Psyllid ID: psy16523
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 85 | ||||||
| 270037307 | 520 | epithelial membrane protein [Aedes albop | 0.482 | 0.078 | 0.809 | 1e-11 | |
| 157123394 | 520 | epithelial membrane protein [Aedes aegyp | 0.482 | 0.078 | 0.809 | 1e-11 | |
| 328702264 | 574 | PREDICTED: scavenger receptor class B me | 0.505 | 0.074 | 0.645 | 2e-11 | |
| 58385970 | 522 | AGAP004846-PC [Anopheles gambiae str. PE | 0.482 | 0.078 | 0.761 | 3e-11 | |
| 158293053 | 512 | AGAP004846-PA [Anopheles gambiae str. PE | 0.482 | 0.080 | 0.761 | 3e-11 | |
| 170069706 | 185 | epithelial membrane protein [Culex quinq | 0.482 | 0.221 | 0.761 | 3e-11 | |
| 91085263 | 515 | PREDICTED: similar to epithelial membran | 0.482 | 0.079 | 0.714 | 3e-09 | |
| 357606371 | 454 | epithelial membrane protein [Danaus plex | 0.470 | 0.088 | 0.682 | 3e-09 | |
| 380014359 | 519 | PREDICTED: scavenger receptor class B me | 0.482 | 0.078 | 0.666 | 1e-08 | |
| 340723035 | 519 | PREDICTED: scavenger receptor class B me | 0.482 | 0.078 | 0.642 | 3e-08 |
| >gi|270037307|gb|ACZ58351.1| epithelial membrane protein [Aedes albopictus] | Back alignment and taxonomy information |
|---|
Score = 73.9 bits (180), Expect = 1e-11, Method: Compositional matrix adjust.
Identities = 34/42 (80%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
Query: 2 WRKPPVHPVIRIFIYNVTNADEFLSVPGTKPVLDEIGPYVYV 43
W KPPV P+IRIF+YNVTNADEFL+ GTKPVLDE+GPYVYV
Sbjct: 65 WSKPPVEPIIRIFVYNVTNADEFLN-NGTKPVLDELGPYVYV 105
|
Source: Aedes albopictus Species: Aedes albopictus Genus: Aedes Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|157123394|ref|XP_001660151.1| epithelial membrane protein [Aedes aegypti] gi|108884544|gb|EAT48769.1| AAEL000256-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|328702264|ref|XP_001946482.2| PREDICTED: scavenger receptor class B member 1-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|58385970|ref|XP_314345.2| AGAP004846-PC [Anopheles gambiae str. PEST] gi|158293055|ref|XP_314346.4| AGAP004846-PB [Anopheles gambiae str. PEST] gi|55240292|gb|EAA09703.2| AGAP004846-PC [Anopheles gambiae str. PEST] gi|157016922|gb|EAA44477.4| AGAP004846-PB [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|158293053|ref|XP_001688562.1| AGAP004846-PA [Anopheles gambiae str. PEST] gi|157016921|gb|EDO64039.1| AGAP004846-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|170069706|ref|XP_001869320.1| epithelial membrane protein [Culex quinquefasciatus] gi|167865605|gb|EDS28988.1| epithelial membrane protein [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|91085263|ref|XP_966331.1| PREDICTED: similar to epithelial membrane protein isoform 1 [Tribolium castaneum] gi|270009222|gb|EFA05670.1| hypothetical protein TcasGA2_TC014954 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|357606371|gb|EHJ65041.1| epithelial membrane protein [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|380014359|ref|XP_003691202.1| PREDICTED: scavenger receptor class B member 1-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|340723035|ref|XP_003399904.1| PREDICTED: scavenger receptor class B member 1-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 85 | ||||||
| FB|FBgn0010435 | 601 | emp "epithelial membrane prote | 0.470 | 0.066 | 0.658 | 6.8e-10 | |
| FB|FBgn0027562 | 552 | CG10345 [Drosophila melanogast | 0.741 | 0.114 | 0.363 | 1.5e-05 | |
| FB|FBgn0035290 | 615 | CG1887 [Drosophila melanogaste | 0.458 | 0.063 | 0.512 | 1.8e-05 | |
| RGD|621882 | 478 | Scarb2 "scavenger receptor cla | 0.564 | 0.100 | 0.450 | 2.1e-05 | |
| MGI|MGI:1196458 | 478 | Scarb2 "scavenger receptor cla | 0.458 | 0.081 | 0.463 | 2.6e-05 | |
| UNIPROTKB|F1RYT3 | 478 | SCARB2 "Uncharacterized protei | 0.458 | 0.081 | 0.463 | 3.4e-05 | |
| UNIPROTKB|D6RDG0 | 106 | SCARB2 "Lysosome membrane prot | 0.458 | 0.367 | 0.414 | 3.9e-05 | |
| FB|FBgn0260004 | 551 | Snmp1 "Sensory neuron membrane | 0.470 | 0.072 | 0.404 | 4.6e-05 | |
| FB|FBgn0025697 | 563 | santa-maria "scavenger recepto | 0.482 | 0.072 | 0.380 | 5.4e-05 | |
| UNIPROTKB|A6QQP4 | 478 | SCARB2 "SCARB2 protein" [Bos t | 0.458 | 0.081 | 0.439 | 7.1e-05 |
| FB|FBgn0010435 emp "epithelial membrane protein" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 152 (58.6 bits), Expect = 6.8e-10, P = 6.8e-10
Identities = 27/41 (65%), Positives = 34/41 (82%)
Query: 2 WRKPPVHPVIRIFIYNVTNADEFLSVPGTKPVLDEIGPYVY 42
W KPPV P I ++IYNVTNAD+FLS G+K ++DE+GPYVY
Sbjct: 146 WAKPPVEPRISLYIYNVTNADDFLS-NGSKAIVDEVGPYVY 185
|
|
| FB|FBgn0027562 CG10345 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0035290 CG1887 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| RGD|621882 Scarb2 "scavenger receptor class B, member 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1196458 Scarb2 "scavenger receptor class B, member 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RYT3 SCARB2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D6RDG0 SCARB2 "Lysosome membrane protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0260004 Snmp1 "Sensory neuron membrane protein 1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0025697 santa-maria "scavenger receptor acting in neural tissue and majority of rhodopsin is absent" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6QQP4 SCARB2 "SCARB2 protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 85 | |||
| pfam01130 | 460 | pfam01130, CD36, CD36 family | 2e-13 |
| >gnl|CDD|216316 pfam01130, CD36, CD36 family | Back alignment and domain information |
|---|
Score = 63.4 bits (155), Expect = 2e-13
Identities = 19/42 (45%), Positives = 30/42 (71%), Gaps = 1/42 (2%)
Query: 1 MWRKPPVHPVIRIFIYNVTNADEFLSVPGTKPVLDEIGPYVY 42
W PPV +++++NVTN +E L+ G KP+++E+GPYVY
Sbjct: 43 SWENPPVPLYFKVYLFNVTNPEEVLN-GGAKPIVEEVGPYVY 83
|
The CD36 family is thought to be a novel class of scavenger receptors. There is also evidence suggesting a possible role in signal transduction. CD36 is involved in cell adhesion. Length = 460 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 85 | |||
| PF01130 | 467 | CD36: CD36 family; InterPro: IPR002159 CD36 is a t | 99.93 | |
| KOG3776|consensus | 507 | 99.86 |
| >PF01130 CD36: CD36 family; InterPro: IPR002159 CD36 is a transmembrane, highly glycosylated, 88kDa glycoprotein expressed by monocytes, macrophages, platelets, microvascular endothelial cells and adipose tissues | Back alignment and domain information |
|---|
Probab=99.93 E-value=1.4e-25 Score=176.44 Aligned_cols=76 Identities=33% Similarity=0.628 Sum_probs=71.7
Q ss_pred CccCCCCcceEEEEEEeccChhhhhcCCCCCceeEEeCCeEEEeEEEeeeeEEecCCCcCceEEEEcceEEEEEeeceee
Q psy16523 1 MWRKPPVHPVIRIFIYNVTNADEFLSVPGTKPVLDEIGPYVYVLLTSFVANVIQVNKLERNSMTWSGLGFYCCLFNMELR 80 (85)
Q Consensus 1 ~W~~pp~~~~~~~y~FNvTN~eevl~g~g~kP~v~EvGPY~Y~e~~~k~ni~~~~n~~e~~t~~y~~~~~y~~~~~~~~~ 80 (85)
.|++||+|++++||+||||||+||++| |+||+|+|+|||+|+|.++|+|++|++|+ +||+|++++.|. |+.|.|
T Consensus 43 ~W~~~p~p~~~~~y~fNvTNp~ev~~~-g~kP~~~EvGPY~y~e~~~k~nv~~~~~~---~tvsY~~~~~~~--F~~~~S 116 (467)
T PF01130_consen 43 NWKKPPVPIYFKFYFFNVTNPEEVLNG-GAKPNVQEVGPYVYREYREKVNVTFNDNG---STVSYRQKRTFF--FDPELS 116 (467)
T ss_pred hhhcCCCccEEEEEEEeccCHHHHhCc-CCCceEEEeCCEEEEeeeeeeeeEEcCCC---cEEEEEeeeeEE--eccccC
Confidence 599999999999999999999999996 99999999999999999999999998873 799999999996 999988
Q ss_pred ec
Q psy16523 81 WS 82 (85)
Q Consensus 81 ~~ 82 (85)
-.
T Consensus 117 ~~ 118 (467)
T PF01130_consen 117 CG 118 (467)
T ss_pred CC
Confidence 65
|
Platelet glycoprotein IV (GP IV)(GPIIIb) (CD36 antigen) is also called GPIV, OKM5-antigen or PASIV. CD36 recognises oxidized low density lipoprotein, long chain fatty acids, anionic phospholipids, collagen types I, IV and V, thrombospondin (TSP) and Plasmodium falciparum infected erythrocytes. The recognition of apoptotic neutrophils is in co-operation with TSP and avb3. Other ligands may still be unknown. CD36 is a scavenger receptor for oxidized LDL and shed photoreceptor outer segments and in recognition and phagocytosis of apoptotic cells and is the cell adhesion molecule in platelet adhesion and aggregation, platelet-monocyte and platelet-tumor cell interaction []. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0007155 cell adhesion, 0016020 membrane |
| >KOG3776|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00