glycosyltransferase Back     alignment and domain information
>PLN02208 glycosyltransferase family protein Back     alignment and domain information
>PLN02562 UDP-glycosyltransferase Back     alignment and domain information
>PLN02410 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02152 indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>PLN02992 coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>PLN03007 UDP-glucosyltransferase family protein Back     alignment and domain information
>PLN02555 limonoid glucosyltransferase Back     alignment and domain information
>PLN02167 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02863 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02210 UDP-glucosyl transferase Back     alignment and domain information
>PLN00164 glucosyltransferase; Provisional Back     alignment and domain information
>PLN02764 glycosyltransferase family protein Back     alignment and domain information
>PLN02448 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN03015 UDP-glucosyl transferase Back     alignment and domain information
>PLN02173 UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN00414 glycosyltransferase family protein Back     alignment and domain information
>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>PLN02534 UDP-glycosyltransferase Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>TIGR01426 MGT glycosyltransferase, MGT family Back     alignment and domain information
>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed Back     alignment and domain information
>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF04101 Glyco_tran_28_C: Glycosyltransferase family 28 C-terminal domain; InterPro: IPR007235 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PF13528 Glyco_trans_1_3: Glycosyl transferase family 1 Back     alignment and domain information
>TIGR00661 MJ1255 conserved hypothetical protein Back     alignment and domain information
>PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>PRK13608 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>PRK13609 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>PLN02605 monogalactosyldiacylglycerol synthase Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>COG4671 Predicted glycosyl transferase [General function prediction only] Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>TIGR03492 conserved hypothetical protein Back     alignment and domain information
>KOG3349|consensus Back     alignment and domain information
>COG3980 spsG Spore coat polysaccharide biosynthesis protein, predicted glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>TIGR00215 lpxB lipid-A-disaccharide synthase Back     alignment and domain information
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG5017 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00534 Glycos_transf_1: Glycosyl transferases group 1; InterPro: IPR001296 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed Back     alignment and domain information
>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) Back     alignment and domain information
>TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase Back     alignment and domain information
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional Back     alignment and domain information
>cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF13844 Glyco_transf_41: Glycosyl transferase family 41; PDB: 3PE4_C 3PE3_D 3TAX_C 2XGO_A 2JLB_B 2XGM_A 2VSY_B 2XGS_B 2VSN_A Back     alignment and domain information
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase Back     alignment and domain information
>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15427 colanic acid biosynthesis glycosyltransferase WcaL; Provisional Back     alignment and domain information
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family Back     alignment and domain information
>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK14089 ipid-A-disaccharide synthase; Provisional Back     alignment and domain information
>PRK10307 putative glycosyl transferase; Provisional Back     alignment and domain information
>cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding Back     alignment and domain information
>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose Back     alignment and domain information
>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain Back     alignment and domain information
>cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF02350 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5 Back     alignment and domain information
>TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional Back     alignment and domain information
>TIGR02918 accessory Sec system glycosylation protein GtfA Back     alignment and domain information
>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK09814 beta-1,6-galactofuranosyltransferase; Provisional Back     alignment and domain information
>PF04007 DUF354: Protein of unknown function (DUF354); InterPro: IPR007152 Members of this family are around 350 amino acids in length Back     alignment and domain information
>PHA01633 putative glycosyl transferase group 1 Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA01630 putative group 1 glycosyl transferase Back     alignment and domain information
>PLN02275 transferase, transferring glycosyl groups Back     alignment and domain information
>PF13524 Glyco_trans_1_2: Glycosyl transferases group 1 Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF13692 Glyco_trans_1_4: Glycosyl transferases group 1; PDB: 3OY2_A 3OY7_B 2Q6V_A 2HY7_A 3CV3_A 3CUY_A Back     alignment and domain information
>COG0381 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10125 putative glycosyl transferase; Provisional Back     alignment and domain information
>PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02470 sucr_synth sucrose synthase Back     alignment and domain information
>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type Back     alignment and domain information
>PLN00142 sucrose synthase Back     alignment and domain information
>TIGR03713 acc_sec_asp1 accessory Sec system protein Asp1 Back     alignment and domain information
>PLN02949 transferase, transferring glycosyl groups Back     alignment and domain information
>PRK00654 glgA glycogen synthase; Provisional Back     alignment and domain information
>PRK14098 glycogen synthase; Provisional Back     alignment and domain information
>TIGR02193 heptsyl_trn_I lipopolysaccharide heptosyltransferase I Back     alignment and domain information
>PF02684 LpxB: Lipid-A-disaccharide synthetase; InterPro: IPR003835 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PRK10017 colanic acid biosynthesis protein; Provisional Back     alignment and domain information
>TIGR02919 accessory Sec system glycosyltransferase GtfB Back     alignment and domain information
>PRK01021 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>PRK14099 glycogen synthase; Provisional Back     alignment and domain information
>PF06258 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterPro: IPR009367 This family consists of several hypothetical eukaryotic and prokaryotic proteins Back     alignment and domain information
>PLN02501 digalactosyldiacylglycerol synthase Back     alignment and domain information
>PLN02846 digalactosyldiacylglycerol synthase Back     alignment and domain information
>PF04464 Glyphos_transf: CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase ; InterPro: IPR007554 Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of Gram-positive bacteria Back     alignment and domain information
>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PLN02939 transferase, transferring glycosyl groups Back     alignment and domain information
>PF06722 DUF1205: Protein of unknown function (DUF1205); InterPro: IPR010610 This entry represents a conserved region of unknown function within bacterial glycosyl transferases Back     alignment and domain information
>PF05159 Capsule_synth: Capsule polysaccharide biosynthesis protein; InterPro: IPR007833 This family includes export proteins involved in capsule polysaccharide biosynthesis, such as KpsS P42218 from SWISSPROT and LipB P57038 from SWISSPROT Back     alignment and domain information
>cd03788 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor Back     alignment and domain information
>COG0763 LpxB Lipid A disaccharide synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02316 synthase/transferase Back     alignment and domain information
>PRK10964 ADP-heptose:LPS heptosyl transferase I; Provisional Back     alignment and domain information
>COG3660 Predicted nucleoside-diphosphate-sugar epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG4370 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02400 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>COG0438 RfaG Glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10422 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>PRK02155 ppnK NAD(+)/NADH kinase family protein; Provisional Back     alignment and domain information
>cd03789 GT1_LPS_heptosyltransferase Lipopolysaccharide heptosyltransferase is involved in the biosynthesis of lipooligosaccharide (LOS) Back     alignment and domain information
>PF01075 Glyco_transf_9: Glycosyltransferase family 9 (heptosyltransferase); InterPro: IPR002201 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>TIGR00730 conserved hypothetical protein, DprA/Smf-related, family 2 Back     alignment and domain information
>TIGR02201 heptsyl_trn_III lipopolysaccharide heptosyltransferase III, putative Back     alignment and domain information
>COG0859 RfaF ADP-heptose:LPS heptosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF07429 Glyco_transf_56: 4-alpha-L-fucosyltransferase glycosyl transferase group 56; InterPro: IPR009993 This family contains the bacterial enzyme 4-alpha-L-fucosyltransferase (Fuc4NAc transferase) (approximately 360 residues long) Back     alignment and domain information
>PRK14077 pnk inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>TIGR02398 gluc_glyc_Psyn glucosylglycerol-phosphate synthase Back     alignment and domain information
>TIGR00725 conserved hypothetical protein, DprA/Smf-related, family 1 Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>KOG0853|consensus Back     alignment and domain information
>cd03793 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, which is most closely related to the GT1 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis Back     alignment and domain information
>PRK04885 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>TIGR02195 heptsyl_trn_II lipopolysaccharide heptosyltransferase II Back     alignment and domain information
>PRK10916 ADP-heptose:LPS heptosyltransferase II; Provisional Back     alignment and domain information
>PRK02649 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK03372 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK01231 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK03378 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>COG1817 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PRK01911 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query244
2o6l_A170 Crystal Structure Of The Udp-Glucuronic Acid Bindin 2e-26
3hbf_A454 Structure Of Ugt78g1 Complexed With Myricetin And U 3e-12
2iya_A424 The Crystal Structure Of Macrolide Glycosyltransfer 4e-10
2pq6_A482 Crystal Structure Of Medicago Truncatula Ugt85h2- I 1e-09
2c1x_A456 Structure And Activity Of A Flavonoid 3-O Glucosylt 5e-09
2vce_A480 Characterization And Engineering Of The Bifunctiona 2e-07
2acv_A463 Crystal Structure Of Medicago Truncatula Ugt71g1 Le 2e-07
2acw_A465 Crystal Structure Of Medicago Truncatula Ugt71g1 Co 2e-07
4g2t_A397 Crystal Structure Of Streptomyces Sp. Sf2575 Glycos 3e-07
4fzr_A398 Crystal Structure Of Ssfs6, Streptomyces Sp. Sf2575 4e-07
2iyf_A430 The Crystal Structure Of Macrolide Glycosyltransfer 1e-05
3iaa_A416 Crystal Structure Of Calg2, Calicheamicin Glycosylt 2e-05
3rsc_A415 Crystal Structure Of Calg2, Calicheamicin Glycosylt 3e-05
2p6p_A384 X-Ray Crystal Structure Of C-C Bond-Forming Dtdp-D- 5e-05
2yjn_A441 Structure Of The Glycosyltransferase Eryciii From T 7e-04
>pdb|2O6L|A Chain A, Crystal Structure Of The Udp-Glucuronic Acid Binding Domain Of The Human Drug Metabolizing Udp-Glucuronosyltransferase 2b7 Length = 170 Back     alignment and structure

Iteration: 1

Score = 115 bits (288), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 55/152 (36%), Positives = 86/152 (56%), Gaps = 2/152 (1%) Query: 15 NGVIYFSMGSIIQGKSFPSDKRKAFLRAFEQIPQRVIWKWEGENMSGKIDKILLKSWAPQ 74 NGV+ FS+GS + + ++ A QIPQ+V+W+++G L W PQ Sbjct: 21 NGVVVFSLGSXVSNXT--EERANVIASALAQIPQKVLWRFDGNKPDTLGLNTRLYKWIPQ 78 Query: 75 RDILDHPNVKVFISHGGFLGTTEALYSGVPIIGIPMFGDQKANIRVVEKAGFGVTLPYDQ 134 D+L HP + FI+HGG G EA+Y G+P +GIP+F DQ NI + G V + ++ Sbjct: 79 NDLLGHPKTRAFITHGGANGIYEAIYHGIPXVGIPLFADQPDNIAHXKARGAAVRVDFNT 138 Query: 135 ITEETVLVALRTVLGNPSYKKRAEKVARLFQD 166 + +L AL+ V+ +PSYK+ K++R+ D Sbjct: 139 XSSTDLLNALKRVINDPSYKENVXKLSRIQHD 170
>pdb|3HBF|A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp Length = 454 Back     alignment and structure
>pdb|2IYA|A Chain A, The Crystal Structure Of Macrolide Glycosyltransferases: A Blueprint For Antibiotic Engineering Length = 424 Back     alignment and structure
>pdb|2PQ6|A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase Length = 482 Back     alignment and structure
>pdb|2C1X|A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification Length = 456 Back     alignment and structure
>pdb|2VCE|A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants Length = 480 Back     alignment and structure
>pdb|2ACV|A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Length = 463 Back     alignment and structure
>pdb|2ACW|A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose Length = 465 Back     alignment and structure
>pdb|4G2T|A Chain A, Crystal Structure Of Streptomyces Sp. Sf2575 Glycosyltransferase Ssfs6, Complexed With Thymidine Diphosphate Length = 397 Back     alignment and structure
>pdb|4FZR|A Chain A, Crystal Structure Of Ssfs6, Streptomyces Sp. Sf2575 Glycosyltransferase Length = 398 Back     alignment and structure
>pdb|2IYF|A Chain A, The Crystal Structure Of Macrolide Glycosyltransferases: A Blueprint For Antibiotic Engineering Length = 430 Back     alignment and structure
>pdb|3IAA|A Chain A, Crystal Structure Of Calg2, Calicheamicin Glycosyltransferase, Tdp Bound Form Length = 416 Back     alignment and structure
>pdb|3RSC|A Chain A, Crystal Structure Of Calg2, Calicheamicin Glycosyltransferase, Tdp And Calicheamicin T0 Bound Form Length = 415 Back     alignment and structure
>pdb|2P6P|A Chain A, X-Ray Crystal Structure Of C-C Bond-Forming Dtdp-D-Olivose-Transferase Urdgt2 Length = 384 Back     alignment and structure
>pdb|2YJN|A Chain A, Structure Of The Glycosyltransferase Eryciii From The Erythromycin Biosynthetic Pathway, In Complex With Its Activating Partner, Erycii Length = 441 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query244
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, 1e-79
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic 6e-51
2iya_A424 OLEI, oleandomycin glycosyltransferase; carbohydra 2e-49
3ia7_A402 CALG4; glycosysltransferase, calicheamicin, enediy 5e-42
3rsc_A415 CALG2; TDP, enediyne, structural genomics, PSI-2, 2e-38
2yjn_A441 ERYCIII, glycosyltransferase; transferase, cytochr 4e-33
3otg_A412 CALG1; calicheamicin, TDP, structural genomics, PS 7e-33
2p6p_A384 Glycosyl transferase; X-RAY-diffraction,urdamycina 3e-30
4fzr_A398 SSFS6; structural genomics, PSI-biology, protein s 2e-28
3tsa_A391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 3e-28
1iir_A415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 3e-26
3h4t_A404 Glycosyltransferase GTFA, glycosyltransferase; van 4e-26
1rrv_A416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 3e-25
3oti_A398 CALG3; calicheamicin, TDP, structural genomics, PS 3e-24
3hbf_A454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 5e-17
2c1x_A456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 6e-17
2acv_A463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 3e-16
2pq6_A482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 5e-16
2vch_A480 Hydroquinone glucosyltransferase; glycosyltransfer 4e-15
>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Length = 170 Back     alignment and structure
 Score =  235 bits (603), Expect = 1e-79
 Identities = 57/163 (34%), Positives = 96/163 (58%), Gaps = 3/163 (1%)

Query: 5   DIKKFLDESV-NGVIYFSMGSIIQGKSFPSDKRKAFLRAFEQIPQRVIWKWEGENMSGKI 63
           +++ F+  S  NGV+ FS+GS++   +   ++      A  QIPQ+V+W+++G       
Sbjct: 10  EMEDFVQSSGENGVVVFSLGSMV--SNMTEERANVIASALAQIPQKVLWRFDGNKPDTLG 67

Query: 64  DKILLKSWAPQRDILDHPNVKVFISHGGFLGTTEALYSGVPIIGIPMFGDQKANIRVVEK 123
               L  W PQ D+L HP  + FI+HGG  G  EA+Y G+P++GIP+F DQ  NI  ++ 
Sbjct: 68  LNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFADQPDNIAHMKA 127

Query: 124 AGFGVTLPYDQITEETVLVALRTVLGNPSYKKRAEKVARLFQD 166
            G  V + ++ ++   +L AL+ V+ +PSYK+   K++R+  D
Sbjct: 128 RGAAVRVDFNTMSSTDLLNALKRVINDPSYKENVMKLSRIQHD 170


>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Length = 430 Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Length = 424 Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Length = 402 Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Length = 415 Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 441 Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Length = 412 Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Length = 384 Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Length = 398 Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Length = 391 Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Length = 415 Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Length = 416 Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Length = 398 Back     alignment and structure
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} PDB: 3hbj_A* Length = 454 Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Length = 456 Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Length = 463 Back     alignment and structure
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Length = 482 Back     alignment and structure
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Length = 480 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query244
2vch_A480 Hydroquinone glucosyltransferase; glycosyltransfer 100.0
3hbf_A454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 100.0
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, 100.0
2c1x_A456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 99.98
2pq6_A482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 99.98
2acv_A463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 99.98
1iir_A415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 99.97
1rrv_A416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 99.97
3h4t_A404 Glycosyltransferase GTFA, glycosyltransferase; van 99.96
4amg_A400 Snogd; transferase, polyketide biosynthesis, GT1 f 99.96
2iya_A424 OLEI, oleandomycin glycosyltransferase; carbohydra 99.96
2p6p_A384 Glycosyl transferase; X-RAY-diffraction,urdamycina 99.95
2yjn_A441 ERYCIII, glycosyltransferase; transferase, cytochr 99.95
3rsc_A415 CALG2; TDP, enediyne, structural genomics, PSI-2, 99.94
4fzr_A398 SSFS6; structural genomics, PSI-biology, protein s 99.93
3ia7_A402 CALG4; glycosysltransferase, calicheamicin, enediy 99.93
3tsa_A391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 99.92
3oti_A398 CALG3; calicheamicin, TDP, structural genomics, PS 99.91
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic 99.91
3otg_A412 CALG1; calicheamicin, TDP, structural genomics, PS 99.89
3s2u_A365 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape 99.84
2jzc_A224 UDP-N-acetylglucosamine transferase subunit ALG13; 99.71
1f0k_A364 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe 99.53
3hbm_A282 UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter je 99.39
2f9f_A177 First mannosyl transferase (WBAZ-1); alpha-beta pr 98.84
1v4v_A376 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t 98.82
1vgv_A384 UDP-N-acetylglucosamine 2-epimerase; structural ge 98.8
3ot5_A403 UDP-N-acetylglucosamine 2-epimerase; structural ge 98.68
2iw1_A374 Lipopolysaccharide core biosynthesis protein RFAG; 98.62
3dzc_A396 UDP-N-acetylglucosamine 2-epimerase; structural ge 98.62
4hwg_A385 UDP-N-acetylglucosamine 2-epimerase; ssgcid, struc 98.61
3okp_A394 GDP-mannose-dependent alpha-(1-6)-phosphatidylino 98.53
3beo_A375 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a 98.52
2gek_A406 Phosphatidylinositol mannosyltransferase (PIMA); G 98.38
2x6q_A416 Trehalose-synthase TRET; biosynthetic protein; 2.2 98.37
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 98.36
3c48_A438 Predicted glycosyltransferases; retaining glycosyl 98.34
2jjm_A394 Glycosyl transferase, group 1 family protein; anth 98.3
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.3
2r60_A499 Glycosyl transferase, group 1; rossmann-fold; 1.80 98.23
2bfw_A200 GLGA glycogen synthase; glycosyltransferase family 98.21
3fro_A439 GLGA glycogen synthase; glycosyltransferase family 98.2
3oy2_A413 Glycosyltransferase B736L; rossmann fold, GDP-mann 98.13
3qhp_A166 Type 1 capsular polysaccharide biosynthesis prote 98.09
2iuy_A342 Avigt4, glycosyltransferase; antibiotics, family G 97.93
2xci_A374 KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci 97.91
3q3e_A631 HMW1C-like glycosyltransferase; N-glycosylation; 2 97.9
2qzs_A485 Glycogen synthase; glycosyl-transferase, GT-B fold 97.73
1rzu_A485 Glycogen synthase 1; glycosyl-transferase, GT-B fo 97.71
3s28_A816 Sucrose synthase 1; glycosyltransferase, sucrose m 97.61
3rhz_A339 GTF3, nucleotide sugar synthetase-like protein; gl 97.4
2x0d_A413 WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge 97.26
2hy7_A406 Glucuronosyltransferase GUMK; glycosyltransferases 97.14
2gt1_A326 Lipopolysaccharide heptosyltransferase-1; GT-B fol 95.23
2iz6_A176 Molybdenum cofactor carrier protein; metal transpo 93.98
1psw_A348 ADP-heptose LPS heptosyltransferase II; structural 93.49
3vue_A536 GBSS-I, granule-bound starch synthase 1, chloropla 93.25
3tov_A349 Glycosyl transferase family 9; structural genomics 93.15
1rcu_A195 Conserved hypothetical protein VT76; structural ge 92.58
1ydh_A216 AT5G11950; structural genomics, protein structure 88.24
3nb0_A725 Glycogen [starch] synthase isoform 2; glycogen syn 87.5
3qua_A199 Putative uncharacterized protein; structural genom 87.36
3sbx_A189 Putative uncharacterized protein; structural genom 87.04
1t35_A191 Hypothetical protein YVDD, putative lysine decarbo 84.82
3l7i_A729 Teichoic acid biosynthesis protein F; GT-B fold, m 84.79
2i2c_A272 Probable inorganic polyphosphate/ATP-NAD kinase 1; 83.69
1uqt_A482 Alpha, alpha-trehalose-phosphate synthase; glycosy 83.59
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Back     alignment and structure
Probab=100.00  E-value=1.7e-33  Score=257.13  Aligned_cols=187  Identities=19%  Similarity=0.323  Sum_probs=153.9

Q ss_pred             chHHHHHHhcC-CCceEEEEcCCCCCCCCCCHHHHHHHHHHHhcCCCeEEEEecCCC---------------C-CCCCCC
Q psy16503          3 ETDIKKFLDES-VNGVIYFSMGSIIQGKSFPSDKRKAFLRAFEQIPQRVIWKWEGEN---------------M-SGKIDK   65 (244)
Q Consensus         3 p~~l~~~l~~~-~~~vI~vs~Gs~~~~~~~~~~~~~~i~~al~~~~~~viw~~~~~~---------------~-~~~~~n   65 (244)
                      |+++.+|+++. ++++|||||||...   .+.+.+.+++++|+..+++|+|+++...               + ...|+|
T Consensus       255 ~~~~~~wLd~~~~~~vvyvs~GS~~~---~~~~~~~~~~~al~~~~~~~lw~~~~~~~~~~~~~~~~~~~~~~~~~lp~~  331 (480)
T 2vch_A          255 ESECLKWLDNQPLGSVLYVSFGSGGT---LTCEQLNELALGLADSEQRFLWVIRSPSGIANSSYFDSHSQTDPLTFLPPG  331 (480)
T ss_dssp             -CHHHHHHHTSCTTCEEEEECTTTCC---CCHHHHHHHHHHHHHTTCEEEEEECCCCSSTTTTTTCC--CSCGGGGSCTT
T ss_pred             hhHHHHHhcCCCCCceEEEecccccC---CCHHHHHHHHHHHHhcCCcEEEEECCccccccccccccccccchhhhcCHH
Confidence            45789999986 47999999999964   5778899999999999999999987532               1 135666


Q ss_pred             E---------EEeccCChhhhhCCCCeeEEEecCChhhHHHHHHhCCcEEecCCCcchhhHHHHH-HHcCceeecCCC--
Q psy16503         66 I---------LLKSWAPQRDILDHPNVKVFISHGGFLGTTEALYSGVPIIGIPMFGDQKANIRVV-EKAGFGVTLPYD--  133 (244)
Q Consensus        66 v---------~~~~~~pq~~lL~h~~~~l~IthgG~~s~~Eal~~gvP~i~vP~~~dQ~~na~~~-~~~G~g~~l~~~--  133 (244)
                      +         .+.+|+||.++|.|+.+++||||||+||+.||+++|||+|++|+++||+.||+++ ++.|+|+.++..  
T Consensus       332 ~~~~~~~~g~~v~~w~Pq~~vL~h~~v~~fvtHgG~~S~~Eal~~GvP~i~~P~~~DQ~~na~~l~~~~G~g~~l~~~~~  411 (480)
T 2vch_A          332 FLERTKKRGFVIPFWAPQAQVLAHPSTGGFLTHCGWNSTLESVVSGIPLIAWPLYAEQKMNAVLLSEDIRAALRPRAGDD  411 (480)
T ss_dssp             HHHHTTTTEEEEESCCCHHHHHHSTTEEEEEECCCHHHHHHHHHHTCCEEECCCSTTHHHHHHHHHHTTCCEECCCCCTT
T ss_pred             HHHHhCCCeEEEeCccCHHHHhCCCCcCeEEecccchhHHHHHHcCCCEEeccccccchHHHHHHHHHhCeEEEeecccC
Confidence            4         4555999999999999999999999999999999999999999999999999997 688999999875  


Q ss_pred             -CCCHHHHHHHHHHHhC---ChhHHHHHHHHHHHHhC---CCCChHHHHHHHHHHHHHcCCCCCCCcc
Q psy16503        134 -QITEETVLVALRTVLG---NPSYKKRAEKVARLFQD---RPMPPLDTAIYWIEHVIRHGGGAHLRPA  194 (244)
Q Consensus       134 -~~~~~~l~~ai~~ll~---~~~y~~~a~~~s~~~~~---~~~~~~~~a~~~ie~~~~~~~~~~l~~~  194 (244)
                       .++.++|.++|+++|.   +++||++|+++++.++.   ...+........++.+.+  +.++++.+
T Consensus       412 ~~~~~~~l~~av~~vl~~~~~~~~r~~a~~l~~~~~~a~~~gGss~~~~~~~v~~~~~--~~~~~~~~  477 (480)
T 2vch_A          412 GLVRREEVARVVKGLMEGEEGKGVRNKMKELKEAACRVLKDDGTSTKALSLVALKWKA--HKKELEQN  477 (480)
T ss_dssp             SCCCHHHHHHHHHHHHTSTHHHHHHHHHHHHHHHHHHHTSTTSHHHHHHHHHHHHHHH--HHHHHHC-
T ss_pred             CccCHHHHHHHHHHHhcCcchHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHH--hHHHhhhc
Confidence             7899999999999998   78899999999998876   333334445556666543  44555443



>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} SCOP: c.87.1.0 PDB: 3hbj_A* Back     alignment and structure
>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Back     alignment and structure
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A* Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Back     alignment and structure
>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>2jzc_A UDP-N-acetylglucosamine transferase subunit ALG13; rossmann-like fold, endoplasmic reticulum, glycosyltransferase, structural genomics; NMR {Saccharomyces cerevisiae} PDB: 2ks6_A Back     alignment and structure
>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* Back     alignment and structure
>3hbm_A UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter jejuni subsp} PDB: 3hbn_A* Back     alignment and structure
>2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8 Back     alignment and structure
>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3 Back     alignment and structure
>1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A* Back     alignment and structure
>3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes} Back     alignment and structure
>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* Back     alignment and structure
>3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, in diseases, isomerase, center for structural genomics of INFE diseases, csgid; 2.35A {Vibrio cholerae} Back     alignment and structure
>4hwg_A UDP-N-acetylglucosamine 2-epimerase; ssgcid, structural genomics, seattle structural genomics center for infectious disease, isomerase; 2.00A {Rickettsia bellii} Back     alignment and structure
>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* Back     alignment and structure
>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A Back     alignment and structure
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Back     alignment and structure
>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Back     alignment and structure
>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Back     alignment and structure
>2bfw_A GLGA glycogen synthase; glycosyltransferase family 5 UDP/ADP-glucose-glycogen syntha rossman folds, transferase; 1.8A {Pyrococcus abyssi} SCOP: c.87.1.8 Back     alignment and structure
>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* Back     alignment and structure
>3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A* Back     alignment and structure
>3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori} Back     alignment and structure
>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* Back     alignment and structure
>2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A* Back     alignment and structure
>3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A Back     alignment and structure
>2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A Back     alignment and structure
>1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A Back     alignment and structure
>3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A* Back     alignment and structure
>3rhz_A GTF3, nucleotide sugar synthetase-like protein; glycosyltransferase, transferase; HET: UDP; 1.90A {Streptococcus parasanguinis} PDB: 3qkw_A* Back     alignment and structure
>2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A* Back     alignment and structure
>2hy7_A Glucuronosyltransferase GUMK; glycosyltransferases, xanthan, membrane-associated proteins; 1.90A {Xanthomonas campestris} PDB: 2q6v_A* 3cv3_A* 3cuy_A* Back     alignment and structure
>2gt1_A Lipopolysaccharide heptosyltransferase-1; GT-B fold; 1.90A {Escherichia coli UTI89} PDB: 2h1f_A* 2h1h_A* Back     alignment and structure
>2iz6_A Molybdenum cofactor carrier protein; metal transport; 1.60A {Chlamydomonas reinhardtii} PDB: 2iz5_A 2iz7_A Back     alignment and structure
>1psw_A ADP-heptose LPS heptosyltransferase II; structural genomics, NYSGXRC, LPS biosynthetic pathway, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.87.1.7 Back     alignment and structure
>3vue_A GBSS-I, granule-bound starch synthase 1, chloroplastic/amyloplastic; rossmann fold, glycosyltransferase, transferase; 2.70A {Oryza sativa japonica group} PDB: 3vuf_A* Back     alignment and structure
>3tov_A Glycosyl transferase family 9; structural genomics, PSI-BIOL protein structure initiative, midwest center for structural genomics, MCSG; 2.98A {Veillonella parvula} Back     alignment and structure
>1rcu_A Conserved hypothetical protein VT76; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.50A {Thermotoga maritima} SCOP: c.129.1.1 Back     alignment and structure
>1ydh_A AT5G11950; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG; 2.15A {Arabidopsis thaliana} SCOP: c.129.1.1 PDB: 2q4d_A Back     alignment and structure
>3nb0_A Glycogen [starch] synthase isoform 2; glycogen synthase, glucose-6-phosphate, yeast, allosteric AC transferase; HET: G6P; 2.41A {Saccharomyces cerevisiae} PDB: 3rt1_A* 3nch_A 3naz_A 3o3c_A* 3rsz_A* Back     alignment and structure
>3qua_A Putative uncharacterized protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium smegmatis str} Back     alignment and structure
>3sbx_A Putative uncharacterized protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: AMP; 2.50A {Mycobacterium marinum M} Back     alignment and structure
>1t35_A Hypothetical protein YVDD, putative lysine decarboxylase; structural genomics target, NYSGXRC, PSI, protein structure initiative; 2.72A {Bacillus subtilis} SCOP: c.129.1.1 Back     alignment and structure
>3l7i_A Teichoic acid biosynthesis protein F; GT-B fold, monotopic membrane protein, structural protein; 2.70A {Staphylococcus epidermidis} PDB: 3l7j_A 3l7k_A* 3l7l_A* 3l7m_A* Back     alignment and structure
>2i2c_A Probable inorganic polyphosphate/ATP-NAD kinase 1; NADP bound of lmnadk1, transferase; HET: DTA PG4; 1.85A {Listeria monocytogenes egd-e} PDB: 2i1w_A* 2i2a_A* 2i2b_A* 2i29_A* 2i2d_A* 2i2e_A* 3v7u_A* 3v7w_A* 3v7y_A* 3v80_A* 3v8m_A* 3v8n_A* 3v8p_A* 4dy6_A* 2i2f_A* 2q5f_A* 3v8q_A* 3v8r_A* Back     alignment and structure
>1uqt_A Alpha, alpha-trehalose-phosphate synthase; glycosyltransferase, transferase; HET: U2F; 2.0A {Escherichia coli} SCOP: c.87.1.6 PDB: 1uqu_A* 2wtx_A* 1gz5_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 244
d2c1xa1450 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-gluc 2e-35
d1rrva_401 c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Am 3e-27
d1iira_401 c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycol 1e-26
d2pq6a1473 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransfe 9e-26
d2acva1461 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transf 2e-23
d2vcha1471 c.87.1.10 (A:6-476) Hydroquinone glucosyltransfera 6e-22
d1pn3a_391 c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA 2e-21
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Length = 450 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: UDPGT-like
domain: UDP glucose:flavonoid 3-o-glucosyltransferase
species: Grape (Vitis vinifera) [TaxId: 29760]
 Score =  128 bits (322), Expect = 2e-35
 Identities = 44/183 (24%), Positives = 73/183 (39%), Gaps = 18/183 (9%)

Query: 18  IYFSMGSIIQGKSFPSDKRKAFLRAFEQIPQRVIWKWEG--------ENMSGKIDKILLK 69
           +Y S G++    + P  +  A   A E      IW              +       ++ 
Sbjct: 268 VYISFGTVT---TPPPAEVVALSEALEASRVPFIWSLRDKARVHLPEGFLEKTRGYGMVV 324

Query: 70  SWAPQRDILDHPNVKVFISHGGFLGTTEALYSGVPIIGIPMFGDQKANI-RVVEKAGFGV 128
            WAPQ ++L H  V  F++H G+    E++  GVP+I  P FGDQ+ N   V +    GV
Sbjct: 325 PWAPQAEVLAHEAVGAFVTHCGWNSLWESVAGGVPLICRPFFGDQRLNGRMVEDVLEIGV 384

Query: 129 TLPYDQITEETVLVALRTVLGNPSYKKRAEKVARL--FQDRPMPP----LDTAIYWIEHV 182
            +     T+  ++     +L     KK  E +  L    DR + P     +  I  ++ V
Sbjct: 385 RIEGGVFTKSGLMSCFDQILSQEKGKKLRENLRALRETADRAVGPKGSSTENFITLVDLV 444

Query: 183 IRH 185
            + 
Sbjct: 445 SKP 447


>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Length = 473 Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Length = 461 Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 471 Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Length = 391 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query244
d2c1xa1450 UDP glucose:flavonoid 3-o-glucosyltransferase {Gra 100.0
d2pq6a1473 (Iso)flavonoid glycosyltransferase {Medicago trunc 100.0
d2vcha1471 Hydroquinone glucosyltransferase {Thale cress (Ara 99.97
d1rrva_401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 99.97
d2acva1461 Triterpene UDP-glucosyl transferase UGT71G1 {Medic 99.97
d1iira_401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 99.97
d1pn3a_391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 99.95
d1f0ka_351 Peptidoglycan biosynthesis glycosyltransferase Mur 99.83
d2iw1a1370 Lipopolysaccharide core biosynthesis protein RfaG 98.63
d2f9fa1166 First mannosyl transferase WbaZ {Archaeoglobus ful 98.39
d2bisa1437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 97.83
d1v4va_373 UDP-N-acetylglucosamine 2-epimerase {Thermus therm 97.56
d2bfwa1196 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 97.54
d1o6ca_377 UDP-N-acetylglucosamine 2-epimerase {Bacillus subt 97.31
d1rzua_477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 96.87
d1f6da_376 UDP-N-acetylglucosamine 2-epimerase {Escherichia c 95.97
d2q4oa1183 Hypothetical protein At2g37210/T2N18.3 {Thale cres 88.6
d1rcua_170 Hypothetical protein TM1055 {Thermotoga maritima [ 88.55
d1qkka_140 Transcriptional regulatory protein DctD, receiver 86.96
d1pswa_348 ADP-heptose LPS heptosyltransferase II {Escherichi 85.27
d1uqta_456 Trehalose-6-phosphate synthase, OtsA {Escherichia 85.27
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 85.2
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 82.89
d1t35a_179 Hypothetical protein YvdD {Bacillus subtilis [TaxI 81.88
d1yioa2128 Response regulatory protein StyR, N-terminal domai 80.46
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: UDPGT-like
domain: UDP glucose:flavonoid 3-o-glucosyltransferase
species: Grape (Vitis vinifera) [TaxId: 29760]
Probab=100.00  E-value=5.7e-37  Score=272.39  Aligned_cols=181  Identities=25%  Similarity=0.433  Sum_probs=154.8

Q ss_pred             chHHHHHHhcCC-CceEEEEcCCCCCCCCCCHHHHHHHHHHHhcCCCeEEEEecCC---CCC-----CCCCCEEEeccCC
Q psy16503          3 ETDIKKFLDESV-NGVIYFSMGSIIQGKSFPSDKRKAFLRAFEQIPQRVIWKWEGE---NMS-----GKIDKILLKSWAP   73 (244)
Q Consensus         3 p~~l~~~l~~~~-~~vI~vs~Gs~~~~~~~~~~~~~~i~~al~~~~~~viw~~~~~---~~~-----~~~~nv~~~~~~p   73 (244)
                      ++++..|+...+ +++||+++||...   .+.+.+..++.+++..+++|+|++...   .++     ..+.|+.+.+|+|
T Consensus       252 ~~~~~~~~~~~~~~~~v~~s~gs~~~---~~~~~~~~~~~~~~~~~~~vl~~~~~~~~~~l~~~~~~~~~~nv~~~~~~p  328 (450)
T d2c1xa1         252 TTGCLQWLKERKPTSVVYISFGTVTT---PPPAEVVALSEALEASRVPFIWSLRDKARVHLPEGFLEKTRGYGMVVPWAP  328 (450)
T ss_dssp             --CHHHHHHTSCTTCEEEEECCSSCC---CCHHHHHHHHHHHHHHTCCEEEECCGGGGGGSCTTHHHHHTTTEEEESCCC
T ss_pred             hhhhccccccCCccceeeeccccccc---CCHHHHHHHHHHHHhcCCeEEEEECCCccccCChhhhhhccccccccccCC
Confidence            345778888764 7899999999965   678899999999999999999998752   222     2467999999999


Q ss_pred             hhhhhCCCCeeEEEecCChhhHHHHHHhCCcEEecCCCcchhhHHHHHHH-cCceeecCCCCCCHHHHHHHHHHHhCChh
Q psy16503         74 QRDILDHPNVKVFISHGGFLGTTEALYSGVPIIGIPMFGDQKANIRVVEK-AGFGVTLPYDQITEETVLVALRTVLGNPS  152 (244)
Q Consensus        74 q~~lL~h~~~~l~IthgG~~s~~Eal~~gvP~i~vP~~~dQ~~na~~~~~-~G~g~~l~~~~~~~~~l~~ai~~ll~~~~  152 (244)
                      |.++|.||++++||||||.||++||+++|||+|++|+++||+.||+++++ .|+|+.++.+++|.++|.++|+++|+|++
T Consensus       329 q~~lL~hp~~~~fItHGG~~s~~eal~~GvP~v~~P~~~DQ~~na~rv~~~~G~G~~l~~~~~t~~~l~~ai~~vL~d~~  408 (450)
T d2c1xa1         329 QAEVLAHEAVGAFVTHCGWNSLWESVAGGVPLICRPFFGDQRLNGRMVEDVLEIGVRIEGGVFTKSGLMSCFDQILSQEK  408 (450)
T ss_dssp             HHHHHTSTTEEEEEECCCHHHHHHHHHHTCCEEECCCSTTHHHHHHHHHHTSCCEEECGGGSCCHHHHHHHHHHHHHSHH
T ss_pred             hHhhhccCceeEEEccCCccHHHHHHHcCCCEEecccccchHHHHHHHHHHcCcEEEecCCCcCHHHHHHHHHHHhcCcH
Confidence            99999999999999999999999999999999999999999999999986 59999999999999999999999999998


Q ss_pred             HHH---HHHHHHHHHhCCCC----ChHHHHHHHHHHHHHcCC
Q psy16503        153 YKK---RAEKVARLFQDRPM----PPLDTAIYWIEHVIRHGG  187 (244)
Q Consensus       153 y~~---~a~~~s~~~~~~~~----~~~~~a~~~ie~~~~~~~  187 (244)
                      |++   +++++++..+ +|.    ++.+.+++|+||+.||+.
T Consensus       409 y~~~~~r~~~l~~~~~-~a~~~~gss~~~~~~~~e~v~r~~~  449 (450)
T d2c1xa1         409 GKKLRENLRALRETAD-RAVGPKGSSTENFITLVDLVSKPKD  449 (450)
T ss_dssp             HHHHHHHHHHHHHHHH-HHTSTTCHHHHHHHHHHHHHTSCCC
T ss_pred             HHHHHHHHHHHHHHHH-HhccCCCCHHHHHHHHHHHHhhhcC
Confidence            875   5555544432 333    348999999999999974



>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9fa1 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1f6da_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q4oa1 c.129.1.1 (A:8-190) Hypothetical protein At2g37210/T2N18.3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rcua_ c.129.1.1 (A:) Hypothetical protein TM1055 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1pswa_ c.87.1.7 (A:) ADP-heptose LPS heptosyltransferase II {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uqta_ c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1t35a_ c.129.1.1 (A:) Hypothetical protein YvdD {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure