Psyllid ID: psy16512


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-----
MQCLSGDLGWVVRGSMVGEFQDAAFKLPISTVNNPVYTEPPIKTKFGYHIIMVEGKNHLKDICYLDYTGAGVYSQSQMNQTIEQLKENIFSHPHGNSVLSDFCVSEIDQMRTKILQYFNTDSDHYSVIFTSGATSAIKTVSEYFEFNEGSFIYLTDNHTSVLGMRELVKTNQIYSFSVDDARNMLNEFKESQENVENMRHSNSLFVYPAESNFSGTKYPLSWCNTVHRNHVFKKHFKCSRSNCFVLLDAATYCGSNMLDLKQHQPDFISISFYKMFGYPTGLGALIVKQKSAHVLNKTFYGGGTVKISMANENFHIKKDGLFEKFEDGTVNYLAIISLKYGFDTMEKKRKSFTNAFELSQYTYFYFKQLSYSNGQPLVELYHDTDYGESKYQGNIVNFNLLHKDGTYYGYSEVQNLANLKKIQLRTGCHCNPGSCQRFLGLSDITIKFHFQQGHICGDDKDIIDGKPTGSIRISYGHASNWDDVKYFLSFLNQYFLQQADFVSIGDICLINNQRAESSKGFFLNHSDNINKENKLVSIYIYPVKACGFFKVESKWEVTASGLKFDRQWMIITHSGVPLTQKLEKNLCLVQPNFDITRNIMTLCYKSSGSTVEIGIDNEGLDLCTSKVCSDKITGFDCGNAVANWLDEQLNRKGLRLIRISKRSSKRNINSFSNMGQYLLITLPSIQAQLENLNAIFELENFVNRFRSNFVVSGQFEANAENDWDQVLIETNDGLLSFQVTSQCTRCQYIYIDQETALNTDVPLGEYQTRNFSTVSLNVKEFFNNLEKTYNQYNFCSSMILDETGIPTVLCPHQKL
ccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccEEccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHccccccccEEEEcccccccHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHHcccccccEEEEEcccccccccccHHHHHHHHHcccccccccccccccEEEEEccccccccccccccccccEEEEccccccccccEEEEEEEEHHHHccccccccccccEEEEEccccEEEcccccccccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccccccccEEEEcccccccccccccEEEEEEEcccccccccHHHHHHHHHHcccEEEccccccHHHHHHHHcccHHHHHHHHHccccccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEEEEEEccccccccccccEEcccccccccccEEEEEcccccccccccccccEEEcEEEccccEEEEEEcccccEEEEccccccccccccEEEcccccEEEccHHHHHHHHHcccccccEEEEccccccccccccccccccEEEEEHHHHHHHHHHHHHHcccccHHccccccEEEcccccccccccccEEEEEcccccEEEEEcccccccccEEEccccccccccHHHHHHHHccccccccEEEEEcccccccccccccccEEEEcccccEEEcccccc
cccccccccEEEEccccccccccEEEcccccccccccccccccccHcccccHHHHccccccEEEEccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHcccEEEEEccHHccccccccHHHHHHccccccEEEEEEcEcccccccccHHHHHHHHHcccccccccccccccEEEEEcHHccccccccHHcccccEEEEEHHHHccccccHHHEEEcHHHHHHcccccccccEEEEEEcccccccccccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccccccccccEEEEEEEccccccEEcHHHHHHHHHHcccEEEccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccccEEEEEEEEEcccHHHHHHHHHHHHHHccccccccccccccccccHccccccccccccccccccccEEEEEEEEEEcccccEEccccccccccccccccEEEEEccccEEEcccccccEEEEEEEEEccccEEEEEcccccccEEEEccccccccccccEccccEEEEcccHHHHHHHHHHHcccccEEEEEcccccccccccccccccEEEEcHHHHHHHHHHHHHHcccccHHHHHcccEEEccccccccHccccEEEEccccccEEEEEEccccccEEEEEccccccccccHHHHHHHHccccEEEEEEEEEcccccccccEEEcccEEEccccccEEEcccccc
mqclsgdlgwvvrgsmvgefqdaafklpistvnnpvyteppiktkfgYHIIMVEGKNhlkdicyldytgagvysqSQMNQTIEQLKENifshphgnsvlsdfCVSEIDQMRTKILQYfntdsdhysvIFTSGATSAIKTVSEYFEfnegsfiyltdnhtsvlGMRELVKTNQIYSFSVDDARNMLNEFKESQENVenmrhsnslfvypaesnfsgtkyplswcntvhrnhvfkkhfkcsrsnCFVLLDAATYcgsnmldlkqhqpdfisISFYkmfgyptglGALIVKQKSAHVLNKTFYGGGTVKISMANenfhikkdglfekfedgtvNYLAIISLKYGFDTMEKKRKSFTNAFELSQYTYFYFKqlsysngqplvelyhdtdygeskyqgnivnfnllhkdgtyygysEVQNLANLKKiqlrtgchcnpgscqrflglsdiTIKFHfqqghicgddkdiidgkptgsirisyghasnwdDVKYFLSFLNQYFLQQADFVSIgdiclinnqraesskgfflnhsdninkenKLVSIYIYpvkacgffkvesKWEVTasglkfdrqwmiithsgvpltqKLEKnlclvqpnfdITRNIMTLcykssgstveigidnegldlctskvcsdkitgfdcGNAVANWLDEQLNRKGLRLIRISKRSSKRNINSFSNMGQYLLITLPSIQAQLENLNAIFELENFVNRFRSNFVvsgqfeanaendwDQVLIETNDgllsfqvtsqctrcqyiyidqetalntdvplgeyqtrnfsTVSLNVKEFFNNLEKTYNqynfcssmildetgiptvlcphqkl
MQCLSGDLGWVVRGSMVGEFQDAAFklpistvnnpvytEPPIKTKFGYHIIMVEGKNHLKDICYLDYTGAGVYSQSQMNQTIEQLKENIFSHPHGNSVLSDFCVSEIDQMRTKILQYFNTDSDHYSVIFTSGATSAIKTVSEYFEFNEGSFIYLTDNHTSVLGMRELVKTNQIYSFSVDDARNMLNEFKESQENVENMRHSNSLFVYPAESNFSGTKYPLSWCNTVHRNHVFKKHFKCSRSNCFVLLDAATYCGSNMLDLKQHQPDFISISFYKMFGYPTGLGALIVKQKSAHVLNKTFYGGGTVKISMANENFHIKKDGLFEKFEDGTVNYLAIISLKYGFDTMEKKRKSFTNAFELSQYTYFYFKQLSYSNGQPLVELYHDTDYGESKYQGNIVNFNLLHKDGTYYGYSEVQNLANLKKIQLRTGCHCNPGSCQRFLGLSDITIKFHFQQGHICGDDKDIIDGKPTGSIRISYGHASNWDDVKYFLSFLNQYFLQQADFVSIGDICLINNQRAESSKGFFLNHSDNINKENKLVSIYIYPVKACGFFKVESKWEVTASGLKFDRQWMIITHSGVPLTQKLEKNLCLVQPNFDITRNIMTLCYKSSGSTVEIGIDNEGLDLCTSKVCSDKITGFDCGNAVANWLDEQLNRKGLrliriskrsskrninsFSNMGQYLLITLPSIQAQLENLNAIFELENFVNRFRSNFVVSGQFEANAENDWDQVLIETNDGLLSFQVTSQCTRCQYIYIDQETALNTDVPLGEYQTRNFSTVSLNVKEFFNNLEKTYNQYNFCSSMILDETGIPTVLCPHQKL
MQCLSGDLGWVVRGSMVGEFQDAAFKLPISTVNNPVYTEPPIKTKFGYHIIMVEGKNHLKDICYLDYTGAGVYSQSQMNQTIEQLKENIFSHPHGNSVLSDFCVSEIDQMRTKILQYFNTDSDHYSVIFTSGATSAIKTVSEYFEFNEGSFIYLTDNHTSVLGMRELVKTNQIYSFSVDDARNMLNEFKESQENVENMRHSNSLFVYPAESNFSGTKYPLSWCNTVHRNHVFKKHFKCSRSNCFVLLDAATYCGSNMLDLKQHQPDFISISFYKMFGYPTGLGALIVKQKSAHVLNKTFYGGGTVKISMANENFHIKKDGLFEKFEDGTVNYLAIISLKYGFDTMEKKRKSFTNAFELSQYTYFYFKQLSYSNGQPLVELYHDTDYGESKYQGNIVNFNLLHKDGTYYGYSEVQNLANLKKIQLRTGCHCNPGSCQRFLGLSDITIKFHFQQGHICgddkdiidgkPTGSIRISYGHASNWDDVKYFLSFLNQYFLQQADFVSIGDICLINNQRAESSKGFFLNHSDNINKENKLVSIYIYPVKACGFFKVESKWEVTASGLKFDRQWMIITHSGVPLTQKLEKNLCLVQPNFDITRNIMTLCYKSSGSTVEIGIDNEGLDLCTSKVCSDKITGFDCGNAVANWLDEQLNRKGlrliriskrsskrninsFSNMGQYLLITLPSIQAQLENLNAIFELENFVNRFRSNFVVSGQFEANAENDWDQVLIETNDGLLSFQVTSQCTRCQYIYIDQETALNTDVPLGEYQTRNFSTVSLNVKEFFNNLEKTYNQYNFCSSMILDETGIPTVLCPHQKL
***LSGDLGWVVRGSMVGEFQDAAFKLPISTVNNPVYTEPPIKTKFGYHIIMVEGKNHLKDICYLDYTGAGVYSQSQMNQTIEQLKENIFSHPHGNSVLSDFCVSEIDQMRTKILQYFNTDSDHYSVIFTSGATSAIKTVSEYFEFNEGSFIYLTDNHTSVLGMRELVKTNQIYSFSVDDAR********************SLFVYPAESNFSGTKYPLSWCNTVHRNHVFKKHFKCSRSNCFVLLDAATYCGSNMLDLKQHQPDFISISFYKMFGYPTGLGALIVKQKSAHVLNKTFYGGGTVKISMANENFHIKKDGLFEKFEDGTVNYLAIISLKYGFDTMEKKRKSFTNAFELSQYTYFYFKQLSYSNGQPLVELYHDTDYGESKYQGNIVNFNLLHKDGTYYGYSEVQNLANLKKIQLRTGCHCNPGSCQRFLGLSDITIKFHFQQGHICGDDKDIIDGKPTGSIRISYGHASNWDDVKYFLSFLNQYFLQQADFVSIGDICLINNQRAESSKGFFLNHSDNINKENKLVSIYIYPVKACGFFKVESKWEVTASGLKFDRQWMIITHSGVPLTQKLEKNLCLVQPNFDITRNIMTLCYKSSGSTVEIGIDNEGLDLCTSKVCSDKITGFDCGNAVANWLDEQLNRKGLRLIRISK****RNINSFSNMGQYLLITLPSIQAQLENLNAIFELENFVNRFRSNFVVSGQFEANAENDWDQVLIETNDGLLSFQVTSQCTRCQYIYIDQETALNTDVPLGEYQTRNFSTVSLNVKEFFNNLEKTYNQYNFCSSMILDETGIPTVLC*****
****S*DLGWVVRGSMVGEF****************YTEPPIKTKFGYHIIMVEGKNHLKDICYLDYTGAGVYSQSQMNQTIEQLKENIFSHPHGNSVLSDFCVSEIDQMRTKILQYFNTDSDHYSVIFTSGATSAIKTVSEYFEFNEGSFIYLTDNHTSVLGMRELVKTNQIYSFSVDDARNMLNEFKESQ*****MRHSNSLFVYPAESNFSGTKYPLSWCNTVHRNHVFKKHFKCSRSNCFVLLDAATYCGSNMLDLKQHQPDFISISFYKMFGYPTGLGALIVKQKSAHVLNKTFYGGGTVKISMANENFHIKKDGLFEKFEDGTVNYLAIISLKYGFDTMEKKRKSFTNAFELSQYTYFYFKQLSYSNGQPLVELYHDTDY***KYQGNIVNFNLLHKDGTYYGYSEVQNLANLKKIQLRTGCHCNPGSCQRFLGLSDITIKFHFQQGHICGDDKDIIDGKPTGSIRISYGHASNWDDVKYFLSFLNQYFLQQADFV******************************NKLVSIYIYPVKACGFFKVESKWEVTASGLKFDRQWMIITHSGVPLTQKLEKNLCLVQPNFDITRNIMTLC**************************DKITGFDCGNAVANWLDEQLNRKGLR*********************YLLITLPSIQAQ***********NFVNRFRSNFVVSGQFEANAENDWDQVLIETNDGLLSFQVTSQCTRCQYIYIDQETALNTDVPLGEYQTRNFSTVSLNVKEFFNNLEKT**************TGIPTVLCPH***
MQCLSGDLGWVVRGSMVGEFQDAAFKLPISTVNNPVYTEPPIKTKFGYHIIMVEGKNHLKDICYLDYTGAGVYSQSQMNQTIEQLKENIFSHPHGNSVLSDFCVSEIDQMRTKILQYFNTDSDHYSVIFTSGATSAIKTVSEYFEFNEGSFIYLTDNHTSVLGMRELVKTNQIYSFSVDDARNMLNEFKESQENVENMRHSNSLFVYPAESNFSGTKYPLSWCNTVHRNHVFKKHFKCSRSNCFVLLDAATYCGSNMLDLKQHQPDFISISFYKMFGYPTGLGALIVKQKSAHVLNKTFYGGGTVKISMANENFHIKKDGLFEKFEDGTVNYLAIISLKYGFDTMEKKRKSFTNAFELSQYTYFYFKQLSYSNGQPLVELYHDTDYGESKYQGNIVNFNLLHKDGTYYGYSEVQNLANLKKIQLRTGCHCNPGSCQRFLGLSDITIKFHFQQGHICGDDKDIIDGKPTGSIRISYGHASNWDDVKYFLSFLNQYFLQQADFVSIGDICLINNQRAESSKGFFLNHSDNINKENKLVSIYIYPVKACGFFKVESKWEVTASGLKFDRQWMIITHSGVPLTQKLEKNLCLVQPNFDITRNIMTLCYKSSGSTVEIGIDNEGLDLCTSKVCSDKITGFDCGNAVANWLDEQLNRKGLRLIRISKRSSKRNINSFSNMGQYLLITLPSIQAQLENLNAIFELENFVNRFRSNFVVSGQFEANAENDWDQVLIETNDGLLSFQVTSQCTRCQYIYIDQETALNTDVPLGEYQTRNFSTVSLNVKEFFNNLEKTYNQYNFCSSMILDETGIPTVLCPHQKL
**CLSGDLGWVVRGSMVGEFQDAAFKLPISTVNNPVYTEPPIKTKFGYHIIMVEGKNHLKDICYLDYTGAGVYSQSQMNQTIEQLKENIFSHPHGNSVLSDFCVSEIDQMRTKILQYFNTDSDHYSVIFTSGATSAIKTVSEYFEFNEGSFIYLTDNHTSVLGMRELVKTNQIYSFSVDDARNMLNEFKESQENVENMRHSNSLFVYPAESNFSGTKYPLSWCNTVHRNHVFKKHFKCSRSNCFVLLDAATYCGSNMLDLKQHQPDFISISFYKMFGYPTGLGALIVKQKSAHVLNKTFYGGGTVKISMANENFHIKKDGLFEKFEDGTVNYLAIISLKYGFDTMEKKRKSFTNAFELSQYTYFYFKQLSYSNGQPLVELYHDTDYGESKYQGNIVNFNLLHKDGTYYGYSEVQNLANLKKIQLRTGCHCNPGSCQRFLGLSDITIKFHFQQGHICGDDKDIIDGKPTGSIRISYGHASNWDDVKYFLSFLNQYFLQQ******************************INKENKLVSIYIYPVKACGFFKVESKWEVTASGLKFDRQWMIITHSGVPLTQKLEKNLCLVQPNFDITRNIMTLCYKSSGSTVEIGIDNEGLDLCTSKVCSDKITGFDCGNAVANWLDEQLNRKGLRLIRISKRSSKRNINSFSNMGQYLLITLPSIQAQLENLNAIFELENFVNRFRSNFVVSGQFEANAENDWDQVLIETNDGLLSFQVTSQCTRCQYIYIDQETALNTDVPLGEYQTRNFSTVSLNVKEFFNNLEKTYNQYNFCSSMILDETGIPTVLCPH***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQCLSGDLGWVVRGSMVGEFQDAAFKLPISTVNNPVYTEPPIKTKFGYHIIMVEGKNHLKDICYLDYTGAGVYSQSQMNQTIEQLKENIFSHPHGNSVLSDFCVSEIDQMRTKILQYFNTDSDHYSVIFTSGATSAIKTVSEYFEFNEGSFIYLTDNHTSVLGMRELVKTNQIYSFSxxxxxxxxxxxxxxxxxxxxxxxxNSLFVYPAESNFSGTKYPLSWCNTVHRNHVFKKHFKCSRSNCFVLLDAATYCGSNMLDLKQHQPDFISISFYKMFGYPTGLGALIVKQKSAHVLNKTFYGGGTVKISMANENFHIKKDGLFEKFEDGTVNYLAIISLKYGFDTMEKKRKSFTNAFELSQYTYFYFKQLSYSNGQPLVELYHDTDYGESKYQGNIVNFNLLHKDGTYYGYSEVQNLANLKKIQLRTGCHCNPGSCQRFLGLSDITIKFHFQQGHICGDDKDIIDGKPTGSIRISYGHASNWDDVKYFLSFLNQYFLQQADFVSIGDICLINNQRAESSKGFFLNHSDNINKENKLVSIYIYPVKACGFFKVESKWEVTASGLKFDRQWMIITHSGVPLTQKLEKNLCLVQPNFDITRNIMTLCYKSSGSTVEIGIDNEGLDLCTSKVCSDKITGFDCGNAVANWLDEQLNRKGLRLIRISKRSSKRNINSFSNMGQYLLITLPSIQAQLENLNAIFELENFVNRFRSNFVVSGQFEANAENDWDQVLIETNDGLLSFQVTSQCTRCQYIYIDQETALNTDVPLGEYQTRNFSTVSLNVKEFFNNLEKTYNQYNFCSSMILDETGIPTVLCPHQKL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query815 2.2.26 [Sep-21-2011]
Q16P90764 Molybdenum cofactor sulfu N/A N/A 0.862 0.920 0.390 1e-156
Q16GH0764 Molybdenum cofactor sulfu N/A N/A 0.862 0.920 0.382 1e-154
Q14CH1862 Molybdenum cofactor sulfu yes N/A 0.847 0.801 0.374 1e-146
B0WSX1760 Molybdenum cofactor sulfu N/A N/A 0.822 0.881 0.372 1e-146
Q96EN8888 Molybdenum cofactor sulfu yes N/A 0.841 0.772 0.366 1e-143
Q8IU29822 Molybdenum cofactor sulfu N/A N/A 0.851 0.844 0.381 1e-139
Q7QFL7770 Molybdenum cofactor sulfu yes N/A 0.826 0.875 0.361 1e-137
A2VD33831 Molybdenum cofactor sulfu yes N/A 0.849 0.832 0.373 1e-134
B4L340779 Molybdenum cofactor sulfu N/A N/A 0.833 0.871 0.356 1e-128
B4M3C9780 Molybdenum cofactor sulfu N/A N/A 0.835 0.873 0.360 1e-125
>sp|Q16P90|MOCO3_AEDAE Molybdenum cofactor sulfurase 3 OS=Aedes aegypti GN=mal3 PE=3 SV=1 Back     alignment and function desciption
 Score =  551 bits (1420), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 303/776 (39%), Positives = 457/776 (58%), Gaps = 73/776 (9%)

Query: 57  NHLKDICYLDYTGAGVYSQSQMNQTIEQLKENIFSHPHGNSVLSDFCVSEIDQMRTKILQ 116
           + LK+ CYLD+ G  +Y+ SQ+    E L +N++ +PH +    D     +DQ+R ++L+
Sbjct: 24  SRLKEKCYLDHAGTTLYADSQIRSVCEGLAQNLYCNPHTSRTTEDL----LDQVRYRVLR 79

Query: 117 YFNTDSDHYSVIFTSGATSAIKTVSEYFEFN-EGSFIYLTDNHTSVLGMRELVKTNQIYS 175
           +FNT S  YS+IFTSG T+++K ++E +EF  EG+F+YL D+HTSVLGMRE+V T +IY 
Sbjct: 80  HFNTRSSEYSLIFTSGTTASLKLLAESYEFAPEGAFVYLKDSHTSVLGMREIVGTERIYP 139

Query: 176 FSVDDARNMLNEFKESQENVENMRHSNSLFVYPAESNFSGTKYPLSWCNTVHRNHVF--- 232
               +   +L E   S+ +  +  HS SL V+PA+ NF+G KYPL     + RN +    
Sbjct: 140 V---EREQLLKELDSSERS--DSEHS-SLIVFPAQCNFNGVKYPLELVRKIQRNGISGYG 193

Query: 233 KKHFKCSRSNCFVLLDAATYCGSNMLDLKQHQPDFISISFYKMFGYPTGLGALIVKQKSA 292
           K+ F+       V LDAA++  ++ LDL ++QPDF+ +SFYK+FGYPTGLGAL+V   +A
Sbjct: 194 KERFR-------VCLDAASFVSTSFLDLSKYQPDFVCLSFYKIFGYPTGLGALLVHHTAA 246

Query: 293 HVLNKTFYGGGTVKISMANENFHIKKDGLFEKFEDGTVNYLAIISLKYGFDTMEKKRKSF 352
             L K +YGGGTVKI+MA  NFH+K+D L E+FEDGT+ + +II+L  GF+T+E+   S 
Sbjct: 247 DQLRKKYYGGGTVKIAMAGRNFHVKRDPLVERFEDGTLAFTSIIALLQGFETLERLVPST 306

Query: 353 T----------NAFELSQYTYFYFKQLSYSNGQPLVELYHDTDYGESKYQGNIVNFNLLH 402
                        F L +Y Y   K L +SNG  +V+LYHDT + +   QG IVNFN+LH
Sbjct: 307 AGLRTIERISQQTFHLGRYCYNRLKALRHSNGNAVVKLYHDTGFEDQGLQGGIVNFNILH 366

Query: 403 KDGTYYGYSEVQNLANLKKIQLRTGCHCNPGSCQRFLGLSDITIKFHFQQGHICGDDKDI 462
           +DGTY G++EV  +A+L  I LRTGC CNPG+CQR L LSD  +   F  GH+CGD  D+
Sbjct: 367 EDGTYVGFAEVSYMASLHNILLRTGCFCNPGACQRHLQLSDEDVLKQFDAGHVCGDANDL 426

Query: 463 IDGKPTGSIRISYGHASNWDDVKYFLSFLNQYFLQQADFVSIGDICLINNQRAESSKGFF 522
           IDG+PTGS+R+S+G+ +  +D+   L  + + ++++   ++ G       Q     K + 
Sbjct: 427 IDGQPTGSVRVSFGYMTRKEDIDCLLEMVEKCYIRKT--IANG---FTRTQIVSKYKSY- 480

Query: 523 LNHSDNINKENKLVSIYIYPVKACGFFKVESKWEVTASGLKFDRQWMIITHSGVPLTQKL 582
                    + +L  I ++P+K+CG FKV ++W ++  GLK DR+++I+  +GV LTQK 
Sbjct: 481 --------DQPRLKMICLFPIKSCGAFKVTTRWPLSRRGLKHDREFVIVDENGVALTQKK 532

Query: 583 EKNLCLVQPNFDITRNIMTLCYKSSGSTVEIGI---DNEGLDLCTSKVCSDKITGFDCGN 639
              +CL++P  ++  N MTL + S    V       +++ + LC +KVC D +   DCG+
Sbjct: 533 LTEMCLIRPQINLKTNEMTLSHPSMDDFVLDLDLLGESQRIKLCQTKVCQDNVQAIDCGD 592

Query: 640 AVANWLDEQLNRKGLRLIRISK------RSSKRNINSFSNMGQYLLITLPSIQ------A 687
            VA W+   L   GLRL++ S       + SK+ I + +N  Q+LLI   S++       
Sbjct: 593 QVAEWISVALQTSGLRLLKQSDEEVRTFQQSKQEI-ALANQAQFLLINQASVRWLADKVP 651

Query: 688 QLENLNAIFELENFVNRFRSNFVVSGQFEANAENDWDQVLIETNDGLLSFQVTSQCTRCQ 747
             + L+    LE+ V+RFR N +V     +  E DW +V I    G L F V   C+RCQ
Sbjct: 652 DWDELHEEPTLESLVDRFRGNLIVETP-TSMEECDWKRVTI----GYLEFAVDGPCSRCQ 706

Query: 748 YIYIDQETALNTDVPL----GEYQTRNFSTVSLNVKEFFNNLEKTYNQYNFCSSMI 799
            I IDQ T + T  PL     E++ +    + L+     N L     Q+ +C+S++
Sbjct: 707 MICIDQGTGVKTTEPLRTIGREFKGKMRFGIYLS---HVNPLRDGSEQWLYCNSVV 759




Sulfurates the molybdenum cofactor. Sulfation of molybdenum is essential for xanthine dehydrogenase (XDH) and aldehyde oxidase (ADO) enzymes in which molybdenum cofactor is liganded by 1 oxygen and 1 sulfur atom in active form.
Aedes aegypti (taxid: 7159)
EC: 2EC: .EC: 8EC: .EC: 1EC: .EC: 9
>sp|Q16GH0|MOCO1_AEDAE Molybdenum cofactor sulfurase 1 OS=Aedes aegypti GN=mal1 PE=3 SV=1 Back     alignment and function description
>sp|Q14CH1|MOCOS_MOUSE Molybdenum cofactor sulfurase OS=Mus musculus GN=Mocos PE=2 SV=1 Back     alignment and function description
>sp|B0WSX1|MOCO2_CULQU Molybdenum cofactor sulfurase 2 OS=Culex quinquefasciatus GN=mal2 PE=3 SV=1 Back     alignment and function description
>sp|Q96EN8|MOCOS_HUMAN Molybdenum cofactor sulfurase OS=Homo sapiens GN=MOCOS PE=1 SV=2 Back     alignment and function description
>sp|Q8IU29|MOCOS_BOMMO Molybdenum cofactor sulfurase OS=Bombyx mori GN=mal PE=2 SV=1 Back     alignment and function description
>sp|Q7QFL7|MOCOS_ANOGA Molybdenum cofactor sulfurase OS=Anopheles gambiae GN=mal PE=3 SV=5 Back     alignment and function description
>sp|A2VD33|MOCOS_DANRE Molybdenum cofactor sulfurase OS=Danio rerio GN=mocos PE=2 SV=2 Back     alignment and function description
>sp|B4L340|MOCOS_DROMO Molybdenum cofactor sulfurase OS=Drosophila mojavensis GN=mal PE=3 SV=1 Back     alignment and function description
>sp|B4M3C9|MOCOS_DROVI Molybdenum cofactor sulfurase OS=Drosophila virilis GN=mal PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query815
157130261764 hypothetical protein AaeL_AAEL011729 [Ae 0.862 0.920 0.390 1e-154
157104924764 hypothetical protein AaeL_AAEL014381 [Ae 0.862 0.920 0.382 1e-152
383855946822 PREDICTED: molybdenum cofactor sulfurase 0.871 0.863 0.402 1e-150
328780894831 PREDICTED: molybdenum cofactor sulfurase 0.852 0.836 0.395 1e-149
380015092834 PREDICTED: molybdenum cofactor sulfurase 0.878 0.858 0.388 1e-149
156554568818 PREDICTED: molybdenum cofactor sulfurase 0.844 0.841 0.398 1e-148
348576551873 PREDICTED: molybdenum cofactor sulfurase 0.853 0.797 0.369 1e-148
350419990825 PREDICTED: molybdenum cofactor sulfurase 0.855 0.844 0.393 1e-147
91077036767 PREDICTED: similar to molybdenum cofacto 0.828 0.880 0.404 1e-147
242014503796 molybdopterin cofactor sulfurase, putati 0.828 0.847 0.398 1e-147
>gi|157130261|ref|XP_001661859.1| hypothetical protein AaeL_AAEL011729 [Aedes aegypti] gi|122105138|sp|Q16P90.1|MOCO3_AEDAE RecName: Full=Molybdenum cofactor sulfurase 3; Short=MOS 3; Short=MoCo sulfurase 3; AltName: Full=Molybdenum cofactor sulfurtransferase 3; AltName: Full=Protein maroon-like 3; Short=Ma-l 3 gi|108871953|gb|EAT36178.1| AAEL011729-PA [Aedes aegypti] Back     alignment and taxonomy information
 Score =  551 bits (1420), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 303/776 (39%), Positives = 457/776 (58%), Gaps = 73/776 (9%)

Query: 57  NHLKDICYLDYTGAGVYSQSQMNQTIEQLKENIFSHPHGNSVLSDFCVSEIDQMRTKILQ 116
           + LK+ CYLD+ G  +Y+ SQ+    E L +N++ +PH +    D     +DQ+R ++L+
Sbjct: 24  SRLKEKCYLDHAGTTLYADSQIRSVCEGLAQNLYCNPHTSRTTEDL----LDQVRYRVLR 79

Query: 117 YFNTDSDHYSVIFTSGATSAIKTVSEYFEFN-EGSFIYLTDNHTSVLGMRELVKTNQIYS 175
           +FNT S  YS+IFTSG T+++K ++E +EF  EG+F+YL D+HTSVLGMRE+V T +IY 
Sbjct: 80  HFNTRSSEYSLIFTSGTTASLKLLAESYEFAPEGAFVYLKDSHTSVLGMREIVGTERIYP 139

Query: 176 FSVDDARNMLNEFKESQENVENMRHSNSLFVYPAESNFSGTKYPLSWCNTVHRNHVF--- 232
               +   +L E   S+ +  +  HS SL V+PA+ NF+G KYPL     + RN +    
Sbjct: 140 V---EREQLLKELDSSERS--DSEHS-SLIVFPAQCNFNGVKYPLELVRKIQRNGISGYG 193

Query: 233 KKHFKCSRSNCFVLLDAATYCGSNMLDLKQHQPDFISISFYKMFGYPTGLGALIVKQKSA 292
           K+ F+       V LDAA++  ++ LDL ++QPDF+ +SFYK+FGYPTGLGAL+V   +A
Sbjct: 194 KERFR-------VCLDAASFVSTSFLDLSKYQPDFVCLSFYKIFGYPTGLGALLVHHTAA 246

Query: 293 HVLNKTFYGGGTVKISMANENFHIKKDGLFEKFEDGTVNYLAIISLKYGFDTMEKKRKSF 352
             L K +YGGGTVKI+MA  NFH+K+D L E+FEDGT+ + +II+L  GF+T+E+   S 
Sbjct: 247 DQLRKKYYGGGTVKIAMAGRNFHVKRDPLVERFEDGTLAFTSIIALLQGFETLERLVPST 306

Query: 353 T----------NAFELSQYTYFYFKQLSYSNGQPLVELYHDTDYGESKYQGNIVNFNLLH 402
                        F L +Y Y   K L +SNG  +V+LYHDT + +   QG IVNFN+LH
Sbjct: 307 AGLRTIERISQQTFHLGRYCYNRLKALRHSNGNAVVKLYHDTGFEDQGLQGGIVNFNILH 366

Query: 403 KDGTYYGYSEVQNLANLKKIQLRTGCHCNPGSCQRFLGLSDITIKFHFQQGHICGDDKDI 462
           +DGTY G++EV  +A+L  I LRTGC CNPG+CQR L LSD  +   F  GH+CGD  D+
Sbjct: 367 EDGTYVGFAEVSYMASLHNILLRTGCFCNPGACQRHLQLSDEDVLKQFDAGHVCGDANDL 426

Query: 463 IDGKPTGSIRISYGHASNWDDVKYFLSFLNQYFLQQADFVSIGDICLINNQRAESSKGFF 522
           IDG+PTGS+R+S+G+ +  +D+   L  + + ++++   ++ G       Q     K + 
Sbjct: 427 IDGQPTGSVRVSFGYMTRKEDIDCLLEMVEKCYIRKT--IANG---FTRTQIVSKYKSY- 480

Query: 523 LNHSDNINKENKLVSIYIYPVKACGFFKVESKWEVTASGLKFDRQWMIITHSGVPLTQKL 582
                    + +L  I ++P+K+CG FKV ++W ++  GLK DR+++I+  +GV LTQK 
Sbjct: 481 --------DQPRLKMICLFPIKSCGAFKVTTRWPLSRRGLKHDREFVIVDENGVALTQKK 532

Query: 583 EKNLCLVQPNFDITRNIMTLCYKSSGSTVEIGI---DNEGLDLCTSKVCSDKITGFDCGN 639
              +CL++P  ++  N MTL + S    V       +++ + LC +KVC D +   DCG+
Sbjct: 533 LTEMCLIRPQINLKTNEMTLSHPSMDDFVLDLDLLGESQRIKLCQTKVCQDNVQAIDCGD 592

Query: 640 AVANWLDEQLNRKGLRLIRISK------RSSKRNINSFSNMGQYLLITLPSIQ------A 687
            VA W+   L   GLRL++ S       + SK+ I + +N  Q+LLI   S++       
Sbjct: 593 QVAEWISVALQTSGLRLLKQSDEEVRTFQQSKQEI-ALANQAQFLLINQASVRWLADKVP 651

Query: 688 QLENLNAIFELENFVNRFRSNFVVSGQFEANAENDWDQVLIETNDGLLSFQVTSQCTRCQ 747
             + L+    LE+ V+RFR N +V     +  E DW +V I    G L F V   C+RCQ
Sbjct: 652 DWDELHEEPTLESLVDRFRGNLIVETP-TSMEECDWKRVTI----GYLEFAVDGPCSRCQ 706

Query: 748 YIYIDQETALNTDVPL----GEYQTRNFSTVSLNVKEFFNNLEKTYNQYNFCSSMI 799
            I IDQ T + T  PL     E++ +    + L+     N L     Q+ +C+S++
Sbjct: 707 MICIDQGTGVKTTEPLRTIGREFKGKMRFGIYLS---HVNPLRDGSEQWLYCNSVV 759




Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157104924|ref|XP_001648634.1| hypothetical protein AaeL_AAEL014381 [Aedes aegypti] gi|122116404|sp|Q16GH0.1|MOCO1_AEDAE RecName: Full=Molybdenum cofactor sulfurase 1; Short=MOS 1; Short=MoCo sulfurase 1; AltName: Full=Molybdenum cofactor sulfurtransferase 1; AltName: Full=Protein maroon-like 1; Short=Ma-l 1 gi|108869104|gb|EAT33329.1| AAEL014381-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|383855946|ref|XP_003703471.1| PREDICTED: molybdenum cofactor sulfurase-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328780894|ref|XP_394734.4| PREDICTED: molybdenum cofactor sulfurase 1-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|380015092|ref|XP_003691545.1| PREDICTED: molybdenum cofactor sulfurase-like [Apis florea] Back     alignment and taxonomy information
>gi|156554568|ref|XP_001605704.1| PREDICTED: molybdenum cofactor sulfurase 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|348576551|ref|XP_003474050.1| PREDICTED: molybdenum cofactor sulfurase-like [Cavia porcellus] Back     alignment and taxonomy information
>gi|350419990|ref|XP_003492363.1| PREDICTED: molybdenum cofactor sulfurase-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|91077036|ref|XP_967646.1| PREDICTED: similar to molybdenum cofactor sulfurase [Tribolium castaneum] gi|270001749|gb|EEZ98196.1| hypothetical protein TcasGA2_TC000626 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242014503|ref|XP_002427929.1| molybdopterin cofactor sulfurase, putative [Pediculus humanus corporis] gi|212512413|gb|EEB15191.1| molybdopterin cofactor sulfurase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query815
UNIPROTKB|Q16P90764 mal3 "Molybdenum cofactor sulf 0.867 0.925 0.374 6.9e-134
MGI|MGI:1915841862 Mocos "molybdenum cofactor sul 0.527 0.498 0.424 1.5e-132
UNIPROTKB|Q16GH0764 mal1 "Molybdenum cofactor sulf 0.874 0.933 0.368 1.2e-131
UNIPROTKB|F1PDQ7879 MOCOS "Uncharacterized protein 0.531 0.492 0.417 7.2e-124
UNIPROTKB|G3N1I0882 MOCOS "Molybdenum cofactor sul 0.538 0.497 0.408 4e-121
UNIPROTKB|Q9N0E7882 MOCOS "Molybdenum cofactor sul 0.538 0.497 0.408 4e-121
UNIPROTKB|F1N3A9849 MOCOS "Molybdenum cofactor sul 0.520 0.499 0.418 5.1e-121
UNIPROTKB|Q96EN8888 MOCOS "Molybdenum cofactor sul 0.525 0.481 0.429 8.4e-121
UNIPROTKB|F1SAI5889 LOC100621611 "Uncharacterized 0.521 0.478 0.412 2.2e-118
UNIPROTKB|B0WSX1760 mal2 "Molybdenum cofactor sulf 0.765 0.821 0.371 6.2e-117
UNIPROTKB|Q16P90 mal3 "Molybdenum cofactor sulfurase 3" [Aedes aegypti (taxid:7159)] Back     alignment and assigned GO terms
 Score = 1312 (466.9 bits), Expect = 6.9e-134, P = 6.9e-134
 Identities = 289/772 (37%), Positives = 438/772 (56%)

Query:    57 NHLKDICYLDYTGAGVYSQSQMNQTIEQLKENIFSHPHGNSVLSDFCVSEIDQMRTKILQ 116
             + LK+ CYLD+ G  +Y+ SQ+    E L +N++ +PH +    D     +DQ+R ++L+
Sbjct:    24 SRLKEKCYLDHAGTTLYADSQIRSVCEGLAQNLYCNPHTSRTTEDL----LDQVRYRVLR 79

Query:   117 YFNTDSDHYSVIFTSGATSAIKTVSEYFEFN-EGSFIYLTDNHTSVLGMRELVKTNQIYS 175
             +FNT S  YS+IFTSG T+++K ++E +EF  EG+F+YL D+HTSVLGMRE+V T +IY 
Sbjct:    80 HFNTRSSEYSLIFTSGTTASLKLLAESYEFAPEGAFVYLKDSHTSVLGMREIVGTERIYP 139

Query:   176 FSVDDARNMLNEFKESQENVENMRHSNSLFVYPAESNFSGTKYPLSWCNTVHRNHVF--- 232
                 +   +L E   S+ +  +  HS SL V+PA+ NF+G KYPL     + RN +    
Sbjct:   140 V---EREQLLKELDSSERS--DSEHS-SLIVFPAQCNFNGVKYPLELVRKIQRNGISGYG 193

Query:   233 KKHFKCSRSNCFVLLDAATYCGSNMLDLKQHQPDFISISFYKMFGYPTGLGALIVKQKSA 292
             K+ F+       V LDAA++  ++ LDL ++QPDF+ +SFYK+FGYPTGLGAL+V   +A
Sbjct:   194 KERFR-------VCLDAASFVSTSFLDLSKYQPDFVCLSFYKIFGYPTGLGALLVHHTAA 246

Query:   293 HVLNKTFYGGGTVKISMANENFHIKKDGLFEKFEDGTVNYLAIISLKYGFDTMEKKRKSF 352
               L K +YGGGTVKI+MA  NFH+K+D L E+FEDGT+ + +II+L  GF+T+E+   S 
Sbjct:   247 DQLRKKYYGGGTVKIAMAGRNFHVKRDPLVERFEDGTLAFTSIIALLQGFETLERLVPST 306

Query:   353 TN----------AFELSQYTYFYFKQLSYSNGQPLVELYHDTDYGESKYQGNIVNFNLLH 402
                          F L +Y Y   K L +SNG  +V+LYHDT + +   QG IVNFN+LH
Sbjct:   307 AGLRTIERISQQTFHLGRYCYNRLKALRHSNGNAVVKLYHDTGFEDQGLQGGIVNFNILH 366

Query:   403 KDGTYYGYSEVQNLANLKKIQLRTGCHCNPGSCQRFLGLSDITIKFHFQQGHICXXXXXX 462
             +DGTY G++EV  +A+L  I LRTGC CNPG+CQR L LSD  +   F  GH+C      
Sbjct:   367 EDGTYVGFAEVSYMASLHNILLRTGCFCNPGACQRHLQLSDEDVLKQFDAGHVCGDANDL 426

Query:   463 XXXXPTGSIRISYGHASNWDDVKYFLSFLNQYFLQQADFVSIGDICLINNQRAESSKGFF 522
                 PTGS+R+S+G+ +  +D+   L  + + ++++   ++ G       Q     K + 
Sbjct:   427 IDGQPTGSVRVSFGYMTRKEDIDCLLEMVEKCYIRKT--IANG---FTRTQIVSKYKSY- 480

Query:   523 LNHSDNINKENKLVSIYIYPVKACGFFKVESKWEVTASGLKFDRQWMIITHSGVPLTQKL 582
                 D    + +L  I ++P+K+CG FKV ++W ++  GLK DR+++I+  +GV LTQK 
Sbjct:   481 ----D----QPRLKMICLFPIKSCGAFKVTTRWPLSRRGLKHDREFVIVDENGVALTQKK 532

Query:   583 EKNLCLVQPNFDITRNIMTLCYKSSGSTV-EIGI--DNEGLDLCTSKVCSDKITGFDCGN 639
                +CL++P  ++  N MTL + S    V ++ +  +++ + LC +KVC D +   DCG+
Sbjct:   533 LTEMCLIRPQINLKTNEMTLSHPSMDDFVLDLDLLGESQRIKLCQTKVCQDNVQAIDCGD 592

Query:   640 AVANWLDEQLNRKGXXXXXXX-----XXXXXXXXXXFSNMGQYLLITLPSIQ---AQLEN 691
              VA W+   L   G                       +N  Q+LLI   S++    ++ +
Sbjct:   593 QVAEWISVALQTSGLRLLKQSDEEVRTFQQSKQEIALANQAQFLLINQASVRWLADKVPD 652

Query:   692 LNAIFE---LENFVNRFRSNFVVSGQFEANAENDWDQVLIETNDGLLSFQVTSQCTRCQY 748
              + + E   LE+ V+RFR N +V        E DW +V I    G L F V   C+RCQ 
Sbjct:   653 WDELHEEPTLESLVDRFRGNLIVETPTSME-ECDWKRVTI----GYLEFAVDGPCSRCQM 707

Query:   749 IYIDQETALNTDVPLGEYQTRNFSTVSLNVK-EFFNNLEKTYNQYNFCSSMI 799
             I IDQ T + T  PL          +   +     N L     Q+ +C+S++
Sbjct:   708 ICIDQGTGVKTTEPLRTIGREFKGKMRFGIYLSHVNPLRDGSEQWLYCNSVV 759




GO:0008265 "Mo-molybdopterin cofactor sulfurase activity" evidence=ISS
GO:0043545 "molybdopterin cofactor metabolic process" evidence=ISS
MGI|MGI:1915841 Mocos "molybdenum cofactor sulfurase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q16GH0 mal1 "Molybdenum cofactor sulfurase 1" [Aedes aegypti (taxid:7159)] Back     alignment and assigned GO terms
UNIPROTKB|F1PDQ7 MOCOS "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|G3N1I0 MOCOS "Molybdenum cofactor sulfurase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9N0E7 MOCOS "Molybdenum cofactor sulfurase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1N3A9 MOCOS "Molybdenum cofactor sulfurase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q96EN8 MOCOS "Molybdenum cofactor sulfurase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SAI5 LOC100621611 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|B0WSX1 mal2 "Molybdenum cofactor sulfurase 2" [Culex quinquefasciatus (taxid:7176)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A2QIK9MOCOS_ASPNC2, ., 8, ., 1, ., 90.29870.81590.8080yesN/A
Q14CH1MOCOS_MOUSE2, ., 8, ., 1, ., 90.37460.84780.8016yesN/A
A2VD33MOCOS_DANRE2, ., 8, ., 1, ., 90.37300.84900.8327yesN/A
Q9C5X8MOCOS_ARATH2, ., 8, ., 1, ., 90.31730.83550.8315yesN/A
Q7QFL7MOCOS_ANOGA2, ., 8, ., 1, ., 90.36110.82690.8753yesN/A
Q21657MOCOS_CAEEL2, ., 8, ., 1, ., 90.33010.76070.8744yesN/A
Q29GM0MOCOS_DROPS2, ., 8, ., 1, ., 90.34210.83680.8611yesN/A
Q96EN8MOCOS_HUMAN2, ., 8, ., 1, ., 90.36610.84170.7725yesN/A
Q559G8MOCOS_DICDI2, ., 8, ., 1, ., 90.34060.84660.6852yesN/A
Q9VRA2MOCOS_DROME2, ., 8, ., 1, ., 90.35120.83680.8732yesN/A
Q655R6MOCOS_ORYSJ2, ., 8, ., 1, ., 90.32890.83920.8300yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.1LOW CONFIDENCE prediction!
4th Layer5.2.1.8LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query815
PLN02724805 PLN02724, PLN02724, Molybdenum cofactor sulfurase 1e-155
COG0520405 COG0520, csdA, Selenocysteine lyase/Cysteine desul 7e-36
pfam00266370 pfam00266, Aminotran_5, Aminotransferase class-V 6e-23
pfam03476118 pfam03476, MOSC_N, MOSC N-terminal beta barrel dom 3e-19
COG3217270 COG3217, COG3217, Uncharacterized Fe-S protein [Ge 2e-15
TIGR01977376 TIGR01977, am_tr_V_EF2568, cysteine desulfurase fa 2e-15
TIGR01979403 TIGR01979, sufS, cysteine desulfurases, SufSfamily 4e-13
pfam0063994 pfam00639, Rotamase, PPIC-type PPIASE domain 1e-11
TIGR02006402 TIGR02006, IscS, cysteine desulfurase IscS 2e-09
cd06453373 cd06453, SufS_like, Cysteine desulfurase (SufS)-li 4e-08
PLN02651364 PLN02651, PLN02651, cysteine desulfurase 3e-07
pfam13616114 pfam13616, Rotamase_3, PPIC-type PPIASE domain 6e-07
PRK03095287 PRK03095, prsA, peptidylprolyl isomerase; Reviewed 7e-07
PRK02998283 PRK02998, prsA, peptidylprolyl isomerase; Reviewed 3e-06
PRK03002285 PRK03002, prsA, peptidylprolyl isomerase; Reviewed 4e-06
pfam03473124 pfam03473, MOSC, MOSC domain 6e-06
COG0760320 COG0760, SurA, Parvulin-like peptidyl-prolyl isome 8e-06
PRK14012404 PRK14012, PRK14012, cysteine desulfurase; Provisio 3e-05
PTZ00356115 PTZ00356, PTZ00356, peptidyl-prolyl cis-trans isom 5e-05
TIGR03235353 TIGR03235, DNA_S_dndA, cysteine desulfurase DndA 1e-04
PRK1544193 PRK15441, PRK15441, peptidyl-prolyl cis-trans isom 0.003
PRK00059336 PRK00059, prsA, peptidylprolyl isomerase; Provisio 0.003
>gnl|CDD|215384 PLN02724, PLN02724, Molybdenum cofactor sulfurase Back     alignment and domain information
 Score =  472 bits (1215), Expect = e-155
 Identities = 258/748 (34%), Positives = 402/748 (53%), Gaps = 73/748 (9%)

Query: 59  LKDICYLDYTGAGVYSQSQMNQTIEQLKENIFSHPHGNSVLSDFCVSEIDQMRTKILQYF 118
           LK + YLD+ GA +YS+SQ+   +     N++ +PH  S  S      I+  R ++L+YF
Sbjct: 32  LKGVVYLDHAGATLYSESQLEAALADFSSNVYGNPHSQSDSSMRSSDTIESARQQVLEYF 91

Query: 119 NTDSDHYSVIFTSGATSAIKTVSEYFEFN-EGSFIYLTDNHTSVLGMRE--LVKTNQIYS 175
           N     Y+ +FTSGAT+A+K V E F ++ E  F Y  +NH SVLG+RE  L K     +
Sbjct: 92  NAPPSDYACVFTSGATAALKLVGETFPWSSESHFCYTLENHNSVLGIREYALEKGAAAIA 151

Query: 176 FSVDDARN-----------------MLNEFKESQENVENMRHSNSLFVYPAESNFSGTKY 218
             +++A N                   N  K  +   E+   + +LF +P+E NFSG K+
Sbjct: 152 VDIEEAANQPTNSQGSVVVKSRGLQRRNTSKLQKR--EDDGEAYNLFAFPSECNFSGAKF 209

Query: 219 PLSWCNTVHRNHVFKKHFKCSRSNCF-VLLDAATYCGSNMLDLKQHQPDFISISFYKMFG 277
           PL     +  N    +H   S+S  + VLLDAA  CG++  DL ++  DF+ +SFYK+FG
Sbjct: 210 PLDLVKLIKDN----QHSNFSKSGRWMVLLDAAKGCGTSPPDLSRYPADFVVVSFYKIFG 265

Query: 278 YPTGLGALIVKQKSAHVLNKTFYGGGTVKISMANENFHIKKDGLFEKFEDGTVNYLAIIS 337
           YPTGLGAL+V++ +A +L K ++GGGTV  S+A+ +F  +++ + ++FEDGT+++L+I +
Sbjct: 266 YPTGLGALLVRRDAAKLLKKKYFGGGTVAASIADIDFVKRRERVEQRFEDGTISFLSIAA 325

Query: 338 LKYGFDTMEKKRKSFTN--AFELSQYTYFYFKQLSYSNGQPLVELY--HDTDYGESKYQG 393
           L++GF  + +   S      + L+ Y     + L + NG P+  LY  H     E   QG
Sbjct: 326 LRHGFKLLNRLTISAIAMHTWALTHYVANSLRNLKHGNGAPVCVLYGNHTFKL-EFHIQG 384

Query: 394 NIVNFNLLHKDGTYYGYSEVQNLANLKKIQLRTGCHCNPGSCQRFLGLSDITIKFHFQQG 453
            IV FNL   DG++ G+ EV+ LA+L  IQLRTGC CNPG+C ++LGLS   ++ +F+ G
Sbjct: 385 PIVTFNLKRADGSWVGHREVEKLASLSGIQLRTGCFCNPGACAKYLGLSHKDLQANFEAG 444

Query: 454 HICGDDKDIIDGKPTGSIRISYGHASNWDDVKYFLSFLNQYFLQQADFVSIGDICLINNQ 513
           H+C DD+D+I G+PTG++R+S+G+ S ++D + F+ F+   F+          +      
Sbjct: 445 HVCWDDQDVIHGRPTGAVRVSFGYMSTFEDCQKFIDFIISSFVSTPKKRGNVTL------ 498

Query: 514 RAESSKGFFLNHSDNINKENKLVSIYIYPVKACGFFKVESKWEVTASGLKFDRQWMIITH 573
           R++ +    +         ++L SI +YP+K+C  F VE +W ++ +GL +DR+WMI + 
Sbjct: 499 RSKRTIPLPVLERKESFDSHRLKSITVYPIKSCAGFSVE-RWPLSETGLLYDREWMIQSL 557

Query: 574 SGVPLTQKLEKNLCLVQPNFDITRNIMTLCYKSSGSTVEIGIDNEGLDLCTSKV--CSDK 631
           +G  LTQK    +CL+    D+    + +        +EI ++++     + +V  C ++
Sbjct: 558 TGEILTQKKVPEMCLITTFIDLESGKLVVRAPRCDHKLEIPLESDSQHEESGEVILCGNR 617

Query: 632 ITGFDCGNAVANWLDEQLNRKGLRLIR--ISKRSSKRNIN-------------SFSNMGQ 676
                 G  +  W    L R+   L+R   S     RN N             SF+N GQ
Sbjct: 618 AESMSYGTEINEWFTNALGRR-CTLVRKSSSNTRVCRNRNPSHSPCGDDESRLSFANEGQ 676

Query: 677 YLLITLPSIQAQLENLNAIFELENFVN-------RFRSNFVVSGQFEANAENDWDQVLIE 729
           +LLI+    +A +E+LN                 RFR N VVSG  EA AE++W  + I 
Sbjct: 677 FLLIS----EASVEDLNRRLATGQEDAKIRLDPTRFRPNLVVSGG-EAYAEDEWQSLSI- 730

Query: 730 TNDGLLSFQVTSQCTRCQYIYIDQETAL 757
              G   F V   C RCQ I IDQET L
Sbjct: 731 ---GDAEFTVLGGCNRCQMINIDQETGL 755


Length = 805

>gnl|CDD|223594 COG0520, csdA, Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215829 pfam00266, Aminotran_5, Aminotransferase class-V Back     alignment and domain information
>gnl|CDD|217584 pfam03476, MOSC_N, MOSC N-terminal beta barrel domain Back     alignment and domain information
>gnl|CDD|225758 COG3217, COG3217, Uncharacterized Fe-S protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|131032 TIGR01977, am_tr_V_EF2568, cysteine desulfurase family protein Back     alignment and domain information
>gnl|CDD|131034 TIGR01979, sufS, cysteine desulfurases, SufSfamily Back     alignment and domain information
>gnl|CDD|216038 pfam00639, Rotamase, PPIC-type PPIASE domain Back     alignment and domain information
>gnl|CDD|131061 TIGR02006, IscS, cysteine desulfurase IscS Back     alignment and domain information
>gnl|CDD|99746 cd06453, SufS_like, Cysteine desulfurase (SufS)-like Back     alignment and domain information
>gnl|CDD|178257 PLN02651, PLN02651, cysteine desulfurase Back     alignment and domain information
>gnl|CDD|222266 pfam13616, Rotamase_3, PPIC-type PPIASE domain Back     alignment and domain information
>gnl|CDD|179537 PRK03095, prsA, peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>gnl|CDD|179522 PRK02998, prsA, peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>gnl|CDD|101162 PRK03002, prsA, peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>gnl|CDD|217583 pfam03473, MOSC, MOSC domain Back     alignment and domain information
>gnl|CDD|223831 COG0760, SurA, Parvulin-like peptidyl-prolyl isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184450 PRK14012, PRK14012, cysteine desulfurase; Provisional Back     alignment and domain information
>gnl|CDD|185573 PTZ00356, PTZ00356, peptidyl-prolyl cis-trans isomerase (PPIase); Provisional Back     alignment and domain information
>gnl|CDD|163191 TIGR03235, DNA_S_dndA, cysteine desulfurase DndA Back     alignment and domain information
>gnl|CDD|185338 PRK15441, PRK15441, peptidyl-prolyl cis-trans isomerase C; Provisional Back     alignment and domain information
>gnl|CDD|234605 PRK00059, prsA, peptidylprolyl isomerase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 815
PLN02724805 Molybdenum cofactor sulfurase 100.0
COG3217270 Uncharacterized Fe-S protein [General function pre 100.0
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 100.0
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desul 100.0
KOG2362|consensus336 100.0
PRK09295406 bifunctional cysteine desulfurase/selenocysteine l 100.0
PLN02855424 Bifunctional selenocysteine lyase/cysteine desulfu 100.0
PRK10874401 cysteine sulfinate desulfinase; Provisional 100.0
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 100.0
KOG1549|consensus428 100.0
PLN02651364 cysteine desulfurase 100.0
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of thi 100.0
PF00266371 Aminotran_5: Aminotransferase class-V; InterPro: I 100.0
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, ep 100.0
TIGR01979403 sufS cysteine desulfurases, SufS subfamily. This m 100.0
TIGR02006402 IscS cysteine desulfurase IscS. This model represe 100.0
KOG2142|consensus728 100.0
PRK02948381 cysteine desulfurase; Provisional 100.0
TIGR01976397 am_tr_V_VC1184 cysteine desulfurase family protein 100.0
TIGR01977376 am_tr_V_EF2568 cysteine desulfurase family protein 100.0
PRK14012404 cysteine desulfurase; Provisional 100.0
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This f 100.0
TIGR01814406 kynureninase kynureninase. This model describes ky 100.0
TIGR03235353 DNA_S_dndA cysteine desulfurase DndA. This model d 100.0
PLN02409401 serine--glyoxylate aminotransaminase 99.97
PRK03080378 phosphoserine aminotransferase; Provisional 99.97
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 99.96
PF03476120 MOSC_N: MOSC N-terminal beta barrel domain; InterP 99.96
TIGR02326363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 99.96
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 99.96
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Pr 99.95
TIGR01364349 serC_1 phosphoserine aminotransferase. This model 99.95
TIGR01788431 Glu-decarb-GAD glutamate decarboxylase. This model 99.95
PRK09331387 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.95
PRK05355360 3-phosphoserine/phosphohydroxythreonine aminotrans 99.95
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartat 99.95
PTZ00094452 serine hydroxymethyltransferase; Provisional 99.95
PRK02769380 histidine decarboxylase; Provisional 99.94
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 99.94
TIGR01366361 serC_3 phosphoserine aminotransferase, putative. T 99.94
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 99.94
PRK13520371 L-tyrosine decarboxylase; Provisional 99.93
TIGR02539370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 99.93
TIGR03812373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 99.92
PLN03032374 serine decarboxylase; Provisional 99.92
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 99.92
TIGR01822393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 99.91
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amin 99.91
PLN03026380 histidinol-phosphate aminotransferase; Provisional 99.91
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferas 99.9
PRK09105370 putative aminotransferase; Provisional 99.9
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 99.9
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- an 99.9
COG3844407 Kynureninase [Amino acid transport and metabolism] 99.9
PRK05387353 histidinol-phosphate aminotransferase; Provisional 99.9
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 99.9
PRK07179407 hypothetical protein; Provisional 99.9
PRK08056356 threonine-phosphate decarboxylase; Provisional 99.9
PRK01533366 histidinol-phosphate aminotransferase; Validated 99.9
PRK06225380 aspartate aminotransferase; Provisional 99.9
PRK14807351 histidinol-phosphate aminotransferase; Provisional 99.9
PRK04870356 histidinol-phosphate aminotransferase; Provisional 99.9
PRK08960387 hypothetical protein; Provisional 99.89
PRK07908349 hypothetical protein; Provisional 99.89
PRK06108382 aspartate aminotransferase; Provisional 99.89
PRK03158359 histidinol-phosphate aminotransferase; Provisional 99.89
PRK08134433 O-acetylhomoserine aminocarboxypropyltransferase; 99.89
KOG2862|consensus385 99.89
PRK06767386 methionine gamma-lyase; Provisional 99.89
cd06454349 KBL_like KBL_like; this family belongs to the pyri 99.89
PRK01688351 histidinol-phosphate aminotransferase; Provisional 99.89
TIGR01437363 selA_rel uncharacterized pyridoxal phosphate-depen 99.89
PRK06207405 aspartate aminotransferase; Provisional 99.89
TIGR01329378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 99.89
PRK08045386 cystathionine gamma-synthase; Provisional 99.89
PRK07681399 aspartate aminotransferase; Provisional 99.89
PRK08861388 cystathionine gamma-synthase; Provisional 99.89
PRK08064390 cystathionine beta-lyase; Provisional 99.89
TIGR00858360 bioF 8-amino-7-oxononanoate synthase. This model r 99.88
PRK00451447 glycine dehydrogenase subunit 1; Validated 99.88
PRK04635354 histidinol-phosphate aminotransferase; Provisional 99.88
PRK05957389 aspartate aminotransferase; Provisional 99.88
TIGR02080382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 99.88
PLN02414993 glycine dehydrogenase (decarboxylating) 99.88
PRK04366481 glycine dehydrogenase subunit 2; Validated 99.88
PRK07324373 transaminase; Validated 99.88
PLN02721353 threonine aldolase 99.88
PLN02452365 phosphoserine transaminase 99.88
PRK02731367 histidinol-phosphate aminotransferase; Validated 99.88
PRK07504398 O-succinylhomoserine sulfhydrylase; Reviewed 99.88
PRK08133390 O-succinylhomoserine sulfhydrylase; Validated 99.88
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. T 99.88
PRK06425332 histidinol-phosphate aminotransferase; Validated 99.87
PRK08574385 cystathionine gamma-synthase; Provisional 99.87
PRK08153369 histidinol-phosphate aminotransferase; Provisional 99.87
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 99.87
PRK08249398 cystathionine gamma-synthase; Provisional 99.87
PRK04781364 histidinol-phosphate aminotransferase; Provisional 99.87
PRK06358354 threonine-phosphate decarboxylase; Provisional 99.87
TIGR01324377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 99.87
COG1168388 MalY Bifunctional PLP-dependent enzyme with beta-c 99.87
PRK06234400 methionine gamma-lyase; Provisional 99.87
PRK07682378 hypothetical protein; Validated 99.87
PRK07337388 aminotransferase; Validated 99.87
PRK08776405 cystathionine gamma-synthase; Provisional 99.87
PRK06460376 hypothetical protein; Provisional 99.87
PRK08912387 hypothetical protein; Provisional 99.87
TIGR01328391 met_gam_lyase methionine gamma-lyase. This model d 99.87
PRK06939397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 99.87
PLN00175413 aminotransferase family protein; Provisional 99.87
PRK06348384 aspartate aminotransferase; Provisional 99.87
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 99.87
PLN02483489 serine palmitoyltransferase 99.87
PRK09276385 LL-diaminopimelate aminotransferase; Provisional 99.87
PLN02822481 serine palmitoyltransferase 99.87
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: t 99.87
PRK00950361 histidinol-phosphate aminotransferase; Validated 99.87
TIGR01325380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 99.87
PRK08361391 aspartate aminotransferase; Provisional 99.87
PRK13392410 5-aminolevulinate synthase; Provisional 99.86
PRK13355517 bifunctional HTH-domain containing protein/aminotr 99.86
PRK05764393 aspartate aminotransferase; Provisional 99.86
PRK07503403 methionine gamma-lyase; Provisional 99.86
PTZ00377481 alanine aminotransferase; Provisional 99.86
PRK05942394 aspartate aminotransferase; Provisional 99.86
TIGR01825385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 99.86
TIGR01365374 serC_2 phosphoserine aminotransferase, Methanosarc 99.86
PRK12414384 putative aminotransferase; Provisional 99.86
PRK05968389 hypothetical protein; Provisional 99.86
PRK08363398 alanine aminotransferase; Validated 99.86
PRK08248431 O-acetylhomoserine aminocarboxypropyltransferase; 99.86
PRK07366388 succinyldiaminopimelate transaminase; Validated 99.86
PRK08114395 cystathionine beta-lyase; Provisional 99.86
PRK02610374 histidinol-phosphate aminotransferase; Provisional 99.86
PRK05166371 histidinol-phosphate aminotransferase; Provisional 99.86
PRK07812436 O-acetylhomoserine aminocarboxypropyltransferase; 99.86
PRK07683387 aminotransferase A; Validated 99.86
TIGR01821402 5aminolev_synth 5-aminolevulinic acid synthase. Th 99.86
PRK14808335 histidinol-phosphate aminotransferase; Provisional 99.86
PLN02414 993 glycine dehydrogenase (decarboxylating) 99.86
PRK03317368 histidinol-phosphate aminotransferase; Provisional 99.86
PRK03321352 putative aminotransferase; Provisional 99.86
PTZ00433412 tyrosine aminotransferase; Provisional 99.85
PRK09265404 aminotransferase AlaT; Validated 99.85
PRK07049427 methionine gamma-lyase; Validated 99.85
PRK07392360 threonine-phosphate decarboxylase; Validated 99.85
PRK07309391 aromatic amino acid aminotransferase; Validated 99.85
cd00609350 AAT_like Aspartate aminotransferase family. This f 99.85
PRK07568397 aspartate aminotransferase; Provisional 99.85
PLN02187462 rooty/superroot1 99.85
PRK07810403 O-succinylhomoserine sulfhydrylase; Provisional 99.85
PRK06290410 aspartate aminotransferase; Provisional 99.85
PRK09028394 cystathionine beta-lyase; Provisional 99.85
PRK09148405 aminotransferase; Validated 99.85
PRK07582366 cystathionine gamma-lyase; Validated 99.85
TIGR01264401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 99.85
PRK12462364 phosphoserine aminotransferase; Provisional 99.85
PRK14809357 histidinol-phosphate aminotransferase; Provisional 99.85
PRK06107402 aspartate aminotransferase; Provisional 99.85
PLN02656409 tyrosine transaminase 99.85
PLN00145430 tyrosine/nicotianamine aminotransferase; Provision 99.85
PRK08636403 aspartate aminotransferase; Provisional 99.85
PRK09147396 succinyldiaminopimelate transaminase; Provisional 99.85
PRK09064407 5-aminolevulinate synthase; Validated 99.85
PRK05939397 hypothetical protein; Provisional 99.85
PRK05994427 O-acetylhomoserine aminocarboxypropyltransferase; 99.85
PRK07811388 cystathionine gamma-synthase; Provisional 99.84
cd00614369 CGS_like CGS_like: Cystathionine gamma-synthase is 99.84
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and rela 99.84
PRK13393406 5-aminolevulinate synthase; Provisional 99.84
PLN02509464 cystathionine beta-lyase 99.84
PRK06176380 cystathionine gamma-synthase/cystathionine beta-ly 99.84
PRK09082386 methionine aminotransferase; Validated 99.84
TIGR01140330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 99.84
PRK00011416 glyA serine hydroxymethyltransferase; Reviewed 99.84
PRK07269364 cystathionine gamma-synthase; Reviewed 99.84
PRK15481431 transcriptional regulatory protein PtsJ; Provision 99.84
PRK05613437 O-acetylhomoserine aminocarboxypropyltransferase; 99.84
PRK07550386 hypothetical protein; Provisional 99.84
TIGR03538393 DapC_gpp succinyldiaminopimelate transaminase. Thi 99.84
PRK08068389 transaminase; Reviewed 99.84
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 99.84
PRK07777387 aminotransferase; Validated 99.84
PLN02376496 1-aminocyclopropane-1-carboxylate synthase 99.83
PRK06084425 O-acetylhomoserine aminocarboxypropyltransferase; 99.83
PRK06836394 aspartate aminotransferase; Provisional 99.83
PRK07671377 cystathionine beta-lyase; Provisional 99.83
TIGR01265403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 99.83
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. 99.83
PRK03967337 histidinol-phosphate aminotransferase; Provisional 99.83
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. T 99.83
PLN02450468 1-aminocyclopropane-1-carboxylate synthase 99.83
PLN00143409 tyrosine/nicotianamine aminotransferase; Provision 99.83
PLN02242418 methionine gamma-lyase 99.83
KOG0257|consensus420 99.83
TIGR03799522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 99.83
PRK08175395 aminotransferase; Validated 99.83
cd06502338 TA_like Low-specificity threonine aldolase (TA). T 99.83
TIGR01326418 OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d 99.83
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 99.82
PRK05367 954 glycine dehydrogenase; Provisional 99.82
PRK07865364 N-succinyldiaminopimelate aminotransferase; Review 99.82
PRK08247366 cystathionine gamma-synthase; Reviewed 99.82
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 99.82
PRK06959339 putative threonine-phosphate decarboxylase; Provis 99.82
PRK06702432 O-acetylhomoserine aminocarboxypropyltransferase; 99.82
PRK05967395 cystathionine beta-lyase; Provisional 99.81
PRK05839374 hypothetical protein; Provisional 99.81
PRK07050394 cystathionine beta-lyase; Provisional 99.81
PRK13580493 serine hydroxymethyltransferase; Provisional 99.81
PLN02880490 tyrosine decarboxylase 99.81
PF00155363 Aminotran_1_2: Aminotransferase class I and II 1-a 99.81
PLN02263470 serine decarboxylase 99.81
PRK13238460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 99.8
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 99.8
PLN03227392 serine palmitoyltransferase-like protein; Provisio 99.8
PRK13034416 serine hydroxymethyltransferase; Reviewed 99.8
PLN03226475 serine hydroxymethyltransferase; Provisional 99.8
PRK06855433 aminotransferase; Validated 99.8
PRK10534333 L-threonine aldolase; Provisional 99.8
PLN02607447 1-aminocyclopropane-1-carboxylate synthase 99.8
PRK05664330 threonine-phosphate decarboxylase; Reviewed 99.79
COG2873426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid 99.79
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 99.79
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 99.79
PRK08354311 putative aminotransferase; Provisional 99.79
PLN02231534 alanine transaminase 99.79
PF01053386 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent 99.79
PLN02955476 8-amino-7-oxononanoate synthase 99.79
COG0626396 MetC Cystathionine beta-lyases/cystathionine gamma 99.79
PRK06434384 cystathionine gamma-lyase; Validated 99.79
COG2008342 GLY1 Threonine aldolase [Amino acid transport and 99.79
PRK09440416 avtA valine--pyruvate transaminase; Provisional 99.78
KOG3846|consensus465 99.78
PF03473133 MOSC: MOSC domain; InterPro: IPR005302 Molybdenum 99.78
COG1167459 ARO8 Transcriptional regulators containing a DNA-b 99.78
PLN02590539 probable tyrosine decarboxylase 99.77
PLN02271586 serine hydroxymethyltransferase 99.77
PLN026721082 methionine S-methyltransferase 99.76
PRK09275527 aspartate aminotransferase; Provisional 99.76
KOG1368|consensus384 99.76
COG0399374 WecE Predicted pyridoxal phosphate-dependent enzym 99.76
COG0076460 GadB Glutamate decarboxylase and related PLP-depen 99.76
TIGR02379376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 99.75
TIGR03801521 asp_4_decarbox aspartate 4-decarboxylase. This enz 99.75
COG1103382 Archaea-specific pyridoxal phosphate-dependent enz 99.75
PRK12566954 glycine dehydrogenase; Provisional 99.75
PRK05367954 glycine dehydrogenase; Provisional 99.74
cd00617431 Tnase_like Tryptophanase family (Tnase). This fami 99.73
PRK03244398 argD acetylornithine aminotransferase; Provisional 99.72
PRK07505402 hypothetical protein; Provisional 99.72
PF01041363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 99.72
KOG1359|consensus417 99.72
TIGR00707379 argD acetylornithine and succinylornithine aminotr 99.71
PRK04311464 selenocysteine synthase; Provisional 99.71
cd00610413 OAT_like Acetyl ornithine aminotransferase family. 99.71
PTZ00376404 aspartate aminotransferase; Provisional 99.71
KOG0259|consensus447 99.71
TIGR00474454 selA seryl-tRNA(sec) selenium transferase. In bact 99.7
PRK15407438 lipopolysaccharide biosynthesis protein RfbH; Prov 99.7
PRK11706375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 99.7
PRK00854401 rocD ornithine--oxo-acid transaminase; Reviewed 99.7
PRK09257396 aromatic amino acid aminotransferase; Provisional 99.69
PLN02368407 alanine transaminase 99.69
KOG0053|consensus409 99.69
PF01276417 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; 99.68
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 99.68
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 99.66
TIGR00461939 gcvP glycine dehydrogenase (decarboxylating). This 99.66
PRK08637388 hypothetical protein; Provisional 99.66
PF00282373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 99.65
PRK15029755 arginine decarboxylase; Provisional 99.65
PTZ00125400 ornithine aminotransferase-like protein; Provision 99.64
TIGR03531444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 99.63
COG0112413 GlyA Glycine/serine hydroxymethyltransferase [Amin 99.63
COG1932365 SerC Phosphoserine aminotransferase [Coenzyme meta 99.6
PRK01278389 argD acetylornithine transaminase protein; Provisi 99.59
PLN02397423 aspartate transaminase 99.59
PF00464399 SHMT: Serine hydroxymethyltransferase; InterPro: I 99.59
PRK02627396 acetylornithine aminotransferase; Provisional 99.58
KOG0256|consensus471 99.58
TIGR03811608 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu 99.58
TIGR01885401 Orn_aminotrans ornithine aminotransferase. This mo 99.57
PRK13578720 ornithine decarboxylase; Provisional 99.57
KOG1360|consensus570 99.56
PRK04260375 acetylornithine aminotransferase; Provisional 99.54
PLN02624474 ornithine-delta-aminotransferase 99.53
PRK15400714 lysine decarboxylase CadA; Provisional 99.52
PRK02936377 argD acetylornithine aminotransferase; Provisional 99.52
KOG0633|consensus375 99.52
KOG3258|consensus133 99.51
PRK05964423 adenosylmethionine--8-amino-7-oxononanoate transam 99.5
PRK15399713 lysine decarboxylase LdcC; Provisional 99.49
KOG1357|consensus519 99.49
TIGR03246397 arg_catab_astC succinylornithine transaminase fami 99.49
PRK03715395 argD acetylornithine transaminase protein; Provisi 99.48
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminot 99.47
TIGR02618450 tyr_phenol_ly tyrosine phenol-lyase. This model de 99.44
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 99.44
COG3977417 Alanine-alpha-ketoisovalerate (or valine-pyruvate) 99.43
PRK13237460 tyrosine phenol-lyase; Provisional 99.41
KOG0634|consensus472 99.4
TIGR02407412 ectoine_ectB diaminobutyrate--2-oxoglutarate amino 99.37
PLN00144382 acetylornithine transaminase 99.37
COG4992404 ArgD Ornithine/acetylornithine aminotransferase [A 99.36
PRK12381406 bifunctional succinylornithine transaminase/acetyl 99.36
TIGR03372442 putres_am_tran putrescine aminotransferase. Member 99.35
PRK08117433 4-aminobutyrate aminotransferase; Provisional 99.34
PRK11522459 putrescine--2-oxoglutarate aminotransferase; Provi 99.34
PRK08360443 4-aminobutyrate aminotransferase; Provisional 99.33
KOG1383|consensus491 99.33
PF01212290 Beta_elim_lyase: Beta-eliminating lyase; InterPro: 99.33
TIGR00700420 GABAtrnsam 4-aminobutyrate aminotransferase, proka 99.32
TIGR00713423 hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi 99.3
PRK09264425 diaminobutyrate--2-oxoglutarate aminotransferase; 99.29
PRK13360442 omega amino acid--pyruvate transaminase; Provision 99.29
COG0160447 GabT 4-aminobutyrate aminotransferase and related 99.28
PLN02760504 4-aminobutyrate:pyruvate transaminase 99.27
PRK05630422 adenosylmethionine--8-amino-7-oxononanoate transam 99.26
COG1982557 LdcC Arginine/lysine/ornithine decarboxylases [Ami 99.26
PRK09792421 4-aminobutyrate transaminase; Provisional 99.25
PRK06777421 4-aminobutyrate aminotransferase; Provisional 99.24
PRK08593445 4-aminobutyrate aminotransferase; Provisional 99.24
PRK06058443 4-aminobutyrate aminotransferase; Provisional 99.23
PRK09221445 beta alanine--pyruvate transaminase; Provisional 99.23
PRK06541460 hypothetical protein; Provisional 99.22
PRK08088425 4-aminobutyrate aminotransferase; Validated 99.22
PRK06173429 adenosylmethionine--8-amino-7-oxononanoate transam 99.22
PRK07495425 4-aminobutyrate aminotransferase; Provisional 99.22
PRK05769441 4-aminobutyrate aminotransferase; Provisional 99.22
PRK04612408 argD acetylornithine transaminase protein; Provisi 99.21
PRK06918451 4-aminobutyrate aminotransferase; Reviewed 99.2
PRK07986428 adenosylmethionine--8-amino-7-oxononanoate transam 99.2
PRK06062451 hypothetical protein; Provisional 99.19
PRK12403460 putative aminotransferase; Provisional 99.19
PRK06105460 aminotransferase; Provisional 99.17
PRK00062426 glutamate-1-semialdehyde aminotransferase; Provisi 99.17
PRK00615433 glutamate-1-semialdehyde aminotransferase; Provisi 99.16
PRK05639457 4-aminobutyrate aminotransferase; Provisional 99.15
TIGR00508427 bioA adenosylmethionine-8-amino-7-oxononanoate tra 99.14
PF12897425 Aminotran_MocR: Alanine-glyoxylate amino-transfera 99.14
PRK07678451 aminotransferase; Validated 99.13
PRK06943453 adenosylmethionine--8-amino-7-oxononanoate transam 99.11
PRK06149972 hypothetical protein; Provisional 99.11
TIGR03251431 LAT_fam L-lysine 6-transaminase. Characterized mem 99.11
PRK07482461 hypothetical protein; Provisional 99.11
COG1003496 GcvP Glycine cleavage system protein P (pyridoxal- 99.08
TIGR00709442 dat 2,4-diaminobutyrate 4-transaminases. This fami 99.08
PRK06082459 4-aminobutyrate aminotransferase; Provisional 99.07
COG0161449 BioA Adenosylmethionine-8-amino-7-oxononanoate ami 99.06
PRK05965459 hypothetical protein; Provisional 99.05
PRK07480456 putative aminotransferase; Validated 99.05
PRK07481449 hypothetical protein; Provisional 99.04
COG0001432 HemL Glutamate-1-semialdehyde aminotransferase [Co 99.03
PRK07030466 adenosylmethionine--8-amino-7-oxononanoate transam 99.02
PRK04013364 argD acetylornithine/acetyl-lysine aminotransferas 99.02
KOG2467|consensus477 99.02
PF02347429 GDC-P: Glycine cleavage system P-protein; InterPro 99.01
PRK07036466 hypothetical protein; Provisional 99.0
PF04864363 Alliinase_C: Allinase; InterPro: IPR006948 Allicin 99.0
PRK08297443 L-lysine aminotransferase; Provisional 99.0
PRK12389428 glutamate-1-semialdehyde aminotransferase; Provisi 98.99
COG1921395 SelA Selenocysteine synthase [seryl-tRNASer seleni 98.99
PRK06916460 adenosylmethionine--8-amino-7-oxononanoate transam 98.99
PLN02482474 glutamate-1-semialdehyde 2,1-aminomutase 98.99
PRK061481013 hypothetical protein; Provisional 98.98
TIGR00699464 GABAtrns_euk 4-aminobutyrate aminotransferase, euk 98.98
PRK07483443 hypothetical protein; Provisional 98.96
PRK08742472 adenosylmethionine--8-amino-7-oxononanoate transam 98.96
PRK06917447 hypothetical protein; Provisional 98.96
PF03841367 SelA: L-seryl-tRNA selenium transferase; InterPro: 98.96
TIGR02617467 tnaA_trp_ase tryptophanase, leader peptide-associa 98.95
KOG0258|consensus475 98.93
KOG2790|consensus370 98.93
PRK07046453 aminotransferase; Validated 98.93
KOG1402|consensus427 98.92
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase 98.9
COG0403450 GcvP Glycine cleavage system protein P (pyridoxal- 98.88
PRK06938464 diaminobutyrate--2-oxoglutarate aminotransferase; 98.88
PRK06931459 diaminobutyrate--2-oxoglutarate aminotransferase; 98.87
KOG1358|consensus467 98.85
PRK1544193 peptidyl-prolyl cis-trans isomerase C; Provisional 98.84
KOG0629|consensus510 98.8
PF13616117 Rotamase_3: PPIC-type PPIASE domain; PDB: 3RFW_A 3 98.79
PF0063995 Rotamase: PPIC-type PPIASE domain; InterPro: IPR00 98.78
KOG0628|consensus511 98.77
KOG1404|consensus442 98.74
PF06838403 Met_gamma_lyase: Methionine gamma-lyase ; InterPro 98.67
PF00202339 Aminotran_3: Aminotransferase class-III; InterPro: 98.66
PRK06209431 glutamate-1-semialdehyde 2,1-aminomutase; Provisio 98.62
TIGR02933256 nifM_nitrog nitrogen fixation protein NifM. Member 98.62
PLN02974817 adenosylmethionine-8-amino-7-oxononanoate transami 98.57
PTZ00356115 peptidyl-prolyl cis-trans isomerase (PPIase); Prov 98.56
PRK12566 954 glycine dehydrogenase; Provisional 98.56
KOG2040|consensus1001 98.48
PRK12450309 foldase protein PrsA; Reviewed 98.46
PRK01326310 prsA foldase protein PrsA; Reviewed 98.4
PRK04405298 prsA peptidylprolyl isomerase; Provisional 98.38
PRK02998283 prsA peptidylprolyl isomerase; Reviewed 98.35
PRK03002285 prsA peptidylprolyl isomerase; Reviewed 98.34
PRK10770413 peptidyl-prolyl cis-trans isomerase SurA; Provisio 98.33
PRK10770413 peptidyl-prolyl cis-trans isomerase SurA; Provisio 98.32
PF05889389 SLA_LP_auto_ag: Soluble liver antigen/liver pancre 98.29
PRK03095287 prsA peptidylprolyl isomerase; Reviewed 98.25
COG3033471 TnaA Tryptophanase [Amino acid transport and metab 98.11
KOG1403|consensus452 97.96
PRK10788623 periplasmic folding chaperone; Provisional 97.95
COG4100416 Cystathionine beta-lyase family protein involved i 97.92
PRK00059336 prsA peptidylprolyl isomerase; Provisional 97.84
KOG1401|consensus433 97.81
COG0760320 SurA Parvulin-like peptidyl-prolyl isomerase [Post 97.51
KOG1412|consensus410 97.41
KOG2040|consensus 1001 97.32
KOG1405|consensus484 96.05
KOG2142|consensus728 95.6
PRK14499308 molybdenum cofactor biosynthesis protein MoaC/MOSC 95.54
KOG1411|consensus427 95.52
PF13145121 Rotamase_2: PPIC-type PPIASE domain; PDB: 3NRK_A 2 94.05
PLN02994153 1-aminocyclopropane-1-carboxylate synthase 93.42
KOG3843|consensus432 89.01
PRK11536223 6-N-hydroxylaminopurine resistance protein; Provis 84.86
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
Probab=100.00  E-value=4e-110  Score=998.65  Aligned_cols=722  Identities=34%  Similarity=0.613  Sum_probs=596.3

Q ss_pred             ccccccchhhhhhhhcccccchhhHHHHHHHHhhccccCCCChhhhhhhhhhhHHHHHHHHHhHcCCCCCceeEEecCCc
Q psy16512         54 EGKNHLKDICYLDYTGAGVYSQSQMNQTIEQLKENIFSHPHGNSVLSDFCVSEIDQMRTKILQYFNTDSDHYSVIFTSGA  133 (815)
Q Consensus        54 ed~~~~~~~iyLd~a~~~~~p~~v~~al~~~l~~~~~~np~s~~~~~~~~~~~~~~~r~~la~~~g~~~~~~~iv~t~g~  133 (815)
                      .+|+.++..+|||+++++++++.+++++.+.+....++||++.+.....+...++++|+.+++++|+++++|.|+||+|+
T Consensus        27 ~~fp~l~~~iYLD~Aatt~~~~~~V~~~~~~~~~~~~~np~s~~~~s~~~~~~~e~aR~~ia~~lga~~~~~~VvFtsna  106 (805)
T PLN02724         27 TEFARLKGVVYLDHAGATLYSESQLEAALADFSSNVYGNPHSQSDSSMRSSDTIESARQQVLEYFNAPPSDYACVFTSGA  106 (805)
T ss_pred             HHhhhcCCCEeEeCCCCCCCCHHHHHHHHHHHHhhccCCCCcCcchhhhHHHHHHHHHHHHHHHhCCCccceEEEEeCCh
Confidence            46777777899999999998877777776666556678998765444545556999999999999998877779999999


Q ss_pred             hhhHHHHHhhhccCCCc-EEEecCCCcchhhHHHHhhccc----eEEcC--------chhhhcc--hhhhhhhhh-h--h
Q psy16512        134 TSAIKTVSEYFEFNEGS-FIYLTDNHTSVLGMRELVKTNQ----IYSFS--------VDDARNM--LNEFKESQE-N--V  195 (815)
Q Consensus       134 t~al~~~~~al~~~~gd-vv~~~~~h~s~~~~~~~~~~~g----~v~~~--------~~~~~~~--~~~~~~l~~-~--~  195 (815)
                      |+|+++++.++.+++|| ||++..+|+++..|.+++++.|    +++++        ..+.++.  +.+++.++. +  .
T Consensus       107 T~alnlva~~l~~~~gd~Iv~t~~eH~svl~~~~~a~~~G~~v~~v~~~~~~~~~~~~~g~~~~~~~~l~~~~~~~l~~~  186 (805)
T PLN02724        107 TAALKLVGETFPWSSESHFCYTLENHNSVLGIREYALEKGAAAIAVDIEEAANQPTNSQGSVVVKSRGLQRRNTSKLQKR  186 (805)
T ss_pred             HHHHHHHHHHCCCCCCCeEEEeeccccchHHHHHHHHHcCCeEEeccchhccccccccccccccchhhhhhhhhhhhccc
Confidence            99999999999888998 8889999999999888887777    34443        1111221  222221100 0  0


Q ss_pred             hhcCCCccEEEEecccCCCccccChHHHHHHhhccccccccccCC-----CCeEEEEecccccCCCCCCCCCCCCcEEEE
Q psy16512        196 ENMRHSNSLFVYPAESNFSGTKYPLSWCNTVHRNHVFKKHFKCSR-----SNCFVLLDAATYCGSNMLDLKQHQPDFISI  270 (815)
Q Consensus       196 ~~~~~~t~lv~i~~~~n~tG~~~~l~~I~~l~~~~~~~~~~~~~~-----~gi~vivD~a~~~g~~~~dl~~~~~D~vv~  270 (815)
                      ....++|++|++++++|.||.++|+++|..+++..        ..     .+++++||++|++|+.++|+..+++||+++
T Consensus       187 ~~~~~~t~LVa~~~vsN~tG~i~pi~~i~~~~~~~--------~~~~~~~g~~~v~vDaaQ~~g~~piDv~~~~~Dfl~~  258 (805)
T PLN02724        187 EDDGEAYNLFAFPSECNFSGAKFPLDLVKLIKDNQ--------HSNFSKSGRWMVLLDAAKGCGTSPPDLSRYPADFVVV  258 (805)
T ss_pred             cccCCCcceEEEEccccCCCCcCCHHHHHHHHHhc--------ccccccCcceEEEeehhhhcCCCCCChhhcCCCEEEE
Confidence            11235679999999999999999999876655510        01     247899999999999999999999999999


Q ss_pred             ccccccccCCcceEEEEecccccccCcccccCceEEEEecCCcccccccCccccccCCCCChhHHHHHHHHHHHHHhhhh
Q psy16512        271 SFYKMFGYPTGLGALIVKQKSAHVLNKTFYGGGTVKISMANENFHIKKDGLFEKFEDGTVNYLAIISLKYGFDTMEKKRK  350 (815)
Q Consensus       271 S~~K~~g~p~G~G~l~~~~~~~~~l~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~gt~~~~~~~al~~al~~l~~~~~  350 (815)
                      |+|||||+|.|+|+|++++++.+.+.|.++||+++........+.......+.+|+.||+|+++++++.+|++++.+++.
T Consensus       259 S~HK~~GgP~G~G~L~vr~~~~~~l~p~~~GGg~~~~~~~~~~~~~~~~~~~~rfE~GT~n~~~i~~l~aal~~l~~ig~  338 (805)
T PLN02724        259 SFYKIFGYPTGLGALLVRRDAAKLLKKKYFGGGTVAASIADIDFVKRRERVEQRFEDGTISFLSIAALRHGFKLLNRLTI  338 (805)
T ss_pred             ecceeccCCCCceEEEEehhhhhhhcCCccCCCceEEEecccceeeccccHHHHhcCCCcchhHHHHHHHHHHHHHHhCh
Confidence            99999999999999999999888888999998876543333233223344578999999999999999999999998875


Q ss_pred             hH--HHHHHHHHHHHHHHHhccccCCCCcEEEcCCCC-CCCCCcccceEEEEEecCCCCccCHHHHHHhhhcCCcEeccC
Q psy16512        351 SF--TNAFELSQYTYFYFKQLSYSNGQPLVELYHDTD-YGESKYQGNIVNFNLLHKDGTYYGYSEVQNLANLKKIQLRTG  427 (815)
Q Consensus       351 ~~--~~~~~l~~~l~~~L~~l~~~~~~p~~~l~~~~~-~~~~~~~~~i~~f~~~~~~~~~~~~~~v~~~l~~~gI~v~~g  427 (815)
                      ..  +|..+|++++.+.|++++|.||.|+++++++.. ......++++++|++.+.++..+++.++.+++..+||.+|+|
T Consensus       339 ~~I~~~~~~L~~~l~~~L~~l~~~~g~~~v~iyg~~~~~~~~~~r~~ivsFnv~~~~~~~v~~~~v~~l~~~~gI~vR~G  418 (805)
T PLN02724        339 SAIAMHTWALTHYVANSLRNLKHGNGAPVCVLYGNHTFKLEFHIQGPIVTFNLKRADGSWVGHREVEKLASLSGIQLRTG  418 (805)
T ss_pred             HHHHHHHHHHHHHHHHHHHhccCCCCCeEEEEcCCCCCCCCcccccCEEEEEEEcCCCCEeCHHHHHHHHHhcCcEEeec
Confidence            44  999999999999999999999999999998641 111235789999999998888888888998889999999999


Q ss_pred             ccCCchhhhhhcCCCHHHHHHHhhcCCccCCcccccCCCCceEEEEeccCCCCHHHHHHHHHHHHHHHhhcCcccccccc
Q psy16512        428 CHCNPGSCQRFLGLSDITIKFHFQQGHICGDDKDIIDGKPTGSIRISYGHASNWDDVKYFLSFLNQYFLQQADFVSIGDI  507 (815)
Q Consensus       428 ~~~~~~~~~~~~g~~~~~~~~~~~~~~~c~~~~~~~~~~~~g~iRvs~g~~~t~edi~~lv~~L~~~~~~~~~~~~~~~~  507 (815)
                      ++|+++.++.++|+++.++...+..|+.|||..+++++.+.|.||+|+|+|||++||++|+++|++.|++++......  
T Consensus       419 ~~Ca~~~~~~~lg~~~~~l~~~~~~~~~c~~~~~~~~~~~~G~vRvS~g~ynt~eDvd~lv~~l~~~~~~~~~~~~~~--  496 (805)
T PLN02724        419 CFCNPGACAKYLGLSHKDLQANFEAGHVCWDDQDVIHGRPTGAVRVSFGYMSTFEDCQKFIDFIISSFVSTPKKRGNV--  496 (805)
T ss_pred             cccCchHHHHHcCCCHHHHHHHhhcCCccCchhheecCcccceEEEEcCccCCHHHHHHHHHHHHHHhhcCCCCCCcc--
Confidence            999999998889999999999999999999999999998889999999999999999999999999999986542210  


Q ss_pred             ccccccccccccccccccCCCCCCccEEeeeeeccccccCceeeccEEEEEecCCCcCcEEEEEeCCCceEEeccccccc
Q psy16512        508 CLINNQRAESSKGFFLNHSDNINKENKLVSIYIYPVKACGFFKVESKWEVTASGLKFDRQWMIITHSGVPLTQKLEKNLC  587 (815)
Q Consensus       508 ~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~l~~yPvKs~~g~~~~~~~~~~~~Gl~~DR~~~~~~~~~~~~t~~~~p~l~  587 (815)
                      .+++...... ++   ..+.+....++|++|||||||||+|++|+ +|++++.||.|||+|||+|++|+++|||++|+|+
T Consensus       497 ~~~~~~~~~~-~~---~~~~~~~~~~~v~~l~iYPVKS~~g~~v~-~a~~~~~Gl~~DR~~~lvd~~g~~~t~r~~p~l~  571 (805)
T PLN02724        497 TLRSKRTIPL-PV---LERKESFDSHRLKSITVYPIKSCAGFSVE-RWPLSETGLLYDREWMIQSLTGEILTQKKVPEMC  571 (805)
T ss_pred             cccCcccccC-CC---ccccccCCCCEEEEEEEeccccCCCceee-EEEEecccccccceEEEEcCCCcEEEcccCceEE
Confidence            1111110000 00   01112237889999999999999999999 9999999999999999999999999999999999


Q ss_pred             cccceeecCCCeEEEEeCCCCeeEEEecCCCC--CceeeeEEeCCceeeeecchhHHHHHHHhcCCCCeEEEEecCCCCC
Q psy16512        588 LVQPNFDITRNIMTLCYKSSGSTVEIGIDNEG--LDLCTSKVCSDKITGFDCGNAVANWLDEQLNRKGLRLIRISKRSSK  665 (815)
Q Consensus       588 ~i~~~~~~~~~~l~l~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~g~~~~~~ls~~lg~~~~~L~~~~~~~~~  665 (815)
                      +|++.++..++.|++++|+++.++.|++++..  .....+++|++++.+++||+++++|||++||+| |+|+++.+...|
T Consensus       572 ~i~~~~~~~~~~l~l~~~~~~~~l~v~l~~~~~~~~~~~v~v~~~~~~~~~~g~~~~~w~S~~lg~~-~~Lv~~~~~~~r  650 (805)
T PLN02724        572 LITTFIDLESGKLVVRAPRCDHKLEIPLESDSQHEESGEVILCGNRAESMSYGTEINEWFTNALGRR-CTLVRKSSSNTR  650 (805)
T ss_pred             EEEeEEecCCCeEEEEcCCCCccEEEeCCCcccccccceeEEeCCcceeEecchhHHHHHHHHhCCc-eEEEEeCCcccc
Confidence            99999987889999999998646999998743  345789999999999999999999999999999 999999775433


Q ss_pred             C---------------cccccccccceeeecHHhHHHHHHHhhhh---cCcccccccccceEEEcCCCCcccCCCcceEE
Q psy16512        666 R---------------NINSFSNMGQYLLITLPSIQAQLENLNAI---FELENFVNRFRSNFVVSGQFEANAENDWDQVL  727 (815)
Q Consensus       666 ~---------------~~~~f~d~~p~~l~s~~Sl~~l~~~l~~~---~~~~~~~~rFRpNivi~~~~~~~~Ed~w~~i~  727 (815)
                      +               ..++|+|.+|++|+|++||++||+++++.   ...+++++||||||||+|. +||+||.|++|+
T Consensus       651 ~~~~~~~~~~~~~~~~~~~~faD~~p~llis~aSl~~Ln~~l~~~~~~~~~~v~~~RFRpNiVv~g~-~~f~ED~W~~l~  729 (805)
T PLN02724        651 VCRNRNPSHSPCGDDESRLSFANEGQFLLISEASVEDLNRRLATGQEDAKIRLDPTRFRPNLVVSGG-EAYAEDEWQSLS  729 (805)
T ss_pred             cccccccccccccCcCCceeecCCCceEEecHHHHHHHHHHhccccccccCCCcHHHccceEEECCC-CCccccCceEEE
Confidence            1               24789999999999999999999999742   1236899999999999999 999999999999


Q ss_pred             EecCCCCeEEEecccCCCccccccCccCCCC--CCChhHHHHhccccccccCccccccccccc----ccceeeeeeeec
Q psy16512        728 IETNDGLLSFQVTSQCTRCQYIYIDQETALN--TDVPLGEYQTRNFSTVSLNVKEFFNNLEKT----YNQYNFCSSMIL  800 (815)
Q Consensus       728 Ig~~~~~~~~~~~~~~~RC~~~~vd~~tg~~--~~~~l~~l~~~r~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~  800 (815)
                      ||    +++|++++||.||+||||||+||++  +.|||+||++||+.    +++++||++...    .+.+++.++..+
T Consensus       730 IG----~~~~~~~~~C~RC~~~tvDp~tg~~~~~~epl~tL~~~R~~----~~~~~FG~~~~~~~~~~~~~~i~vGd~v  800 (805)
T PLN02724        730 IG----DAEFTVLGGCNRCQMINIDQETGLVNPSNEPLATLASYRRV----KGKILFGILLRYEISDKRDQWIAVGSRV  800 (805)
T ss_pred             EC----CEEEEEecccCCCCCCcCCcccCccCCCCChHHHHHHHhCc----CCCCCccceeeccccCCCCcEEEeCCEE
Confidence            99    9999999999999999999999986  46999999999985    567888887633    455567777655



>COG3217 Uncharacterized Fe-S protein [General function prediction only] Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2362|consensus Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>KOG1549|consensus Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>KOG2142|consensus Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>PF03476 MOSC_N: MOSC N-terminal beta barrel domain; InterPro: IPR005303 This domain is found to the N terminus of MOSC domain (IPR005302 from INTERPRO) Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>COG3844 Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>KOG2862|consensus Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>PLN02452 phosphoserine transaminase Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK06425 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK06460 hypothetical protein; Provisional Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>PRK14808 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PRK07049 methionine gamma-lyase; Validated Back     alignment and domain information
>PRK07392 threonine-phosphate decarboxylase; Validated Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>PRK12462 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK07269 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>KOG0257|consensus Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>PRK06959 putative threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK05967 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK05664 threonine-phosphate decarboxylase; Reviewed Back     alignment and domain information
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>PRK08354 putative aminotransferase; Provisional Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PLN02955 8-amino-7-oxononanoate synthase Back     alignment and domain information
>COG0626 MetC Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06434 cystathionine gamma-lyase; Validated Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>KOG3846|consensus Back     alignment and domain information
>PF03473 MOSC: MOSC domain; InterPro: IPR005302 Molybdenum cofactor (MOCO) sulphurases [] catalyse the insertion of a terminal sulphur ligand into the molybdenum cofactor, thereby converting the oxo form of MOCO to a sulphurylated form Back     alignment and domain information
>COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK09275 aspartate aminotransferase; Provisional Back     alignment and domain information
>KOG1368|consensus Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>TIGR03801 asp_4_decarbox aspartate 4-decarboxylase Back     alignment and domain information
>COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only] Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>KOG1359|consensus Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>PRK04311 selenocysteine synthase; Provisional Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>PTZ00376 aspartate aminotransferase; Provisional Back     alignment and domain information
>KOG0259|consensus Back     alignment and domain information
>TIGR00474 selA seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>PRK09257 aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>PLN02368 alanine transaminase Back     alignment and domain information
>KOG0053|consensus Back     alignment and domain information
>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK08637 hypothetical protein; Provisional Back     alignment and domain information
>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1932 SerC Phosphoserine aminotransferase [Coenzyme metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PLN02397 aspartate transaminase Back     alignment and domain information
>PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) [] Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>KOG0256|consensus Back     alignment and domain information
>TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>PRK13578 ornithine decarboxylase; Provisional Back     alignment and domain information
>KOG1360|consensus Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PLN02624 ornithine-delta-aminotransferase Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>KOG0633|consensus Back     alignment and domain information
>KOG3258|consensus Back     alignment and domain information
>PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>KOG1357|consensus Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>PRK03715 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>TIGR02618 tyr_phenol_ly tyrosine phenol-lyase Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>COG3977 Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13237 tyrosine phenol-lyase; Provisional Back     alignment and domain information
>KOG0634|consensus Back     alignment and domain information
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>PLN00144 acetylornithine transaminase Back     alignment and domain information
>COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>TIGR03372 putres_am_tran putrescine aminotransferase Back     alignment and domain information
>PRK08117 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK08360 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>KOG1383|consensus Back     alignment and domain information
>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases Back     alignment and domain information
>TIGR00700 GABAtrnsam 4-aminobutyrate aminotransferase, prokaryotic type Back     alignment and domain information
>TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>PRK13360 omega amino acid--pyruvate transaminase; Provisional Back     alignment and domain information
>COG0160 GabT 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02760 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>PRK05630 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>COG1982 LdcC Arginine/lysine/ornithine decarboxylases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09792 4-aminobutyrate transaminase; Provisional Back     alignment and domain information
>PRK06777 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK08593 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06058 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK09221 beta alanine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK06541 hypothetical protein; Provisional Back     alignment and domain information
>PRK08088 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information
>PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07495 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK05769 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK04612 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK06918 4-aminobutyrate aminotransferase; Reviewed Back     alignment and domain information
>PRK07986 adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated Back     alignment and domain information
>PRK06062 hypothetical protein; Provisional Back     alignment and domain information
>PRK12403 putative aminotransferase; Provisional Back     alignment and domain information
>PRK06105 aminotransferase; Provisional Back     alignment and domain information
>PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK00615 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK05639 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>TIGR00508 bioA adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>PF12897 Aminotran_MocR: Alanine-glyoxylate amino-transferase; InterPro: IPR024551 This entry represents a family of putative aminotransferases Back     alignment and domain information
>PRK07678 aminotransferase; Validated Back     alignment and domain information
>PRK06943 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03251 LAT_fam L-lysine 6-transaminase Back     alignment and domain information
>PRK07482 hypothetical protein; Provisional Back     alignment and domain information
>COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00709 dat 2,4-diaminobutyrate 4-transaminases Back     alignment and domain information
>PRK06082 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>COG0161 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK05965 hypothetical protein; Provisional Back     alignment and domain information
>PRK07480 putative aminotransferase; Validated Back     alignment and domain information
>PRK07481 hypothetical protein; Provisional Back     alignment and domain information
>COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK04013 argD acetylornithine/acetyl-lysine aminotransferase; Provisional Back     alignment and domain information
>KOG2467|consensus Back     alignment and domain information
>PF02347 GDC-P: Glycine cleavage system P-protein; InterPro: IPR020580 This family consists of glycine cleavage system P-proteins (1 Back     alignment and domain information
>PRK07036 hypothetical protein; Provisional Back     alignment and domain information
>PF04864 Alliinase_C: Allinase; InterPro: IPR006948 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species Back     alignment and domain information
>PRK08297 L-lysine aminotransferase; Provisional Back     alignment and domain information
>PRK12389 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>COG1921 SelA Selenocysteine synthase [seryl-tRNASer selenium transferase] [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06916 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PLN02482 glutamate-1-semialdehyde 2,1-aminomutase Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00699 GABAtrns_euk 4-aminobutyrate aminotransferase, eukaryotic type Back     alignment and domain information
>PRK07483 hypothetical protein; Provisional Back     alignment and domain information
>PRK08742 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06917 hypothetical protein; Provisional Back     alignment and domain information
>PF03841 SelA: L-seryl-tRNA selenium transferase; InterPro: IPR018319 In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor Back     alignment and domain information
>TIGR02617 tnaA_trp_ase tryptophanase, leader peptide-associated Back     alignment and domain information
>KOG0258|consensus Back     alignment and domain information
>KOG2790|consensus Back     alignment and domain information
>PRK07046 aminotransferase; Validated Back     alignment and domain information
>KOG1402|consensus Back     alignment and domain information
>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0403 GcvP Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06938 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK06931 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>KOG1358|consensus Back     alignment and domain information
>PRK15441 peptidyl-prolyl cis-trans isomerase C; Provisional Back     alignment and domain information
>KOG0629|consensus Back     alignment and domain information
>PF13616 Rotamase_3: PPIC-type PPIASE domain; PDB: 3RFW_A 3UI5_A 3UI4_A 1FJD_A 1EQ3_A 1ZK6_A Back     alignment and domain information
>PF00639 Rotamase: PPIC-type PPIASE domain; InterPro: IPR000297 Peptidylprolyl isomerase (5 Back     alignment and domain information
>KOG0628|consensus Back     alignment and domain information
>KOG1404|consensus Back     alignment and domain information
>PF06838 Met_gamma_lyase: Methionine gamma-lyase ; InterPro: IPR009651 This family represents the aluminium resistance protein, which confers resistance to aluminium in bacteria [] Back     alignment and domain information
>PF00202 Aminotran_3: Aminotransferase class-III; InterPro: IPR005814 Aminotransferases share certain mechanistic features with other pyridoxalphosphate-dependent enzymes, such as the covalent binding of the pyridoxalphosphate group to a lysine residue Back     alignment and domain information
>PRK06209 glutamate-1-semialdehyde 2,1-aminomutase; Provisional Back     alignment and domain information
>TIGR02933 nifM_nitrog nitrogen fixation protein NifM Back     alignment and domain information
>PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>PTZ00356 peptidyl-prolyl cis-trans isomerase (PPIase); Provisional Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>KOG2040|consensus Back     alignment and domain information
>PRK12450 foldase protein PrsA; Reviewed Back     alignment and domain information
>PRK01326 prsA foldase protein PrsA; Reviewed Back     alignment and domain information
>PRK04405 prsA peptidylprolyl isomerase; Provisional Back     alignment and domain information
>PRK02998 prsA peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>PRK03002 prsA peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>PRK10770 peptidyl-prolyl cis-trans isomerase SurA; Provisional Back     alignment and domain information
>PRK10770 peptidyl-prolyl cis-trans isomerase SurA; Provisional Back     alignment and domain information
>PF05889 SLA_LP_auto_ag: Soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen); InterPro: IPR008829 This family consists of several eukaryotic and archaeal proteins which are related to the Homo sapiens soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen) Back     alignment and domain information
>PRK03095 prsA peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>COG3033 TnaA Tryptophanase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1403|consensus Back     alignment and domain information
>PRK10788 periplasmic folding chaperone; Provisional Back     alignment and domain information
>COG4100 Cystathionine beta-lyase family protein involved in aluminum resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK00059 prsA peptidylprolyl isomerase; Provisional Back     alignment and domain information
>KOG1401|consensus Back     alignment and domain information
>COG0760 SurA Parvulin-like peptidyl-prolyl isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1412|consensus Back     alignment and domain information
>KOG2040|consensus Back     alignment and domain information
>KOG1405|consensus Back     alignment and domain information
>KOG2142|consensus Back     alignment and domain information
>PRK14499 molybdenum cofactor biosynthesis protein MoaC/MOSC-domain-containing protein; Provisional Back     alignment and domain information
>KOG1411|consensus Back     alignment and domain information
>PF13145 Rotamase_2: PPIC-type PPIASE domain; PDB: 3NRK_A 2KGJ_A Back     alignment and domain information
>PLN02994 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>KOG3843|consensus Back     alignment and domain information
>PRK11536 6-N-hydroxylaminopurine resistance protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query815
1fjd_A104 Human Parvulin-Like Peptidyl Prolyl CisTRANS ISOMER 5e-19
3ui4_A101 0.8 A Resolution Crystal Structure Of Human Parvuli 5e-19
1eq3_A96 Nmr Structure Of Human Parvulin Hpar14 Length = 96 5e-19
1elq_A390 Crystal Structure Of The Cystine C-S Lyase C-Des Le 2e-06
1p3w_B404 X-Ray Crystal Structure Of E. Coli Iscs Length = 40 5e-06
3lvj_A423 Crystal Structure Of E.Coli Iscs-Tusa Complex (Form 6e-06
1n2t_A386 C-Des Mutant K223a With Gly Covalenty Linked To The 7e-06
2rqs_A97 3d Structure Of Pin From The Psychrophilic Archeon 3e-05
3rfw_A252 The Virulence Factor Peb4 And The Periplasmic Prote 3e-05
1zk6_A93 Nmr Solution Structure Of B. Subtilis Prsa Ppiase L 7e-04
>pdb|1FJD|A Chain A, Human Parvulin-Like Peptidyl Prolyl CisTRANS ISOMERASE, Hpar14 Length = 104 Back     alignment and structure

Iteration: 1

Score = 93.2 bits (230), Expect = 5e-19, Method: Composition-based stats. Identities = 37/51 (72%), Positives = 46/51 (90%) Query: 6 GDLGWVVRGSMVGEFQDAAFKLPISTVNNPVYTEPPIKTKFGYHIIMVEGK 56 GDLGW+ RGSMVG FQ+AAF LP+S ++ PV+T+PP+KTKFGYHIIMVEG+ Sbjct: 53 GDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGR 103
>pdb|3UI4|A Chain A, 0.8 A Resolution Crystal Structure Of Human Parvulin 14 Length = 101 Back     alignment and structure
>pdb|1EQ3|A Chain A, Nmr Structure Of Human Parvulin Hpar14 Length = 96 Back     alignment and structure
>pdb|1ELQ|A Chain A, Crystal Structure Of The Cystine C-S Lyase C-Des Length = 390 Back     alignment and structure
>pdb|1P3W|B Chain B, X-Ray Crystal Structure Of E. Coli Iscs Length = 404 Back     alignment and structure
>pdb|3LVJ|A Chain A, Crystal Structure Of E.Coli Iscs-Tusa Complex (Form 1) Length = 423 Back     alignment and structure
>pdb|1N2T|A Chain A, C-Des Mutant K223a With Gly Covalenty Linked To The Plp-Cofactor Length = 386 Back     alignment and structure
>pdb|2RQS|A Chain A, 3d Structure Of Pin From The Psychrophilic Archeon Cenarcheaum Symbiosum (Cspin) Length = 97 Back     alignment and structure
>pdb|3RFW|A Chain A, The Virulence Factor Peb4 And The Periplasmic Protein Cj1289 Are Two Structurally-Related Sura-Like Chaperones In The Human Pathogen Campylobacter Jejuni Length = 252 Back     alignment and structure
>pdb|1ZK6|A Chain A, Nmr Solution Structure Of B. Subtilis Prsa Ppiase Length = 93 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query815
3ui4_A101 Peptidyl-prolyl CIS-trans isomerase NIMA-interact; 4e-24
2exn_A136 Hypothetical protein BOR11; beta barrel containing 2e-23
1jns_A92 Peptidyl-prolyl CIS-trans isomerase C; alpha-beta 9e-18
2rqs_A97 Parvulin-like peptidyl-prolyl isomerase; CIS/trans 6e-17
1zk6_A93 Foldase protein PRSA; alpha/beta structure, isomer 2e-15
2jzv_A111 Foldase protein PRSA; ppiase, parvulin, proline is 4e-15
4g2p_A110 Chaperone SURA; structural genomics, PSI-biology, 4e-15
3rfw_A252 Cell-binding factor 2; SURA-like, chaperone; 2.20A 1e-14
3i6c_A123 Peptidyl-prolyl CIS-trans isomerase NIMA- interact 2e-14
1yw5_A177 Peptidyl prolyl CIS/trans isomerase; WW-domain, pp 2e-14
1j6y_A139 Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN 2e-14
3gpk_A112 PPIC-type peptidyl-prolyl CIS-trans isomerase; rot 3e-14
2kgj_A102 Peptidyl-prolyl CIS-trans isomerase D; prolyl isom 4e-14
3tc5_A166 Peptidyl-prolyl CIS-trans isomerase NIMA-interact; 5e-14
2pv1_A103 Chaperone SURA; surviVal protein A, peptidyl-proly 3e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-06
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 2e-11
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 3e-08
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 9e-08
3nrk_A325 LIC12922; NC domain, parvulin domain, SURA homolog 1e-07
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 2e-07
1m5y_A408 SurviVal protein, surviVal protein SURA; surviVal 2e-07
1m5y_A408 SurviVal protein, surviVal protein SURA; surviVal 2e-06
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 6e-05
3rgc_A252 Possible periplasmic protein; ppiase, chaperone; 2 8e-05
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 2e-04
>3ui4_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; peptidyl-prolyl-isomerase; 0.80A {Homo sapiens} PDB: 3ui5_A 1fjd_A 1eq3_A Length = 101 Back     alignment and structure
 Score = 96.6 bits (241), Expect = 4e-24
 Identities = 37/51 (72%), Positives = 46/51 (90%)

Query: 6   GDLGWVVRGSMVGEFQDAAFKLPISTVNNPVYTEPPIKTKFGYHIIMVEGK 56
           GDLGW+ RGSMVG FQ+AAF LP+S ++ PV+T+PP+KTKFGYHIIMVEG+
Sbjct: 50  GDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGR 100


>2exn_A Hypothetical protein BOR11; beta barrel containing fold, autostructure, autoassign, structure, structural genomics, PSI; NMR {Bordetella bronchiseptica} SCOP: b.165.1.1 Length = 136 Back     alignment and structure
>1jns_A Peptidyl-prolyl CIS-trans isomerase C; alpha-beta sandwich, CIS peptide bond; NMR {Escherichia coli} SCOP: d.26.1.1 PDB: 1jnt_A Length = 92 Back     alignment and structure
>2rqs_A Parvulin-like peptidyl-prolyl isomerase; CIS/trans isomerisation, cenarcheaum symbiosum, low temperat NIMA-kinase, PIN1, cell cycle; NMR {Cenarchaeum symbiosum} Length = 97 Back     alignment and structure
>1zk6_A Foldase protein PRSA; alpha/beta structure, isomerase; NMR {Bacillus subtilis} Length = 93 Back     alignment and structure
>2jzv_A Foldase protein PRSA; ppiase, parvulin, proline isomerase, lipoprotein, membrane, palmitate, rotamase; NMR {Staphylococcus aureus} Length = 111 Back     alignment and structure
>4g2p_A Chaperone SURA; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, pcsep; 1.82A {Salmonella enterica subsp} Length = 110 Back     alignment and structure
>3rfw_A Cell-binding factor 2; SURA-like, chaperone; 2.20A {Campylobacter jejuni} Length = 252 Back     alignment and structure
>3i6c_A Peptidyl-prolyl CIS-trans isomerase NIMA- interacting 1; SBDD, small molecule, ppiase, cell cycle, nucleus, phosphoprotein, rotamase; HET: GIA; 1.30A {Homo sapiens} PDB: 3ik8_A 3ikd_A* 3ikg_A* 3jyj_A* 3kac_A* 1nmw_A Length = 123 Back     alignment and structure
>1yw5_A Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} Length = 177 Back     alignment and structure
>1j6y_A Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN1, phosphorylation; NMR {Arabidopsis thaliana} SCOP: d.26.1.1 Length = 139 Back     alignment and structure
>3gpk_A PPIC-type peptidyl-prolyl CIS-trans isomerase; rotamase,ppiase domain, 11189O3,PSI2., structural genomics; 1.55A {Novosphingobium aromaticivorans} Length = 112 Back     alignment and structure
>2kgj_A Peptidyl-prolyl CIS-trans isomerase D; prolyl isomerase, parvulin, cell inner membrane, cell membrane, membrane, rotamase, stress response; NMR {Escherichia coli} Length = 102 Back     alignment and structure
>3tc5_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; PIN1 mutant (R14A), oncogenic transformation, small molecule cycle, rotamase, phosphoprotein; HET: 3T5 P6G; 1.40A {Homo sapiens} PDB: 2itk_A* 2q5a_A* 2xp3_A* 2xp4_A* 2xp5_A* 2xp7_A* 2xp8_A* 2xp9_A* 2xpa_A* 2xpb_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 3ntp_A* 3odk_A* 3oob_A* 2zr6_A* 1f8a_B* ... Length = 166 Back     alignment and structure
>2pv1_A Chaperone SURA; surviVal protein A, peptidyl-prolyl CIS-trans isomerase domain, peptide, complex; 1.30A {Escherichia coli} SCOP: d.26.1.1 PDB: 2pv2_A Length = 103 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Length = 390 Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Length = 416 Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Length = 371 Back     alignment and structure
>3nrk_A LIC12922; NC domain, parvulin domain, SURA homology, probable chaperon unknown function; 3.10A {Leptospira interrogans serovar copenhaorganism_taxid} Length = 325 Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Length = 465 Back     alignment and structure
>1m5y_A SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} SCOP: a.223.1.2 d.26.1.1 d.26.1.1 PDB: 2pv3_A Length = 408 Back     alignment and structure
>1m5y_A SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} SCOP: a.223.1.2 d.26.1.1 d.26.1.1 PDB: 2pv3_A Length = 408 Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Length = 420 Back     alignment and structure
>3rgc_A Possible periplasmic protein; ppiase, chaperone; 2.30A {Campylobacter jejuni} Length = 252 Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Length = 406 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query815
4hvk_A382 Probable cysteine desulfurase 2; transferase and I 100.0
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 100.0
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 100.0
3qm2_A386 Phosphoserine aminotransferase; structural genomic 100.0
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 100.0
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 100.0
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 100.0
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 100.0
3vax_A400 Putative uncharacterized protein DNDA; desulfurase 99.98
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 99.98
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 99.97
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 99.97
3a9z_A432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 99.97
3m5u_A361 Phosphoserine aminotransferase; alpha-beta half sa 99.97
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 99.97
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 99.97
1iug_A352 Putative aspartate aminotransferase; wild type, py 99.97
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 99.97
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 99.96
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 99.96
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 99.96
2yrr_A353 Aminotransferase, class V; structural genomics, NP 99.96
2exn_A136 Hypothetical protein BOR11; beta barrel containing 99.96
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 99.96
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 99.96
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 99.95
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 99.95
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 99.95
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 99.95
3f0h_A376 Aminotransferase; RER070207000802, structural geno 99.95
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 99.95
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 99.95
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 99.95
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 99.94
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 99.94
3ke3_A379 Putative serine-pyruvate aminotransferase; structu 99.94
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 99.94
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 99.94
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 99.94
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 99.94
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 99.94
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 99.93
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 99.93
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 99.93
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 99.93
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 99.93
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 99.93
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.93
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 99.93
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 99.93
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 99.93
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 99.92
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 99.92
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 99.92
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 99.92
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 99.92
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 99.92
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 99.92
1pff_A331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 99.92
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 99.92
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 99.92
2z61_A370 Probable aspartate aminotransferase 2; amino acid 99.92
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 99.92
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.92
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 99.92
3ftb_A361 Histidinol-phosphate aminotransferase; structural 99.92
1rv3_A483 Serine hydroxymethyltransferase, cytosolic; one-ca 99.92
2fq6_A415 Cystathionine beta-lyase; protein-inhibitor comple 99.92
1qgn_A445 Protein (cystathionine gamma-synthase); methionine 99.91
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 99.91
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 99.91
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 99.91
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.91
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 99.91
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 99.91
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 99.91
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 99.91
3l8a_A421 METC, putative aminotransferase, probable beta-cys 99.91
2o0r_A411 RV0858C (N-succinyldiaminopimelate aminotransfera; 99.91
1gc0_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 99.91
2fnu_A375 Aminotransferase; protein-product complex, structu 99.91
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 99.91
1xi9_A406 Putative transaminase; alanine aminotransferase, s 99.91
3cog_A403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 99.91
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 99.91
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 99.91
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 99.91
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 99.91
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 99.91
3nra_A407 Aspartate aminotransferase; structural genomics, j 99.91
2rfv_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 99.91
2cb1_A412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 99.9
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 99.9
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 99.9
1vp4_A425 Aminotransferase, putative; structural genomics, j 99.9
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 99.9
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 99.9
3ele_A398 Amino transferase; RER070207001803, structural gen 99.9
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 99.9
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 99.9
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 99.9
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 99.9
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 99.9
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 99.9
1svv_A359 Threonine aldolase; structural genomics, structura 99.9
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 99.9
1n8p_A393 Cystathionine gamma-lyase; three open alpha/beta s 99.9
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 99.9
3vp6_A511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 99.9
3aow_A448 Putative uncharacterized protein PH0207; protein-P 99.9
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 99.9
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 99.9
1cs1_A386 CGS, protein (cystathionine gamma-synthase); lyase 99.89
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 99.89
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 99.89
2x3l_A446 ORN/Lys/Arg decarboxylase family protein; lyase; H 99.89
3frk_A373 QDTB; aminotransferase, sugar-modification, natura 99.89
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 99.89
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 99.89
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 99.89
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 99.89
1jg8_A347 L-ALLO-threonine aldolase; glycine biosynthesis, p 99.89
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 99.89
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 99.89
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 99.89
3qhx_A392 Cystathionine gamma-synthase METB (CGS); structura 99.89
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 99.89
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 99.89
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 99.88
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 99.88
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 99.88
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 99.88
3uwc_A374 Nucleotide-sugar aminotransferase; lipopolysacchar 99.88
3acz_A389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 99.88
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 99.88
3ndn_A414 O-succinylhomoserine sulfhydrylase; seattle struct 99.88
1e5e_A404 MGL, methionine gamma-lyase; methionine biosynthes 99.88
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 99.88
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 99.88
1c4k_A730 Protein (ornithine decarboxylase); lyase; HET: PLP 99.87
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 99.87
3ruy_A392 Ornithine aminotransferase; structural genomics, c 99.87
1ibj_A464 CBL, cystathionine beta-lyase; PLP-dependent enzym 99.87
1wyu_B474 Glycine dehydrogenase subunit 2 (P-protein); alpha 99.87
2ctz_A421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 99.87
1b9h_A388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 99.87
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 99.87
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 99.87
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 99.87
3b8x_A390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 99.87
1mdo_A393 ARNB aminotransferase; type 1 aminotransferase fol 99.87
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 99.87
2a7v_A490 Serine hydroxymethyltransferase; structural genomi 99.87
3dr4_A391 Putative perosamine synthetase; deoxysugar, pyrido 99.86
3nyt_A367 Aminotransferase WBPE; PLP binding, nucleotide-sug 99.86
2oga_A399 Transaminase; PLP-dependent enzyme, desosamine, de 99.86
1o69_A394 Aminotransferase; structural genomics, unknown fun 99.86
3ri6_A430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 99.86
2c81_A418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 99.86
3rq1_A418 Aminotransferase class I and II; structural genomi 99.86
3n0l_A417 Serine hydroxymethyltransferase; alpha beta class, 99.86
3gbx_A420 Serine hydroxymethyltransferase; structural genomi 99.85
2vyc_A755 Biodegradative arginine decarboxylase; pyridoxal p 99.85
3ihj_A498 Alanine aminotransferase 2; helix, structural geno 99.85
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.85
3bb8_A437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 99.84
3f6t_A533 Aspartate aminotransferase; YP_194538.1, STRU geno 99.84
3bwn_A391 AT1G70560, L-tryptophan aminotransferase; auxin sy 99.84
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 99.84
2po3_A424 4-dehydrase; external aldimine, PLP, aminotransfer 99.83
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 99.83
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 99.83
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 99.83
3nmy_A400 Xometc, cystathionine gamma-lyase-like protein; Cy 99.83
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 99.83
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 99.83
3ecd_A425 Serine hydroxymethyltransferase 2; ssgcid, decode, 99.82
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 99.71
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 99.82
4adb_A406 Succinylornithine transaminase; transferase, PLP e 99.82
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 99.82
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 99.82
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 99.82
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 99.81
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 99.81
3nx3_A395 Acoat, acetylornithine aminotransferase; csgid, st 99.81
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 99.81
3ju7_A377 Putative PLP-dependent aminotransferase; NP_978343 99.81
2oqx_A467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 99.81
3h7f_A447 Serine hydroxymethyltransferase 1; cytoplasm, one- 99.81
3pj0_A359 LMO0305 protein; structural genomics, joint center 99.8
2aeu_A374 Hypothetical protein MJ0158; selenocysteine syntha 99.8
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 99.8
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 99.79
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 99.79
3i4j_A430 Aminotransferase, class III; structural GENOMICS,N 99.79
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 99.79
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 99.79
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 99.79
2zy4_A546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 99.78
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 99.78
1z7d_A433 Ornithine aminotransferase; structural genomics co 99.78
3n75_A715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 99.77
1zod_A433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 99.76
3tfu_A457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.76
2cjg_A449 L-lysine-epsilon aminotransferase; internal aldimi 99.75
3jzl_A409 Putative cystathionine beta-lyase involved in ALU 99.75
3n5m_A452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.75
3l44_A434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 99.74
3i16_A427 Aluminum resistance protein; YP_878183.1, carbon-s 99.74
3gju_A460 Putative aminotransferase; pyridoxal phosphate, PL 99.74
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 99.73
4a6r_A459 Omega transaminase; transferase, PLP-binding enzym 99.72
3dod_A448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.72
3i5t_A476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 99.71
3fq8_A427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 99.71
3hvy_A427 Cystathionine beta-lyase family protein, YNBB B.S 99.71
3hmu_A472 Aminotransferase, class III; structural genomics, 99.71
3oks_A451 4-aminobutyrate transaminase; ssgcid, transferase, 99.71
4e77_A429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 99.7
4ffc_A453 4-aminobutyrate aminotransferase (GABT); structura 99.7
3k28_A429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 99.67
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 99.67
3ht4_A431 Aluminum resistance protein; lyase, putative cysta 99.67
2epj_A434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.67
1ohv_A472 4-aminobutyrate aminotransferase; PLP-dependent en 99.67
2e7u_A424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.66
2cy8_A453 D-phgat, D-phenylglycine aminotransferase; structu 99.66
4h51_A420 Aspartate aminotransferase; ssgcid, structural gen 99.64
3bc8_A450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 99.58
3ou5_A490 Serine hydroxymethyltransferase, mitochondrial; st 99.55
3hl2_A501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.49
2yky_A465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 99.04
1oru_A195 YUAD protein; structural genomics, cytosolic hypot 99.34
4atq_A456 4-aminobutyrate transaminase; transferase; HET: PL 99.34
4ao9_A454 Beta-phenylalanine aminotransferase; HET: PLP; 1.5 99.31
2lj4_A115 Peptidyl-prolyl CIS-trans isomerase/rotamase, PUT; 99.28
3ui4_A101 Peptidyl-prolyl CIS-trans isomerase NIMA-interact; 99.28
4e3q_A473 Pyruvate transaminase; aminotransferase, transfera 99.17
3i6c_A123 Peptidyl-prolyl CIS-trans isomerase NIMA- interact 99.12
4g2p_A110 Chaperone SURA; structural genomics, PSI-biology, 99.12
1jns_A92 Peptidyl-prolyl CIS-trans isomerase C; alpha-beta 99.1
3gpk_A112 PPIC-type peptidyl-prolyl CIS-trans isomerase; rot 99.09
2rqs_A97 Parvulin-like peptidyl-prolyl isomerase; CIS/trans 99.05
1zk6_A93 Foldase protein PRSA; alpha/beta structure, isomer 99.01
2kgj_A102 Peptidyl-prolyl CIS-trans isomerase D; prolyl isom 99.0
2pv1_A103 Chaperone SURA; surviVal protein A, peptidyl-proly 99.0
2jzv_A111 Foldase protein PRSA; ppiase, parvulin, proline is 98.98
1j6y_A139 Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN 98.95
4a0g_A831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 98.88
3rfw_A252 Cell-binding factor 2; SURA-like, chaperone; 2.20A 98.62
3rgc_A252 Possible periplasmic protein; ppiase, chaperone; 2 98.44
3nrk_A325 LIC12922; NC domain, parvulin domain, SURA homolog 98.31
1m5y_A408 SurviVal protein, surviVal protein SURA; surviVal 98.07
1m5y_A408 SurviVal protein, surviVal protein SURA; surviVal 97.95
1o65_A246 Hypothetical protein YIIM; structural genomics, un 97.78
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
Probab=100.00  E-value=8.5e-34  Score=313.95  Aligned_cols=358  Identities=19%  Similarity=0.259  Sum_probs=275.4

Q ss_pred             hhhhhhhcccccchhhHHHHHHHHhhccccCCCChhhhhhhhhhhHHHHHHHHHhHcCCCCCceeEEecCCchhhHHHHH
Q psy16512         62 ICYLDYTGAGVYSQSQMNQTIEQLKENIFSHPHGNSVLSDFCVSEIDQMRTKILQYFNTDSDHYSVIFTSGATSAIKTVS  141 (815)
Q Consensus        62 ~iyLd~a~~~~~p~~v~~al~~~l~~~~~~np~s~~~~~~~~~~~~~~~r~~la~~~g~~~~~~~iv~t~g~t~al~~~~  141 (815)
                      ++|||+++.+++++.+.+++.+.+.. .+.||+..+.........++++++++++++|+++++  +++|+|+++|+.+++
T Consensus         1 ~iyld~~~~~~~~~~v~~a~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~la~~~~~~~~~--i~~~~g~~~a~~~~~   77 (382)
T 4hvk_A            1 MAYFDYTSAKPVDERILEAMLPYMTE-SFGNPSSVHSYGFKAREAVQEAREKVAKLVNGGGGT--VVFTSGATEANNLAI   77 (382)
T ss_dssp             -CBCBTTTCCCCCHHHHHHHHHHHHT-SCCCTTCSSHHHHHHHHHHHHHHHHHHHHTTCTTEE--EEEESSHHHHHHHHH
T ss_pred             CEeecCCCcCCCCHHHHHHHHHHHHh-hcCCCcccchHHHHHHHHHHHHHHHHHHHcCCCcCe--EEEECCchHHHHHHH
Confidence            37999999999999999999887754 466776653333333344889999999999998766  999999999999999


Q ss_pred             hhhcc---CCCc-EEEecCCCcchhhHHHHhhccc----eEEcCchhhhcchhhhhhhhhhhhhcCCCccEEEEecccCC
Q psy16512        142 EYFEF---NEGS-FIYLTDNHTSVLGMRELVKTNQ----IYSFSVDDARNMLNEFKESQENVENMRHSNSLFVYPAESNF  213 (815)
Q Consensus       142 ~al~~---~~gd-vv~~~~~h~s~~~~~~~~~~~g----~v~~~~~~~~~~~~~~~~l~~~~~~~~~~t~lv~i~~~~n~  213 (815)
                      .++.+   ++|| |+++..+|+++......++..|    .++++.++.++++++++++       .+++++|++++++||
T Consensus        78 ~~~~~~~~~~gd~vi~~~~~~~~~~~~~~~~~~~g~~~~~v~~~~~~~~d~~~l~~~i-------~~~~~~v~~~~~~np  150 (382)
T 4hvk_A           78 IGYAMRNARKGKHILVSAVEHMSVINPAKFLQKQGFEVEYIPVGKYGEVDVSFIDQKL-------RDDTILVSVQHANNE  150 (382)
T ss_dssp             HHHHHHHGGGCCEEEEETTCCHHHHHHHHHHHHTTCEEEEECBCTTSCBCHHHHHHHC-------CTTEEEEECCSBCTT
T ss_pred             HHhhhhhcCCCCEEEECCCCcHHHHHHHHHHHhcCCEEEEeccCCCCCcCHHHHHHHh-------ccCceEEEEECCCCC
Confidence            98864   7888 8899999999887666665556    4556655666777776644       467999999999999


Q ss_pred             CccccChHHHHHHhhccccccccccCCCCeEEEEecccccCCCCCCCCCCCCcEEEEccccccccCCcceEEEEeccccc
Q psy16512        214 SGTKYPLSWCNTVHRNHVFKKHFKCSRSNCFVLLDAATYCGSNMLDLKQHQPDFISISFYKMFGYPTGLGALIVKQKSAH  293 (815)
Q Consensus       214 tG~~~~l~~I~~l~~~~~~~~~~~~~~~gi~vivD~a~~~g~~~~dl~~~~~D~vv~S~~K~~g~p~G~G~l~~~~~~~~  293 (815)
                      ||.+.|+++|.++|+           ++|+ +|+|++|+.+..++++...++|++++|+||++| |.|+|+++++++.  
T Consensus       151 tG~~~~~~~i~~l~~-----------~~~~-li~D~a~~~~~~~~~~~~~~~d~~~~s~~K~~g-~~g~g~~~~~~~~--  215 (382)
T 4hvk_A          151 IGTIQPVEEISEVLA-----------GKAA-LHIDATASVGQIEVDVEKIGADMLTISSNDIYG-PKGVGALWIRKEA--  215 (382)
T ss_dssp             TCBBCCHHHHHHHHS-----------SSSE-EEEECTTTBTTBCCCHHHHTCSEEEEESGGGTS-CTTCEEEEEETTC--
T ss_pred             ceeeCCHHHHHHHHH-----------HcCE-EEEEhHHhcCCCCCCchhcCCCEEEEeHHHhcC-CCceEEEEEcCcc--
Confidence            999999999999999           8999 999999999988777766789999999999887 8899999999876  


Q ss_pred             ccCcccccCceEEEEecCCcccccccCccccccCCCCChhHHHHHHHHHHHHHhhhhhH-HHHHHHHHHHHHHHHhcccc
Q psy16512        294 VLNKTFYGGGTVKISMANENFHIKKDGLFEKFEDGTVNYLAIISLKYGFDTMEKKRKSF-TNAFELSQYTYFYFKQLSYS  372 (815)
Q Consensus       294 ~l~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~gt~~~~~~~al~~al~~l~~~~~~~-~~~~~l~~~l~~~L~~l~~~  372 (815)
                      .+.+.+.++..                 ..++..++++...+.++.++++.+......+ ++..++++++.+.|+++   
T Consensus       216 ~~~~~~~~~~~-----------------~~~~~~~~~~~~~~~~~~~al~~~~~~~~~~~~~~~~~~~~l~~~L~~~---  275 (382)
T 4hvk_A          216 KLQPVILGGGQ-----------------ENGLRSGSENVPSIVGFGKAAEITAMEWREEAERLRRLRDRIIDNVLKI---  275 (382)
T ss_dssp             CCCCSSCSSCT-----------------GGGTSCSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTS---
T ss_pred             CcCcccccCCC-----------------cCccccCCcCHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHhcC---
Confidence            35454443322                 2456788999999999988888765432333 88999999999999988   


Q ss_pred             CCCCcEEEcCCCCCCCCCcccceEEEEEecCCCCccCHHHHHHhhhcCCcEeccCccCCchhh-----hhhcCCCHHHHH
Q psy16512        373 NGQPLVELYHDTDYGESKYQGNIVNFNLLHKDGTYYGYSEVQNLANLKKIQLRTGCHCNPGSC-----QRFLGLSDITIK  447 (815)
Q Consensus       373 ~~~p~~~l~~~~~~~~~~~~~~i~~f~~~~~~~~~~~~~~v~~~l~~~gI~v~~g~~~~~~~~-----~~~~g~~~~~~~  447 (815)
                         |+++++.+..    ...++++.|.+++.+     ..++.+.|.++||.+++|..|.....     ...+|++++.  
T Consensus       276 ---~~~~~~~~~~----~~~~~~~~~~~~~~~-----~~~~~~~l~~~gi~v~~g~~~~~~~~~~~~~~~~~g~~~~~--  341 (382)
T 4hvk_A          276 ---EESYLNGHPE----KRLPNNVNVRFSYIE-----GESIVLSLDMAGIQASTGSACSSKTLQPSHVLMACGLKHEE--  341 (382)
T ss_dssp             ---TTEEECSCSS----SBCTTEEEEEETTCC-----HHHHHHHHHHTTCBCBCC--------CCCHHHHHTTCCHHH--
T ss_pred             ---CCeEEeCCcc----ccCCCEEEEEECCCC-----HHHHHHHHHHCCEEEeeCCccCCCCCcchHHHHHcCCChhh--
Confidence               7899886642    233568888886433     34588889999999999988875431     1223433211  


Q ss_pred             HHhhcCCccCCcccccCCCCceEEEEeccCCCCHHHHHHHHHHHHHHHhh
Q psy16512        448 FHFQQGHICGDDKDIIDGKPTGSIRISYGHASNWDDVKYFLSFLNQYFLQ  497 (815)
Q Consensus       448 ~~~~~~~~c~~~~~~~~~~~~g~iRvs~g~~~t~edi~~lv~~L~~~~~~  497 (815)
                                         ..+++|++++.+++++|+++++++|++++.+
T Consensus       342 -------------------~~~~iRl~~~~~~t~e~i~~~~~~l~~~~~~  372 (382)
T 4hvk_A          342 -------------------AHGTLLLTLGRYNTDEDVDRLLEVLPGVIER  372 (382)
T ss_dssp             -------------------HHTEEEEECCTTCCHHHHHHHHHHHHHHHHH
T ss_pred             -------------------cCCeEEEEcCCCCCHHHHHHHHHHHHHHHHH
Confidence                               1378999999999999999999999998754



>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>2exn_A Hypothetical protein BOR11; beta barrel containing fold, autostructure, autoassign, structure, structural genomics, PSI; NMR {Bordetella bronchiseptica} SCOP: b.165.1.1 Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Back     alignment and structure
>1oru_A YUAD protein; structural genomics, cytosolic hypothetical protein, PSI, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.80A {Bacillus subtilis} SCOP: b.58.1.2 Back     alignment and structure
>4atq_A 4-aminobutyrate transaminase; transferase; HET: PLP; 2.75A {Arthrobacter aurescens} PDB: 4atp_A* Back     alignment and structure
>4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* Back     alignment and structure
>2lj4_A Peptidyl-prolyl CIS-trans isomerase/rotamase, PUT; tbpin1; NMR {Trypanosoma brucei} Back     alignment and structure
>3ui4_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; peptidyl-prolyl-isomerase; 0.80A {Homo sapiens} SCOP: d.26.1.1 PDB: 3ui5_A 3ui6_A 1fjd_A 1eq3_A Back     alignment and structure
>4e3q_A Pyruvate transaminase; aminotransferase, transferase; HET: PMP; 1.90A {Vibrio fluvialis} PDB: 4e3r_A* 3nui_A Back     alignment and structure
>3i6c_A Peptidyl-prolyl CIS-trans isomerase NIMA- interacting 1; SBDD, small molecule, ppiase, cell cycle, nucleus, phosphoprotein, rotamase; HET: GIA; 1.30A {Homo sapiens} PDB: 3ik8_A 3ikd_A* 3ikg_A* 3jyj_A* 3kac_A* 1nmw_A Back     alignment and structure
>4g2p_A Chaperone SURA; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, pcsep; 1.82A {Salmonella enterica subsp} Back     alignment and structure
>1jns_A Peptidyl-prolyl CIS-trans isomerase C; alpha-beta sandwich, CIS peptide bond; NMR {Escherichia coli} SCOP: d.26.1.1 PDB: 1jnt_A Back     alignment and structure
>3gpk_A PPIC-type peptidyl-prolyl CIS-trans isomerase; rotamase,ppiase domain, 11189O3,PSI2., structural genomics; 1.55A {Novosphingobium aromaticivorans} Back     alignment and structure
>2rqs_A Parvulin-like peptidyl-prolyl isomerase; CIS/trans isomerisation, cenarcheaum symbiosum, low temperat NIMA-kinase, PIN1, cell cycle; NMR {Cenarchaeum symbiosum} Back     alignment and structure
>1zk6_A Foldase protein PRSA; alpha/beta structure, isomerase; NMR {Bacillus subtilis} Back     alignment and structure
>2kgj_A Peptidyl-prolyl CIS-trans isomerase D; prolyl isomerase, parvulin, cell inner membrane, cell membrane, membrane, rotamase, stress response; NMR {Escherichia coli} Back     alignment and structure
>2pv1_A Chaperone SURA; surviVal protein A, peptidyl-prolyl CIS-trans isomerase domain, peptide, complex; 1.30A {Escherichia coli} SCOP: d.26.1.1 PDB: 2pv2_A Back     alignment and structure
>2jzv_A Foldase protein PRSA; ppiase, parvulin, proline isomerase, lipoprotein, membrane, palmitate, rotamase; NMR {Staphylococcus aureus} Back     alignment and structure
>1j6y_A Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN1, phosphorylation; NMR {Arabidopsis thaliana} SCOP: d.26.1.1 Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Back     alignment and structure
>3rfw_A Cell-binding factor 2; SURA-like, chaperone; 2.20A {Campylobacter jejuni} Back     alignment and structure
>3rgc_A Possible periplasmic protein; ppiase, chaperone; 2.30A {Campylobacter jejuni} Back     alignment and structure
>3nrk_A LIC12922; NC domain, parvulin domain, SURA homology, probable chaperon unknown function; 3.10A {Leptospira interrogans serovar copenhaorganism_taxid} Back     alignment and structure
>1m5y_A SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} SCOP: a.223.1.2 d.26.1.1 d.26.1.1 PDB: 2pv3_A Back     alignment and structure
>1m5y_A SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} SCOP: a.223.1.2 d.26.1.1 d.26.1.1 PDB: 2pv3_A Back     alignment and structure
>1o65_A Hypothetical protein YIIM; structural genomics, unknown function; 2.33A {Escherichia coli} SCOP: b.58.1.2 PDB: 1o67_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 815
d1t3ia_408 c.67.1.3 (A:) Probable cysteine desulfurase SufS { 3e-24
d2exna1128 b.165.1.1 (A:1-128) Hypothetical protein BB0938 {B 5e-23
d1p3wa_391 c.67.1.3 (A:) Cysteine desulfurase IscS {Escherich 9e-23
d1jf9a_405 c.67.1.3 (A:) NifS-like protein/selenocysteine lya 4e-21
d1eg5a_376 c.67.1.3 (A:) NifS-like protein/selenocysteine lya 6e-15
d1eq3a_96 d.26.1.1 (A:) Parvulin {Human (Homo sapiens), hpar 9e-12
d1h0ca_388 c.67.1.3 (A:) Alanine-glyoxylate aminotransferase 8e-10
d1vjoa_377 c.67.1.3 (A:) Alanine-glyoxylate aminotransferase 7e-09
d2ch1a1388 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminas 2e-08
d1m32a_361 c.67.1.3 (A:) 2-aminoethylphosphonate transaminase 2e-08
d1elua_381 c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocyst 8e-07
d1jnsa_92 d.26.1.1 (A:) Parvulin 10 (rotamase C) {Escherichi 9e-07
d1j6ya_120 d.26.1.1 (A:) Mitotic rotamase PIN1, domain 2 {Tha 2e-05
d1m5ya3108 d.26.1.1 (A:279-386) Porin chaperone SurA, PPIase 0.002
d1pina2119 d.26.1.1 (A:45-163) Mitotic rotamase PIN1, domain 0.003
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Cystathionine synthase-like
domain: Probable cysteine desulfurase SufS
species: Synechocystis sp. PCC 6803 [TaxId: 1148]
 Score =  103 bits (257), Expect = 3e-24
 Identities = 72/441 (16%), Positives = 135/441 (30%), Gaps = 58/441 (13%)

Query: 56  KNHLKDICYLDYTGAGVYSQSQMNQTIEQLKENIFSHPHGNSVLSDFCVSEIDQMRTKIL 115
           + +   + YLD        ++ + + +   + +  +   G   LS       + +R K+ 
Sbjct: 17  EINGHPLVYLDNAATSQKPRAVLEKLMHYYENDNANVHRGAHQLSVRATDAYEAVRNKVA 76

Query: 116 QYFNTDSDHYSVIF--TSGATSAIKTVSEYFEFNEGSFIYLTD-NHTSVLGMRELVKTNQ 172
           ++ N  S    V     + A + +           G  I  T   H S L   ++V    
Sbjct: 77  KFINARSPREIVYTRNATEAINLVAYSWGMNNLKAGDEIITTVMEHHSNLVPWQMVAAKT 136

Query: 173 IYSFSVDDARNMLNEFKESQENVENMRHSNSLFVYPAESNFSGTKYPLSWCNTVHRNHVF 232
                +   +    E  + +     +     L      SN  G   P      +      
Sbjct: 137 G--AVLKFVQLDEQESFDLEHFKTLLSEKTKLVTVVHISNTLGCVNPAEEIAQLAHQA-- 192

Query: 233 KKHFKCSRSNCFVLLDAATYCGSNMLDLKQHQPDFISISFYKMFGYPTGLGALIVKQKSA 292
                       VL+DA        LD++    D++  S +     PTG+G L  K++  
Sbjct: 193 ---------GAKVLVDACQSAPHYPLDVQLIDCDWLVASGH-KMCAPTGIGFLYGKEEIL 242

Query: 293 HVLNKTFYGGGTVKISMANENFHIKKDGLFEKFEDGTVNYLAIISLKYGFDTMEKKRKSF 352
                 F+GGG +   +  ++F      L  KFE GT      I+L    D +       
Sbjct: 243 E-AMPPFFGGGEMIAEVFFDHFTT--GELPHKFEAGTPAIAEAIALGAAVDYLTDLGMEN 299

Query: 353 TNAFELSQYTYFYFKQLSYSNGQPLVELYHDTDYGESKYQGNIVNFNLLHKDGTYYGYSE 412
            + +E+    Y +                      +   +  + +FN+          S+
Sbjct: 300 IHNYEVELTHYLWQGLGQIPQL------RLYGPNPKHGDRAALASFNVAGLHA-----SD 348

Query: 413 VQNLANLKKIQLRTGCHCNPGSCQRFLGLSDITIKFHFQQGHICGDDKDIIDGKPTGSIR 472
           V  + +   I +R+G HC     + F                             +GS R
Sbjct: 349 VATMVDQDGIAIRSGHHCTQPLHRLF---------------------------DASGSAR 381

Query: 473 ISYGHASNWDDVKYFLSFLNQ 493
            S    +  +++  FL  L  
Sbjct: 382 ASLYFYNTKEEIDLFLQSLQA 402


>d2exna1 b.165.1.1 (A:1-128) Hypothetical protein BB0938 {Bordetella bronchiseptica [TaxId: 518]} Length = 128 Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Length = 391 Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Length = 405 Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Length = 376 Back     information, alignment and structure
>d1eq3a_ d.26.1.1 (A:) Parvulin {Human (Homo sapiens), hpar14 [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Length = 377 Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Length = 388 Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Length = 361 Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Length = 381 Back     information, alignment and structure
>d1jnsa_ d.26.1.1 (A:) Parvulin 10 (rotamase C) {Escherichia coli [TaxId: 562]} Length = 92 Back     information, alignment and structure
>d1j6ya_ d.26.1.1 (A:) Mitotic rotamase PIN1, domain 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 120 Back     information, alignment and structure
>d1m5ya3 d.26.1.1 (A:279-386) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]} Length = 108 Back     information, alignment and structure
>d1pina2 d.26.1.1 (A:45-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query815
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 100.0
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 100.0
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 100.0
d1p3wa_391 Cysteine desulfurase IscS {Escherichia coli [TaxId 100.0
d1eg5a_376 NifS-like protein/selenocysteine lyase {Thermotoga 100.0
d1qz9a_404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 100.0
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 99.97
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 99.97
d2exna1128 Hypothetical protein BB0938 {Bordetella bronchisep 99.96
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 99.96
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 99.95
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 99.95
d1iuga_348 Subgroup IV putative aspartate aminotransferase {T 99.95
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 99.93
d1pmma_450 Glutamate decarboxylase beta, GadB {Escherichia co 99.92
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 99.91
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 99.9
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 99.9
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 99.89
d1w23a_360 Phosphoserine aminotransferase, PSAT {Bacillus alc 99.89
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 99.89
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 99.88
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 99.88
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 99.88
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 99.87
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 99.87
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 99.87
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 99.86
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 99.86
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 99.86
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 99.85
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 99.85
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 99.84
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 99.84
d1gc0a_392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 99.83
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 99.83
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 99.83
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.83
d1iaya_428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.83
d1c4ka2462 Ornithine decarboxylase major domain {Lactobacillu 99.83
d1js3a_476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 99.83
d1y4ia1397 Methionine gamma-lyase, MGL {Citrobacter freundii 99.83
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 99.82
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 99.82
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 99.82
d1qgna_398 Cystathionine gamma-synthase, CGS {Common tobacco 99.82
d1cs1a_384 Cystathionine gamma-synthase, CGS {Escherichia col 99.81
d2z67a1434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 99.79
d1e5ea_394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.79
d3bc8a1445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 99.77
d1mdoa_376 Aminotransferase ArnB {Salmonella typhimurium [Tax 99.77
d1ibja_380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 99.77
d1pffa_331 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.77
d2hoxa1425 Alliinase {Garlic (Allium sativum) [TaxId: 4682]} 99.76
d2ctza1421 O-acetyl-L-homoserine sulfhydrylase {Thermus therm 99.76
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 99.75
d1cl1a_391 Cystathionine beta-lyase, CBL {Escherichia coli [T 99.75
d1m6sa_343 Low-specificity threonine aldolase {Thermotoga mar 99.71
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 99.71
d1n8pa_393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 99.69
d2aeua1366 Hypothetical protein MJ0158 {Archaeon Methanococcu 99.67
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 99.66
d2fnua1371 Spore coat polysaccharide biosynthesis protein C { 99.65
d1o69a_374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 99.65
d1dfoa_416 Serine hydroxymethyltransferase {Escherichia coli 99.64
d1b9ha_384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 99.63
d1kl1a_405 Serine hydroxymethyltransferase {Bacillus stearoth 99.62
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 99.61
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 99.58
d1rv3a_470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 99.54
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 99.54
d2a7va1463 Serine hydroxymethyltransferase {Human (Homo sapie 99.53
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 99.53
d1c7ga_456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 99.51
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 99.46
d1wyua1437 Glycine dehydrogenase (decarboxylating) subunit 1 99.46
d1eq3a_96 Parvulin {Human (Homo sapiens), hpar14 [TaxId: 960 99.4
d2byla1404 Ornithine aminotransferase {Human (Homo sapiens) [ 99.33
d1ax4a_465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 99.28
d1z7da1404 Ornithine aminotransferase {Plasmodium yoelii yoel 99.26
d1vefa1387 Acetylornithine/acetyl-lysine aminotransferase Arg 99.26
d1sffa_425 4-aminobutyrate aminotransferase, GABA-aminotransf 99.26
d2v1pa1467 Tryptophan indol-lyase (tryptophanase) {Escherichi 99.23
d1s0aa_429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.22
d1jnsa_92 Parvulin 10 (rotamase C) {Escherichia coli [TaxId: 99.15
d1wyub1471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 99.13
d2gsaa_427 Glutamate-1-semialdehyde aminomutase (aminotransfe 99.12
d1pina2119 Mitotic rotamase PIN1, domain 2 {Human (Homo sapie 99.1
d1j6ya_120 Mitotic rotamase PIN1, domain 2 {Thale cress (Arab 99.08
d1ohwa_461 4-aminobutyrate aminotransferase, GABA-aminotransf 99.08
d1m5ya3108 Porin chaperone SurA, PPIase domains {Escherichia 99.04
d1zoda1431 Dialkylglycine decarboxylase {Pseudomonas cepacia 99.01
d2pv2a1103 Porin chaperone SurA, PPIase domains {Escherichia 98.85
d1orua_182 Hypothetical protein YuaD {Bacillus subtilis [TaxI 98.68
d1o65a_233 Hypothetical protein YiiM {Escherichia coli [TaxId 96.15
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Cystathionine synthase-like
domain: NifS-like protein/selenocysteine lyase
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=1.1e-42  Score=386.53  Aligned_cols=367  Identities=20%  Similarity=0.272  Sum_probs=302.9

Q ss_pred             hhhhhhhcccccchhhHHHHHHHHhhccccCCCCh-hhhhhhhhhhHHHHHHHHHhHcCCCC-CceeEEecCCchhhHHH
Q psy16512         62 ICYLDYTGAGVYSQSQMNQTIEQLKENIFSHPHGN-SVLSDFCVSEIDQMRTKILQYFNTDS-DHYSVIFTSGATSAIKT  139 (815)
Q Consensus        62 ~iyLd~a~~~~~p~~v~~al~~~l~~~~~~np~s~-~~~~~~~~~~~~~~r~~la~~~g~~~-~~~~iv~t~g~t~al~~  139 (815)
                      .+|||+++.+++|+.+++++.+.+.+ .++||++. +.....+.+.++++|+.+++++|+.+ ++  |+|++|+|++++.
T Consensus        23 ~iYld~a~~~~~p~~v~~~~~~~~~~-~~~n~~~~~~~~~~~~~~~~e~~R~~ia~~l~~~~~~~--i~~~~~~T~~~~~   99 (405)
T d1jf9a_          23 LAYLDSAASAQKPSQVIDAEAEFYRH-GYAAVHRGIHTLSAQATEKMENVRKRASLFINARSAEE--LVFVRGTTEGINL   99 (405)
T ss_dssp             CEECCTTTCCCCCHHHHHHHHHHHHH-TCCCCSSCSSHHHHHHHHHHHHHHHHHHHHTTCSCGGG--EEEESSHHHHHHH
T ss_pred             eEEEeCccccCCCHHHHHHHHHHHHh-ccCCCccchhHHHHHHHHHHHHHHHHHHHHcCCCCccc--ccccCcHHHHHHH
Confidence            58999999999999999999776654 57888765 34444445559999999999999754 55  9999999999999


Q ss_pred             HHhh---hccCCCc-EEEecCCCcchh-hHHHHhhccc----eEEcCchhhhcchhhhhhhhhhhhhcCCCccEEEEecc
Q psy16512        140 VSEY---FEFNEGS-FIYLTDNHTSVL-GMRELVKTNQ----IYSFSVDDARNMLNEFKESQENVENMRHSNSLFVYPAE  210 (815)
Q Consensus       140 ~~~a---l~~~~gd-vv~~~~~h~s~~-~~~~~~~~~g----~v~~~~~~~~~~~~~~~~l~~~~~~~~~~t~lv~i~~~  210 (815)
                      ++.+   ..+.+|+ +|++..+|++.. .|..++++.|    .+++++++.++++.++.       .++++|++|+++++
T Consensus       100 ~~~~~~~~~~~~g~~il~~~~e~~s~~~~~~~~a~~~g~~v~~~~~~~~g~~~~~~~~~-------~i~~~t~lv~~~~v  172 (405)
T d1jf9a_         100 VANSWGNSNVRAGDNIIISQMEHHANIVPWQMLCARVGAELRVIPLNPDGTLQLETLPT-------LFDEKTRLLAITHV  172 (405)
T ss_dssp             HHHHHHHHHCCTTCEEEEETTCCGGGTHHHHHHHHHHTCEEEEECBCTTSCBCGGGHHH-------HCCTTEEEEEEESB
T ss_pred             HHhcccccccCCCCEEEEEeCcccchHHHHHHHHHHcCcEEEEECCCCCCcCCHHHHHH-------hccCCcEEEEEecC
Confidence            8887   3357888 999999999865 5777777777    66777777777776665       44689999999999


Q ss_pred             cCCCccccChHHHHHHhhccccccccccCCCCeEEEEecccccCCCCCCCCCCCCcEEEEccccccccCCcceEEEEecc
Q psy16512        211 SNFSGTKYPLSWCNTVHRNHVFKKHFKCSRSNCFVLLDAATYCGSNMLDLKQHQPDFISISFYKMFGYPTGLGALIVKQK  290 (815)
Q Consensus       211 ~n~tG~~~~l~~I~~l~~~~~~~~~~~~~~~gi~vivD~a~~~g~~~~dl~~~~~D~vv~S~~K~~g~p~G~G~l~~~~~  290 (815)
                      +|.||.++|+++|.++||           ++|+++++|++|++|..++|+..+++|++++|+|||+| |.|+|+++++++
T Consensus       173 ~~~tG~~~pi~~i~~~~~-----------~~g~~~~vD~~q~~g~~~id~~~~~~D~~~~s~hK~~G-p~G~g~l~v~~~  240 (405)
T d1jf9a_         173 SNVLGTENPLAEMITLAH-----------QHGAKVLVDGAQAVMHHPVDVQALDCDFYVFSGHKLYG-PTGIGILYVKEA  240 (405)
T ss_dssp             CTTTCCBCCHHHHHHHHH-----------HTTCEEEEECTTTTTTSCCCHHHHTCSEEEEEGGGTTS-CSSCEEEEECHH
T ss_pred             CCcccccCchHHhhhHHH-----------HcCCeeecccceeccccccchhhcCCceeecccccccc-CCCceeeeechh
Confidence            999999999999999999           89999999999999999999999999999999999987 999999999999


Q ss_pred             cccccCcccccCceEEEEecCCcccccccCccccccCCCCChhHHHHHHHHHHHHHhhhhhH--HHHHHHHHHHHHHHHh
Q psy16512        291 SAHVLNKTFYGGGTVKISMANENFHIKKDGLFEKFEDGTVNYLAIISLKYGFDTMEKKRKSF--TNAFELSQYTYFYFKQ  368 (815)
Q Consensus       291 ~~~~l~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~gt~~~~~~~al~~al~~l~~~~~~~--~~~~~l~~~l~~~L~~  368 (815)
                      ..+.+.+...++............  .+...+.+|+.||+|+.+++++..+++++..++...  ++...|.+++.+.+..
T Consensus       241 ~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~r~e~GT~~~~~~~~l~~al~~~~~~g~~~i~~~~~~L~~~~~~~l~~  318 (405)
T d1jf9a_         241 LLQEMPPWEGGGSMIATVSLSEGT--TWTKAPWRFEAGTPNTGGIIGLGAALEYVSALGLNNIAEYEQNLMHYALSQLES  318 (405)
T ss_dssp             HHTTCCCSSCSSSSEEECCTTTCC--EECCTTGGGCCSSCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHTT
T ss_pred             hhcccCcccccccccCcccccccc--ccccchhhhcCCCCcHHHHHHHHHHHHHHHHhChHHHHHHHHHHHHHHHhhhhc
Confidence            888777766665554443322222  234567889999999999999999999999887554  8889999999999988


Q ss_pred             ccccCCCCcEEEcCCCCCCCCCcccceEEEEEecCCCCccCHHHHHHhhhcCCcEeccCccCCchhhhhhcCCCHHHHHH
Q psy16512        369 LSYSNGQPLVELYHDTDYGESKYQGNIVNFNLLHKDGTYYGYSEVQNLANLKKIQLRTGCHCNPGSCQRFLGLSDITIKF  448 (815)
Q Consensus       369 l~~~~~~p~~~l~~~~~~~~~~~~~~i~~f~~~~~~~~~~~~~~v~~~l~~~gI~v~~g~~~~~~~~~~~~g~~~~~~~~  448 (815)
                      +      +.+.+..+.      .++++++|.+++.++.     ++...|.++||.+++|++|+.+... .++.       
T Consensus       319 ~------~~~~~~~~~------~r~~ivsf~~~~~~~~-----~~~~~L~~~gI~v~~G~~c~~~~~~-~~~~-------  373 (405)
T d1jf9a_         319 V------PDLTLYGPQ------NRLGVIAFNLGKHHAY-----DVGSFLDNYGIAVRTGHHCAMPLMA-YYNV-------  373 (405)
T ss_dssp             S------TTEEEESCT------TCCSEEEEEETTCCHH-----HHHHHHHHTTEECEEECTTCHHHHH-HTTC-------
T ss_pred             C------CcccccCCc------CcCcEEEEEcCCCCHH-----HHHHHHHHCCcEEEccchhhhhHHH-hcCC-------
Confidence            8      677877764      3478999999765443     4788899999999999999876543 2221       


Q ss_pred             HhhcCCccCCcccccCCCCceEEEEeccCCCCHHHHHHHHHHHHHHHh
Q psy16512        449 HFQQGHICGDDKDIIDGKPTGSIRISYGHASNWDDVKYFLSFLNQYFL  496 (815)
Q Consensus       449 ~~~~~~~c~~~~~~~~~~~~g~iRvs~g~~~t~edi~~lv~~L~~~~~  496 (815)
                                         +|+||||+|+|||.+||++++++|+++.+
T Consensus       374 -------------------~g~iRiS~~~ynt~eDid~l~~~l~~i~r  402 (405)
T d1jf9a_         374 -------------------PAMCRASLAMYNTHEEVDRLVTGLQRIHR  402 (405)
T ss_dssp             -------------------SCEEEEECCTTCCHHHHHHHHHHHHHHHH
T ss_pred             -------------------CCEEEEECCCCCCHHHHHHHHHHHHHHHH
Confidence                               48999999999999999999999998753



>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2exna1 b.165.1.1 (A:1-128) Hypothetical protein BB0938 {Bordetella bronchiseptica [TaxId: 518]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1eq3a_ d.26.1.1 (A:) Parvulin {Human (Homo sapiens), hpar14 [TaxId: 9606]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnsa_ d.26.1.1 (A:) Parvulin 10 (rotamase C) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Back     information, alignment and structure
>d1pina2 d.26.1.1 (A:45-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j6ya_ d.26.1.1 (A:) Mitotic rotamase PIN1, domain 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1m5ya3 d.26.1.1 (A:279-386) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d2pv2a1 d.26.1.1 (A:172-274) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1orua_ b.58.1.2 (A:) Hypothetical protein YuaD {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o65a_ b.58.1.2 (A:) Hypothetical protein YiiM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure