Psyllid ID: psy16562

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-----
MPTLATLRVGREDADPDLMKYLQPNDVASGRYDNMSTAEAEKNNLCARPCDNAKPLVCYYSFTLENYATVGPACADCLKGNQKACRRKGCVTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMIDREVTLHWHGVYQKVTPWMDGVPMVTQCPIPSSTTFRYKFPAMPSGTFFYHSHVGLQKMDGLEGSMIIRTPKTADPHAELYDFDLYSHVIIVTDWMHSMTDSKFPGNTYNDTRIKPDAILINGQNQNPKDNSPRVPMHFFKVQRDKRYLMRIIGGSCLACPLIFTIEKHQLQVIASDGTAVEPLVVDSVTLFPGDRVDVIIHTNQSNNLYWMQAKTLCDSITAEAVLQYEGEKLTYVSKRPKSDSFPRGKPKDNSPRVPMHFFKVQRDKRYLMRIIGGSCLACPLIFTIEKHQLQVIASDGTAVEPLVVDSVTLFP
ccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEcccccccccEEEEEEEEEEEEEcccccEEEEEEEcccccccEEEEEEccEEEEEEEEcccccccEEEEccccccccccccccccccccccccccEEEEEEEccccccEEEccccccccccccEEEEEEccccccccccccccccccccEEEEEEcccccccccccccccccccccccEEEEccccccccccccccccEEEEEEcccEEEEEEEEcccccccEEEEEEccEEEEEEEcccccEEEEEcEEEEEcccEEEEEEEccccccccEEEEEEccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccEEEEEcccEEEEEccccccEEEEcccEEEcc
ccEEEEEccccccccHHHHHHcccccccccccccccHHHHccccHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccccEEEEEEccEcccccEEEEcccEEEEEEEEccccccEcEEEEcccccccHHHcccEcccEccEccccEEEEEEEccccEEEEEEEccccHHHHccEEEEEEEccccccccHHHccEccHHHEEEEEEEccccHHHHHHHHHcccccccccEEEEcccccccccccccccEEEEEEccccEEEEEEEEEEcccccEEEEEcccEEEEEEEEcEEccEEEEEEEEEEcccEEEEEEEcccccccEEEEEccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccEEEEEccccccccccccccEEEcc
mptlatlrvgredadpdlmkylqpndvasgrydnmstaeaeknnlcarpcdnakplvcyysftlenyatvgpacadclkgnqkacrrkgcvtadGFERAILSINrqlpgpsiqvckgdtiiVDVKNHMIDREVTLHWHGVyqkvtpwmdgvpmvtqcpipssttfrykfpampsgtffyhshvglqkmdglegsmiirtpktadphaelydfdlySHVIIVTDwmhsmtdskfpgntyndtrikpdailingqnqnpkdnsprvpmhffkvqrDKRYLMRIIGgsclacpliFTIEKHQLQViasdgtaveplvvdsvtlfpgdrvdVIIHTNQSNNLYWMQAKTLCDSITAEAVLQYEGEKLTyvskrpksdsfprgkpkdnsprvpmhffkvqrDKRYLMRIIGgsclacpliFTIEKHQLQViasdgtaveplvvdsvtlfp
mptlatlrvgredadpdlmkylqpndvasgryDNMSTAEAEKnnlcarpcdnAKPLVCYYSFTLENYATVGPACADCLKGNQKACRRKGCVTADGFERAILSinrqlpgpsiqvcKGDTIIVDVKNHMIDREVTLHWHGVYQKVTPWMDGVPMVTQCPIPSSTTFRYKFPAMPSGTFFYHSHVGLQKMDGLEGSMIIRTPKTADPHAELYDFDLYSHVIIVTDWMHSMTDSKFPGNTYNDTRIKPDAILINGqnqnpkdnsprvpMHFFKVQRDKRYLMRIIGGSCLACPLIFTIEKHQLQVIASDGTAVEPLVVDSVTLFPGDRVDVIIHTNQSNNLYWMQAKTLCDSITAEAVLQYEGEkltyvskrpksdsfprgkpkdnsprvpmhffkVQRDKRYLMRIIGGSCLACPLIFTIEKHQLQVIASDGTAVEPLVVDSVTLFP
MPTLATLRVGREDADPDLMKYLQPNDVASGRYDNMSTAEAEKNNLCARPCDNAKPLVCYYSFTLENYATVGPACADCLKGNQKACRRKGCVTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMIDREVTLHWHGVYQKVTPWMDGVPMVTQCPIPSSTTFRYKFPAMPSGTFFYHSHVGLQKMDGLEGSMIIRTPKTADPHAELYDFDLYSHVIIVTDWMHSMTDSKFPGNTYNDTRIKPDAILINGQNQNPKDNSPRVPMHFFKVQRDKRYLMRIIGGSCLACPLIFTIEKHQLQVIASDGTAVEPLVVDSVTLFPGDRVDVIIHTNQSNNLYWMQAKTLCDSITAEAVLQYEGEKLTYVSKRPKSDSFPRGKPKDNSPRVPMHFFKVQRDKRYLMRIIGGSCLACPLIFTIEKHQLQVIASDGTAVEPLVVDSVTLFP
*******************************************NLCARPCDNAKPLVCYYSFTLENYATVGPACADCLKGNQKACRRKGCVTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMIDREVTLHWHGVYQKVTPWMDGVPMVTQCPIPSSTTFRYKFPAMPSGTFFYHSHVGLQKMDGLEGSMIIRTPKTADPHAELYDFDLYSHVIIVTDWMHSMTDSKFPGNTYNDTRIKPDAILI**************PMHFFKVQRDKRYLMRIIGGSCLACPLIFTIEKHQLQVIASDGTAVEPLVVDSVTLFPGDRVDVIIHTNQSNNLYWMQAKTLCDSITAEAVLQYEGEKLTYV**********************MHFFKVQRDKRYLMRIIGGSCLACPLIFTIEKHQLQVIASDGTAVEPLVVDSVT***
*******************************************NLCARPCDNAKPLVCYYSFTLENYATVGPACADCLKGNQKACRRKGCVTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMIDREVTLHWHGVYQKVTPWMDGVPMVTQCPIPSSTTFRYKFPAMPSGTFFYHSHVGLQKMDGLEGSMIIRTPKTADPHAELYDFDLYSHVIIVTDWMHSMTDSKFPGNTYNDTRIKPDAILINGQNQNPKDNSPRVPMHFFKVQRDKRYLMRIIGGSCLACPLIFTIEKHQLQVIASDGTAVEPLVVDSVTLFPGDRVDVIIHTNQSNNLYWMQAKTLCDSITAEAVLQYEGEKLTYVSKRPKSDSFPRGKPKDNSPRVPMHFFKVQRDKRYLMRIIGGSCLACPLIFTIEKHQLQVIASDGTAVEPLVVDSVTLFP
MPTLATLRVGREDADPDLMKYLQPNDVASGRYDNMSTAEAEKNNLCARPCDNAKPLVCYYSFTLENYATVGPACADCLKGNQKACRRKGCVTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMIDREVTLHWHGVYQKVTPWMDGVPMVTQCPIPSSTTFRYKFPAMPSGTFFYHSHVGLQKMDGLEGSMIIRTPKTADPHAELYDFDLYSHVIIVTDWMHSMTDSKFPGNTYNDTRIKPDAILINGQNQNPKDNSPRVPMHFFKVQRDKRYLMRIIGGSCLACPLIFTIEKHQLQVIASDGTAVEPLVVDSVTLFPGDRVDVIIHTNQSNNLYWMQAKTLCDSITAEAVLQYEGEKLTYVSK**************NSPRVPMHFFKVQRDKRYLMRIIGGSCLACPLIFTIEKHQLQVIASDGTAVEPLVVDSVTLFP
MPTLATLRVGREDADPDLMKYLQPNDVASGRYDNMSTAEAEKNNLCARPCDNAKPLVCYYSFTLENYATVGPACADCLKGNQKACRRKGCVTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMIDREVTLHWHGVYQKVTPWMDGVPMVTQCPIPSSTTFRYKFPAMPSGTFFYHSHVGLQKMDGLEGSMIIRTPKTADPHAELYDFDLYSHVIIVTDWMHSMTDSKFPGNTYNDTRIKPDAILINGQNQNPKDNSPRVPMHFFKVQRDKRYLMRIIGGSCLACPLIFTIEKHQLQVIASDGTAVEPLVVDSVTLFPGDRVDVIIHTNQSNNLYWMQAKTLCDSITAEAVLQYEGEKL****KRPKSDSFPRGKPKDNSPRVPMHFFKVQRDKRYLMRIIGGSCLACPLIFTIEKHQLQVIASDGTAVEPLVVDSVTLFP
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPTLATLRVGREDADPDLMKYLQPNDVASGRYDNMSTAEAEKNNLCARPCDNAKPLVCYYSFTLENYATVGPACADCLKGNQKACRRKGCVTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMIDREVTLHWHGVYQKVTPWMDGVPMVTQCPIPSSTTFRYKFPAMPSGTFFYHSHVGLQKMDGLEGSMIIRTPKTADPHAELYDFDLYSHVIIVTDWMHSMTDSKFPGNTYNDTRIKPDAILINGQNQNPKDNSPRVPMHFFKVQRDKRYLMRIIGGSCLACPLIFTIEKHQLQVIASDGTAVEPLVVDSVTLFPGDRVDVIIHTNQSNNLYWMQAKTLCDSITAEAVLQYEGEKLTYVSKRPKSDSFPRGKPKDNSPRVPMHFFKVQRDKRYLMRIIGGSCLACPLIFTIEKHQLQVIASDGTAVEPLVVDSVTLFP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query445 2.2.26 [Sep-21-2011]
Q02079 572 Laccase-3 OS=Thanatephoru N/A N/A 0.611 0.475 0.389 8e-48
Q02081 531 Laccase-4 OS=Thanatephoru N/A N/A 0.595 0.499 0.375 8e-47
P56193 576 Laccase-1 OS=Thanatephoru N/A N/A 0.611 0.472 0.371 7e-46
Q99055 520 Laccase-4 OS=Trametes vil N/A N/A 0.734 0.628 0.322 2e-43
Q12719 520 Laccase-4 OS=Trametes ver N/A N/A 0.725 0.621 0.323 4e-43
Q12541 520 Laccase-1 OS=Agaricus bis N/A N/A 0.593 0.507 0.370 5e-43
Q12718 519 Laccase-2 OS=Trametes ver N/A N/A 0.582 0.499 0.360 3e-42
Q99046 519 Laccase-2 OS=Trametes vil N/A N/A 0.582 0.499 0.360 5e-42
Q12542 520 Laccase-2 OS=Agaricus bis N/A N/A 0.582 0.498 0.359 2e-41
Q02075 599 Laccase-2 OS=Thanatephoru N/A N/A 0.604 0.449 0.343 5e-41
>sp|Q02079|LAC3_THACU Laccase-3 OS=Thanatephorus cucumeris GN=LCC3 PE=2 SV=1 Back     alignment and function desciption
 Score =  191 bits (486), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 111/285 (38%), Positives = 160/285 (56%), Gaps = 13/285 (4%)

Query: 89  GCVTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMID----REVTLHWHGVYQKV 144
           G +  DG ER    +N   PGP I   KGDT+ V V+N + +    R  ++HWHG+ Q  
Sbjct: 31  GKIAPDGVERDATLVNGGYPGPLIFANKGDTLKVKVQNKLTNPDMYRTTSIHWHGLLQHR 90

Query: 145 TPWMDGVPMVTQCPIPSSTTFRYKFP-AMPSGTFFYHSHVGLQKMDGLEGSMIIRTPKTA 203
               DG   VTQCPI    ++ Y  P    +GT++YHSH+  Q +DGL G ++I  PK  
Sbjct: 91  NADDDGPAFVTQCPIVPQASYTYTMPLGDQTGTYWYHSHLSSQYVDGLRGPLVIYDPK-- 148

Query: 204 DPHAELYDFDLYSHVIIVTDWMHSMTDSKFPGNTYNDTRIKPDAILINGQNQNPKDNSPR 263
           DPH  LYD D    V+I+ DW H  T SK    T N T  +PD+  ING+ +   DN+P 
Sbjct: 149 DPHRRLYDIDDEKTVLIIGDWYH--TSSKAILATGNITLQQPDSATINGKGRFDPDNTPA 206

Query: 264 VP--MHFFKVQRDKRYLMRIIGGSCLACPLIFTIEKHQLQVIASDGTAVEPLVVDSVTLF 321
            P  ++  KV+R KRY +R+I  S +A     +I+ H++ VIA+DG + +P  VDS  + 
Sbjct: 207 NPNTLYTLKVKRGKRYRLRVINSSAIAS-FRMSIQGHKMTVIAADGVSTKPYQVDSFDIL 265

Query: 322 PGDRVDVIIHTNQSNNLYWMQAK-TLCDSITAEAVLQYEGEKLTY 365
            G R+D ++  NQ  + YW+ A  T   + TA+A+L YE ++  Y
Sbjct: 266 AGQRIDAVVEANQEPDTYWINAPLTNVANKTAQALLIYEDDRRPY 310
Lignin degradation and detoxification of lignin-derived products.
Thanatephorus cucumeris (taxid: 107832)
EC: 1EC: .EC: 1EC: 0EC: .EC: 3EC: .EC: 2
>sp|Q02081|LAC4_THACU Laccase-4 OS=Thanatephorus cucumeris GN=LCC4 PE=1 SV=1 Back     alignment and function description
>sp|P56193|LAC1_THACU Laccase-1 OS=Thanatephorus cucumeris GN=LCC1 PE=1 SV=1 Back     alignment and function description
>sp|Q99055|LAC4_TRAVI Laccase-4 OS=Trametes villosa GN=LCC4 PE=3 SV=1 Back     alignment and function description
>sp|Q12719|LAC4_TRAVE Laccase-4 OS=Trametes versicolor GN=LCC4 PE=3 SV=1 Back     alignment and function description
>sp|Q12541|LAC1_AGABI Laccase-1 OS=Agaricus bisporus GN=lcc1 PE=1 SV=1 Back     alignment and function description
>sp|Q12718|LAC2_TRAVE Laccase-2 OS=Trametes versicolor GN=LCC2 PE=1 SV=1 Back     alignment and function description
>sp|Q99046|LAC2_TRAVI Laccase-2 OS=Trametes villosa GN=LCC2 PE=3 SV=1 Back     alignment and function description
>sp|Q12542|LAC2_AGABI Laccase-2 OS=Agaricus bisporus GN=lcc2 PE=1 SV=1 Back     alignment and function description
>sp|Q02075|LAC2_THACU Laccase-2 OS=Thanatephorus cucumeris GN=LCC2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query445
261086629 619 laccase 17 [Reticulitermes flavipes] 0.797 0.573 0.436 2e-84
261086617 647 laccase 6 [Reticulitermes flavipes] 0.797 0.548 0.436 2e-84
261086627 647 laccase 15 [Reticulitermes flavipes] 0.797 0.548 0.436 3e-84
261086619 647 laccase 7 [Reticulitermes flavipes] 0.797 0.548 0.436 8e-84
261086625 647 laccase 14 [Reticulitermes flavipes] 0.797 0.548 0.436 8e-84
261086621 647 laccase 12 [Reticulitermes flavipes] 0.797 0.548 0.433 1e-83
261086631 647 laccase 19 [Reticulitermes flavipes] 0.797 0.548 0.433 2e-83
321470899 725 hypothetical protein DAPPUDRAFT_317026 [ 0.710 0.435 0.440 2e-80
380029116 728 PREDICTED: laccase-4-like [Apis florea] 0.779 0.476 0.421 4e-80
110761651 746 PREDICTED: laccase-4 [Apis mellifera] 0.779 0.465 0.418 4e-80
>gi|261086629|gb|ACX54564.1| laccase 17 [Reticulitermes flavipes] Back     alignment and taxonomy information
 Score =  319 bits (817), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 161/369 (43%), Positives = 222/369 (60%), Gaps = 14/369 (3%)

Query: 18  LMKYLQPNDVASGRYDNMSTAEAEKNNLCARPCDNAK-PLVCYYSFTLENYATVGPACAD 76
           L  YLQPND      D  +     K+N CAR C+  + P +CYY +T+ENY T+  AC +
Sbjct: 21  LNSYLQPND----DIDRNTYLLNAKSNNCARICNGTEAPKICYYQWTIENYVTLSEACDN 76

Query: 77  CLKGNQKACRRKGCVTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMIDREVTLH 136
           C   N  AC    C+TADG+ER+ILS+NR+LPGPSI+VC  D +IVD+ N+M  R  ++H
Sbjct: 77  C-PLNVTACYNAQCITADGYERSILSVNRKLPGPSIEVCLRDRVIVDITNNMAGRTTSIH 135

Query: 137 WHGVYQKVTPWMDGVPMVTQCPIPSSTTFRYKFPAMPSGTFFYHSHVGLQKMDGLEGSMI 196
           WHGV+QK + +MDGVPMVTQC I    TFRY F A   GT F+HSH GLQK+DG+ G+++
Sbjct: 136 WHGVFQKGSQYMDGVPMVTQCTIHEGDTFRYDFIANNEGTHFWHSHDGLQKLDGVTGNLV 195

Query: 197 IRTPKTADPHAELYDFDLYSHVIIVTDWMHSMTDSKFPGNTYNDTRIKPDAILINGQNQN 256
           +R PK  DP+ +LYDFDL  H I ++DW+H   D  FPG    +     ++ LING+ + 
Sbjct: 196 VRVPKNFDPNGQLYDFDLPEHKIFISDWLHLSADDHFPGLRATNPGQDANSFLINGRGRT 255

Query: 257 -PKDNSPRVPMHFFKVQRDKRYLMRIIGGSCLACPLIFTIEKHQLQVIASDGTAVEPLVV 315
                S   P     VQ  +RY +RI+G  C  CP   TI+ H++ VIA+DG +V P  V
Sbjct: 256 LIGTQSTNTPYAQINVQWGRRYRLRIVGSLCTVCPTQLTIDGHKITVIATDGNSVAPARV 315

Query: 316 DSVTLFPGDRVDVIIHTNQSNNLYWMQAKTLCDSITAE----AVLQYEG---EKLTYVSK 368
           DS+ ++ G+R DV++    +   YW+  K L   + +      VLQYE     KL  ++ 
Sbjct: 316 DSLIIYSGERYDVVLEATNTEGSYWIHLKGLVTCVGSRVYQLGVLQYENTTTNKLHALTP 375

Query: 369 RPKSDSFPR 377
            P  D FP+
Sbjct: 376 DPGYDGFPQ 384

Source: Reticulitermes flavipes

Species: Reticulitermes flavipes

Genus: Reticulitermes

Family: Rhinotermitidae

Order: Isoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|261086617|gb|ACX54558.1| laccase 6 [Reticulitermes flavipes] Back     alignment and taxonomy information
>gi|261086627|gb|ACX54563.1| laccase 15 [Reticulitermes flavipes] Back     alignment and taxonomy information
>gi|261086619|gb|ACX54559.1| laccase 7 [Reticulitermes flavipes] Back     alignment and taxonomy information
>gi|261086625|gb|ACX54562.1| laccase 14 [Reticulitermes flavipes] Back     alignment and taxonomy information
>gi|261086621|gb|ACX54560.1| laccase 12 [Reticulitermes flavipes] Back     alignment and taxonomy information
>gi|261086631|gb|ACX54565.1| laccase 19 [Reticulitermes flavipes] Back     alignment and taxonomy information
>gi|321470899|gb|EFX81873.1| hypothetical protein DAPPUDRAFT_317026 [Daphnia pulex] Back     alignment and taxonomy information
>gi|380029116|ref|XP_003698228.1| PREDICTED: laccase-4-like [Apis florea] Back     alignment and taxonomy information
>gi|110761651|ref|XP_393845.3| PREDICTED: laccase-4 [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query445
FB|FBgn0032116 959 Mco1 "Multicopper oxidase-1" [ 0.519 0.240 0.497 3.6e-75
FB|FBgn0259247 784 laccase2 "laccase 2" [Drosophi 0.8 0.454 0.398 2.2e-73
FB|FBgn0052557 645 CG32557 [Drosophila melanogast 0.671 0.463 0.369 2.9e-55
FB|FBgn0039387 677 MCO3 "multicopper oxidase 3" [ 0.698 0.459 0.342 2.1e-54
UNIPROTKB|D0VWU3 499 D0VWU3 "Laccase" [Trametes max 0.570 0.509 0.340 3.7e-39
ASPGD|ASPL0000035520 570 lccB [Emericella nidulans (tax 0.582 0.454 0.346 2.6e-38
TAIR|locus:2135242 582 AT4G39830 [Arabidopsis thalian 0.649 0.496 0.318 9.5e-36
TAIR|locus:2178973 573 AT5G21100 [Arabidopsis thalian 0.530 0.411 0.338 1.8e-35
UNIPROTKB|G4NBF8 747 MGG_17429 "Uncharacterized pro 0.579 0.345 0.338 7.1e-33
TAIR|locus:505006625 588 AT5G21105 [Arabidopsis thalian 0.534 0.404 0.329 2e-32
FB|FBgn0032116 Mco1 "Multicopper oxidase-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 619 (223.0 bits), Expect = 3.6e-75, Sum P(2) = 3.6e-75
 Identities = 117/235 (49%), Positives = 156/235 (66%)

Query:    22 LQPNDVASGRYDNMSTAEAEKNNLCARPCD-NAKPLVCYYSFTLENYATVGPACADCLKG 80
             LQ N VA    D++ TAE  +N+ C R C   A+P+ C Y F +E Y T   AC DC + 
Sbjct:   223 LQDN-VAEST-DDIWTAEWYRNHPCNRDCQVGAEPMTCRYKFVVEWYQTFSKACYDCPR- 279

Query:    81 NQKACRRKGCVTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMIDREVTLHWHGV 140
             N   C R  CV  DG ER+I  +NR +PGP+I+VC+GD I+VDVKNH++    ++HWHG+
Sbjct:   280 NLTDCSRPHCVMGDGLERSITVVNRMMPGPAIEVCEGDEIVVDVKNHLLGESTSIHWHGL 339

Query:   141 YQKVTPWMDGVPMVTQCPIPSSTTFRYKFPAMPSGTFFYHSHVGLQKMDGLEGSMIIRTP 200
             +QK TP+MDGVP +TQCPI    TFRY FPA  SGT F+HSH G+Q+ DG+  ++IIR P
Sbjct:   340 HQKKTPYMDGVPHITQCPITPHATFRYSFPADLSGTHFWHSHTGMQRGDGVFSALIIRKP 399

Query:   201 KTADPHAELYDFDLYSHVIIVTDWMHSMTDSKFPGNTYNDTRIKPDAILINGQNQ 255
             KTA+PH  LYDFDL  HV+IV DW+H    S F  + ++    KP  +L+NG+ +
Sbjct:   400 KTAEPHGGLYDFDLSEHVMIVQDWIHDTGASIFSYHHHSRGDNKPHNLLVNGKGR 454
GO:0005381 "iron ion transmembrane transporter activity" evidence=ISS
GO:0004322 "ferroxidase activity" evidence=ISS;IDA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005507 "copper ion binding" evidence=IEA
GO:0031233 "intrinsic to external side of plasma membrane" evidence=ISM
GO:0009986 "cell surface" evidence=IDA
GO:0055072 "iron ion homeostasis" evidence=IMP
GO:0045178 "basal part of cell" evidence=IDA
FB|FBgn0259247 laccase2 "laccase 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0052557 CG32557 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0039387 MCO3 "multicopper oxidase 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|D0VWU3 D0VWU3 "Laccase" [Trametes maxima (taxid:259368)] Back     alignment and assigned GO terms
ASPGD|ASPL0000035520 lccB [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TAIR|locus:2135242 AT4G39830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2178973 AT5G21100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G4NBF8 MGG_17429 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
TAIR|locus:505006625 AT5G21105 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query445
TIGR03388 541 TIGR03388, ascorbase, L-ascorbate oxidase, plant t 2e-52
PLN02604 566 PLN02604, PLN02604, oxidoreductase 2e-46
pfam07732119 pfam07732, Cu-oxidase_3, Multicopper oxidase 9e-43
PLN02191 574 PLN02191, PLN02191, L-ascorbate oxidase 9e-42
TIGR03389 539 TIGR03389, laccase, laccase, plant 5e-40
COG2132451 COG2132, SufI, Putative multicopper oxidases [Seco 1e-38
TIGR03390 538 TIGR03390, ascorbOXfungal, L-ascorbate oxidase, fu 1e-34
PLN02354 552 PLN02354, PLN02354, copper ion binding / oxidoredu 2e-28
pfam00394146 pfam00394, Cu-oxidase, Multicopper oxidase 1e-24
TIGR01480 587 TIGR01480, copper_res_A, copper-resistance protein 1e-24
PLN02835 539 PLN02835, PLN02835, oxidoreductase 1e-23
PLN02792 536 PLN02792, PLN02792, oxidoreductase 6e-18
PLN02168 545 PLN02168, PLN02168, copper ion binding / pectinest 4e-17
PLN00044 596 PLN00044, PLN00044, multi-copper oxidase-related p 3e-16
PLN02991 543 PLN02991, PLN02991, oxidoreductase 2e-14
PRK10965 523 PRK10965, PRK10965, multicopper oxidase; Provision 2e-10
pfam00394146 pfam00394, Cu-oxidase, Multicopper oxidase 9e-10
TIGR03389 539 TIGR03389, laccase, laccase, plant 3e-04
>gnl|CDD|234193 TIGR03388, ascorbase, L-ascorbate oxidase, plant type Back     alignment and domain information 
 Score =  183 bits (467), Expect = 2e-52
 Identities = 99/302 (32%), Positives = 147/302 (48%), Gaps = 32/302 (10%)

Query: 94  DGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMIDREVTLHWHGVYQKVTPWMDGVPM 153
           D FE+ ++ IN Q PGP+I+   GDTI+V++ N +    V +HWHG+ Q  TPW DG   
Sbjct: 16  DCFEKLVIGINGQFPGPTIRAQAGDTIVVELTNKLHTEGVVIHWHGIRQIGTPWADGTAG 75

Query: 154 VTQCPIPSSTTFRYKFPAMPSGTFFYHSHVGLQKMDGLEGSMIIRTPKTADPHAELYDFD 213
           VTQC I    TF Y F     GT+FYH H G+Q+  GL GS+I+  P   +     YD +
Sbjct: 76  VTQCAINPGETFIYNFVVDRPGTYFYHGHYGMQRSAGLYGSLIVDVPDG-EKEPFHYDGE 134

Query: 214 LYSHVIIVTDWMHSMTDSKFPGNTYNDTRI--KPDAILINGQNQ-----NPKDNSPRVPM 266
                ++++DW H     +  G +    R   +P ++LING+ Q       K +S  +P 
Sbjct: 135 ---FNLLLSDWWHKSIHEQEVGLSSKPMRWIGEPQSLLINGRGQFNCSLAAKFSSTNLPQ 191

Query: 267 -----------HFFKVQRDKRYLMRIIGGSCLACPLIFTIEKHQLQVIASDGTAVEPLVV 315
                          V+  K Y +RI   + LA  L F IE H+L V+ +DG  VEP  V
Sbjct: 192 CNLKGNEQCAPQILHVEPGKTYRLRIASTTALAA-LNFAIEGHKLTVVEADGNYVEPFTV 250

Query: 316 DSVTLFPGDRVDVIIHTNQ--SNNLYWMQAKTLC---DSITAEAVLQYEGEKLTYVSKRP 370
             + ++ G+   V++ T+Q  S N YW+         ++     VL Y        S+ P
Sbjct: 251 KDIDIYSGETYSVLLTTDQDPSRN-YWISVGVRGRKPNTPPGLTVLNYYP---NSPSRLP 306

Query: 371 KS 372
            +
Sbjct: 307 PT 308

Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases. Length = 541
>gnl|CDD|215324 PLN02604, PLN02604, oxidoreductase Back     alignment and domain information
>gnl|CDD|219542 pfam07732, Cu-oxidase_3, Multicopper oxidase Back     alignment and domain information
>gnl|CDD|177843 PLN02191, PLN02191, L-ascorbate oxidase Back     alignment and domain information
>gnl|CDD|234194 TIGR03389, laccase, laccase, plant Back     alignment and domain information
>gnl|CDD|225043 COG2132, SufI, Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|132431 TIGR03390, ascorbOXfungal, L-ascorbate oxidase, fungal type Back     alignment and domain information
>gnl|CDD|177987 PLN02354, PLN02354, copper ion binding / oxidoreductase Back     alignment and domain information
>gnl|CDD|215896 pfam00394, Cu-oxidase, Multicopper oxidase Back     alignment and domain information
>gnl|CDD|233432 TIGR01480, copper_res_A, copper-resistance protein, CopA family Back     alignment and domain information
>gnl|CDD|178429 PLN02835, PLN02835, oxidoreductase Back     alignment and domain information
>gnl|CDD|178389 PLN02792, PLN02792, oxidoreductase Back     alignment and domain information
>gnl|CDD|215113 PLN02168, PLN02168, copper ion binding / pectinesterase Back     alignment and domain information
>gnl|CDD|165622 PLN00044, PLN00044, multi-copper oxidase-related protein; Provisional Back     alignment and domain information
>gnl|CDD|215536 PLN02991, PLN02991, oxidoreductase Back     alignment and domain information
>gnl|CDD|236810 PRK10965, PRK10965, multicopper oxidase; Provisional Back     alignment and domain information
>gnl|CDD|215896 pfam00394, Cu-oxidase, Multicopper oxidase Back     alignment and domain information
>gnl|CDD|234194 TIGR03389, laccase, laccase, plant Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 445
PLN02835 539 oxidoreductase 100.0
PLN02991 543 oxidoreductase 100.0
PLN02168 545 copper ion binding / pectinesterase 100.0
PLN02354 552 copper ion binding / oxidoreductase 100.0
PLN00044 596 multi-copper oxidase-related protein; Provisional 100.0
PLN02792 536 oxidoreductase 100.0
TIGR03389 539 laccase laccase, plant. Members of this protein fa 100.0
TIGR03388 541 ascorbase L-ascorbate oxidase, plant type. Members 100.0
PLN02191 574 L-ascorbate oxidase 100.0
TIGR03390 538 ascorbOXfungal L-ascorbate oxidase, fungal type. T 100.0
PLN02604 566 oxidoreductase 100.0
KOG1263|consensus 563 100.0
TIGR01480 587 copper_res_A copper-resistance protein, CopA famil 100.0
PRK10965523 multicopper oxidase; Provisional 100.0
PRK10883471 FtsI repressor; Provisional 100.0
TIGR02376311 Cu_nitrite_red nitrite reductase, copper-containin 100.0
COG2132451 SufI Putative multicopper oxidases [Secondary meta 100.0
PF07732117 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR01 100.0
PF00394159 Cu-oxidase: Multicopper oxidase; InterPro: IPR0011 99.94
PLN02354 552 copper ion binding / oxidoreductase 99.88
PLN02168 545 copper ion binding / pectinesterase 99.88
PLN02835 539 oxidoreductase 99.88
PLN02792 536 oxidoreductase 99.88
PLN00044 596 multi-copper oxidase-related protein; Provisional 99.88
TIGR03389 539 laccase laccase, plant. Members of this protein fa 99.87
PLN02991 543 oxidoreductase 99.87
PLN02191 574 L-ascorbate oxidase 99.87
TIGR03388 541 ascorbase L-ascorbate oxidase, plant type. Members 99.86
PLN02604 566 oxidoreductase 99.86
TIGR03390 538 ascorbOXfungal L-ascorbate oxidase, fungal type. T 99.85
KOG1263|consensus 563 99.84
TIGR03095148 rusti_cyanin rusticyanin. Rusticyanin is a blue co 99.82
TIGR01480 587 copper_res_A copper-resistance protein, CopA famil 99.82
PRK10965 523 multicopper oxidase; Provisional 99.77
PRK10883 471 FtsI repressor; Provisional 99.74
TIGR02376311 Cu_nitrite_red nitrite reductase, copper-containin 99.71
COG2132 451 SufI Putative multicopper oxidases [Secondary meta 99.46
PF07732117 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR01 99.25
TIGR03096135 nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de 99.08
PF07731138 Cu-oxidase_2: Multicopper oxidase; InterPro: IPR01 98.83
PF00394159 Cu-oxidase: Multicopper oxidase; InterPro: IPR0011 98.82
PF07731138 Cu-oxidase_2: Multicopper oxidase; InterPro: IPR01 98.65
TIGR03095148 rusti_cyanin rusticyanin. Rusticyanin is a blue co 98.28
TIGR0265699 cyanin_plasto plastocyanin. Members of this family 98.24
PF0012799 Copper-bind: Copper binding proteins, plastocyanin 98.07
PRK02710119 plastocyanin; Provisional 97.99
TIGR03096135 nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de 97.84
PF13473104 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 97.74
TIGR0265783 amicyanin amicyanin. Members of this family are am 97.71
PRK02888635 nitrous-oxide reductase; Validated 97.7
TIGR02375116 pseudoazurin pseudoazurin. Pseudoazurin, also call 97.37
TIGR03094195 sulfo_cyanin sulfocyanin. Members of this family a 97.2
TIGR03102115 halo_cynanin halocyanin domain. Halocyanins are bl 97.19
COG3794128 PetE Plastocyanin [Energy production and conversio 97.05
PF06525196 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb 96.97
PF13473104 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 96.53
TIGR0265699 cyanin_plasto plastocyanin. Members of this family 96.29
PRK02888635 nitrous-oxide reductase; Validated 95.52
PF06525196 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb 95.22
PRK02710119 plastocyanin; Provisional 94.45
PF0012799 Copper-bind: Copper binding proteins, plastocyanin 93.52
COG4454158 Uncharacterized copper-binding protein [Inorganic 92.15
PF00116120 COX2: Cytochrome C oxidase subunit II, periplasmic 92.1
PF00116120 COX2: Cytochrome C oxidase subunit II, periplasmic 90.74
PF1269082 BsuPI: Intracellular proteinase inhibitor; InterPr 90.33
TIGR02375116 pseudoazurin pseudoazurin. Pseudoazurin, also call 89.41
COG3794128 PetE Plastocyanin [Energy production and conversio 89.29
TIGR0265783 amicyanin amicyanin. Members of this family are am 88.55
TIGR03102115 halo_cynanin halocyanin domain. Halocyanins are bl 87.98
TIGR02695125 azurin azurin. Azurin is a blue copper-binding pro 85.7
TIGR02695125 azurin azurin. Azurin is a blue copper-binding pro 84.69
TIGR03094195 sulfo_cyanin sulfocyanin. Members of this family a 83.51
COG4454158 Uncharacterized copper-binding protein [Inorganic 82.66
>PLN02835 oxidoreductase Back     alignment and domain information 
Probab=100.00  E-value=1.6e-69  Score=568.94  Aligned_cols=266  Identities=29%  Similarity=0.510  Sum_probs=230.5

Q ss_pred             CceEEEEEEEEEeeecCccccccCCCcccccccceeecCCCeEEEEEEECCCCCCCeEEEEcCCEEEEEEEecCCCCCce
Q psy16562         55 PLVCYYSFTLENYATVGPACADCLKGNQKACRRKGCVTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMIDREVT  134 (445)
Q Consensus        55 p~~~~y~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dG~~~~~~~~Ng~~PGPtI~v~~GD~v~V~v~N~l~~~~ts  134 (445)
                      .++++|+|+|++.                      .+.+||+++.+|+|||++|||+|++++||+|+|+|+|+|+ ++|+
T Consensus        27 ~~~~~y~~~v~~~----------------------~~~~dg~~~~~~~~NG~~PGP~I~~~~GD~v~v~v~N~L~-~~tt   83 (539)
T PLN02835         27 DPYKYYTWTVTYG----------------------TISPLGVPQQVILINGQFPGPRLDVVTNDNIILNLINKLD-QPFL   83 (539)
T ss_pred             CcEEEEEEEEEEE----------------------EeccCCeEEEEEEECCcCCCCCEEEECCCEEEEEEEeCCC-CCCc
Confidence            4789999999974                      3568999999999999999999999999999999999998 8999


Q ss_pred             EeeCCcccCCCCCCCCCCcccccCCCCCCceEEEEec-CCCcceEEecccchhhhcCceeEEEEeCCCCCCCCCCcc-cc
Q psy16562        135 LHWHGVYQKVTPWMDGVPMVTQCPIPSSTTFRYKFPA-MPSGTFFYHSHVGLQKMDGLEGSMIIRTPKTADPHAELY-DF  212 (445)
Q Consensus       135 iHwHG~~~~~~~~~DGvp~~tq~pI~pG~~~~Y~f~~-~~~GT~wYH~H~~~q~~~Gl~G~lIV~~~~~~~p~~~~~-d~  212 (445)
                      |||||++|++++||||+++ |||||+||++|+|+|++ +++||||||||++.|+++||+|+|||++++.. +.  +| .+
T Consensus        84 iHWHGl~~~~~~~~DGv~~-tQ~pI~PG~sf~Y~F~~~~q~GT~WYHsH~~~q~~~Gl~G~lIV~~~~~~-~~--p~~~~  159 (539)
T PLN02835         84 LTWNGIKQRKNSWQDGVLG-TNCPIPPNSNYTYKFQTKDQIGTFTYFPSTLFHKAAGGFGAINVYERPRI-PI--PFPLP  159 (539)
T ss_pred             EEeCCcccCCCCCCCCCcc-CcCCCCCCCcEEEEEEECCCCEeEEEEeCccchhcCcccceeEEeCCCCC-Cc--CCCCC
Confidence            9999999999999999999 99999999999999997 48999999999999999999999999865322 21  12 12


Q ss_pred             CCcceEEEEeeeeccCCCCccCCCC-CCCCCCCCCeEEEccccCCCCCCCCCcccceEEEecCcEEEEEEEccCCCceeE
Q psy16562        213 DLYSHVIIVTDWMHSMTDSKFPGNT-YNDTRIKPDAILINGQNQNPKDNSPRVPMHFFKVQRDKRYLMRIIGGSCLACPL  291 (445)
Q Consensus       213 d~~e~~l~l~D~~~~~~~~~~~~~~-~~~~~~~~~~~lING~~~~~~~~~~~~p~~~i~v~~G~~~rlRliN~~~~~~~~  291 (445)
                      | .|++|+|+||++..... +...+ .......++++||||+..           +.++|++|++|||||||++.. ..+
T Consensus       160 d-~e~~l~l~Dw~~~~~~~-~~~~~~~g~~~~~~d~~liNG~~~-----------~~~~v~~G~~yRlRliNa~~~-~~~  225 (539)
T PLN02835        160 D-GDFTLLVGDWYKTSHKT-LQQRLDSGKVLPFPDGVLINGQTQ-----------STFSGDQGKTYMFRISNVGLS-TSL  225 (539)
T ss_pred             C-ceEEEEeeccccCCHHH-HHHHhhcCCCCCCCceEEEccccC-----------ceEEECCCCEEEEEEEEcCCC-ccE
Confidence            3 37999999999986533 21111 122235789999999965           379999999999999999987 489


Q ss_pred             EEEecccceEEEccCCCcceeeEecEEEecCCceEEEEEecCCCCceEEEEEEec--CCCceeeEEEEEcCC
Q psy16562        292 IFTIEKHQLQVIASDGTAVEPLVVDSVTLFPGDRVDVIIHTNQSNNLYWMQAKTL--CDSITAEAVLQYEGE  361 (445)
Q Consensus       292 ~~~i~gh~~~via~DG~~v~P~~~~~~~I~pGeR~dv~v~~~~~~G~y~~~~~~~--~~~~~~~ail~y~~~  361 (445)
                      .|+|+||.|+||++||++++|..++.+.|++||||||+|++++.+|+|||++...  +....+.|+|+|.+.
T Consensus       226 ~f~i~gH~~~VI~~DG~~v~p~~~~~l~i~~GqRydvlv~~~~~~g~y~i~a~~~~~~~~~~~~ail~Y~~~  297 (539)
T PLN02835        226 NFRIQGHTMKLVEVEGSHTIQNIYDSLDVHVGQSVAVLVTLNQSPKDYYIVASTRFTRQILTATAVLHYSNS  297 (539)
T ss_pred             EEEECCCEEEEEEECCccCCCceeeEEEECcCceEEEEEEcCCCCCcEEEEEEccccCCCcceEEEEEECCC
Confidence            9999999999999999999999999999999999999999999889999998654  455678999999875

>PLN02991 oxidoreductase Back     alignment and domain information
>PLN02168 copper ion binding / pectinesterase Back     alignment and domain information
>PLN02354 copper ion binding / oxidoreductase Back     alignment and domain information
>PLN00044 multi-copper oxidase-related protein; Provisional Back     alignment and domain information
>PLN02792 oxidoreductase Back     alignment and domain information
>TIGR03389 laccase laccase, plant Back     alignment and domain information
>TIGR03388 ascorbase L-ascorbate oxidase, plant type Back     alignment and domain information
>PLN02191 L-ascorbate oxidase Back     alignment and domain information
>TIGR03390 ascorbOXfungal L-ascorbate oxidase, fungal type Back     alignment and domain information
>PLN02604 oxidoreductase Back     alignment and domain information
>KOG1263|consensus Back     alignment and domain information
>TIGR01480 copper_res_A copper-resistance protein, CopA family Back     alignment and domain information
>PRK10965 multicopper oxidase; Provisional Back     alignment and domain information
>PRK10883 FtsI repressor; Provisional Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information
>COG2132 SufI Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF07732 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR011707 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>PF00394 Cu-oxidase: Multicopper oxidase; InterPro: IPR001117 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>PLN02354 copper ion binding / oxidoreductase Back     alignment and domain information
>PLN02168 copper ion binding / pectinesterase Back     alignment and domain information
>PLN02835 oxidoreductase Back     alignment and domain information
>PLN02792 oxidoreductase Back     alignment and domain information
>PLN00044 multi-copper oxidase-related protein; Provisional Back     alignment and domain information
>TIGR03389 laccase laccase, plant Back     alignment and domain information
>PLN02991 oxidoreductase Back     alignment and domain information
>PLN02191 L-ascorbate oxidase Back     alignment and domain information
>TIGR03388 ascorbase L-ascorbate oxidase, plant type Back     alignment and domain information
>PLN02604 oxidoreductase Back     alignment and domain information
>TIGR03390 ascorbOXfungal L-ascorbate oxidase, fungal type Back     alignment and domain information
>KOG1263|consensus Back     alignment and domain information
>TIGR03095 rusti_cyanin rusticyanin Back     alignment and domain information
>TIGR01480 copper_res_A copper-resistance protein, CopA family Back     alignment and domain information
>PRK10965 multicopper oxidase; Provisional Back     alignment and domain information
>PRK10883 FtsI repressor; Provisional Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information
>COG2132 SufI Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF07732 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR011707 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>TIGR03096 nitroso_cyanin nitrosocyanin Back     alignment and domain information
>PF07731 Cu-oxidase_2: Multicopper oxidase; InterPro: IPR011706 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>PF00394 Cu-oxidase: Multicopper oxidase; InterPro: IPR001117 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>PF07731 Cu-oxidase_2: Multicopper oxidase; InterPro: IPR011706 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>TIGR03095 rusti_cyanin rusticyanin Back     alignment and domain information
>TIGR02656 cyanin_plasto plastocyanin Back     alignment and domain information
>PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>PRK02710 plastocyanin; Provisional Back     alignment and domain information
>TIGR03096 nitroso_cyanin nitrosocyanin Back     alignment and domain information
>PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D Back     alignment and domain information
>TIGR02657 amicyanin amicyanin Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>TIGR02375 pseudoazurin pseudoazurin Back     alignment and domain information
>TIGR03094 sulfo_cyanin sulfocyanin Back     alignment and domain information
>TIGR03102 halo_cynanin halocyanin domain Back     alignment and domain information
>COG3794 PetE Plastocyanin [Energy production and conversion] Back     alignment and domain information
>PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus Back     alignment and domain information
>PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D Back     alignment and domain information
>TIGR02656 cyanin_plasto plastocyanin Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus Back     alignment and domain information
>PRK02710 plastocyanin; Provisional Back     alignment and domain information
>PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00116 COX2: Cytochrome C oxidase subunit II, periplasmic domain This family corresponds to chains b and o Back     alignment and domain information
>PF00116 COX2: Cytochrome C oxidase subunit II, periplasmic domain This family corresponds to chains b and o Back     alignment and domain information
>PF12690 BsuPI: Intracellular proteinase inhibitor; InterPro: IPR020481 BsuPI is a intracellular proteinase inhibitor that directly regulates the major intracellular proteinase (ISP-1) activity in vivo Back     alignment and domain information
>TIGR02375 pseudoazurin pseudoazurin Back     alignment and domain information
>COG3794 PetE Plastocyanin [Energy production and conversion] Back     alignment and domain information
>TIGR02657 amicyanin amicyanin Back     alignment and domain information
>TIGR03102 halo_cynanin halocyanin domain Back     alignment and domain information
>TIGR02695 azurin azurin Back     alignment and domain information
>TIGR02695 azurin azurin Back     alignment and domain information
>TIGR03094 sulfo_cyanin sulfocyanin Back     alignment and domain information
>COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query445
2hzh_A 499 Crystal Structure Of Laccase From Coriolus Zonatus 6e-44
2qt6_A 498 Crystal Structure Determination Of A Blue Laccase F 8e-44
2qt6_A 498 Crystal Structure Determination Of A Blue Laccase F 1e-05
1gyc_A 499 Crystal Structure Determination At Room Temperature 1e-43
1gyc_A 499 Crystal Structure Determination At Room Temperature 6e-05
3kw7_A 502 Crystal Structure Of Lacb From Trametes Sp. Ah28-2 9e-43
3kw7_A 502 Crystal Structure Of Lacb From Trametes Sp. Ah28-2 4e-04
3fpx_A 499 Native Fungus Laccase From Trametes Hirsuta Length 1e-41
3pxl_A 499 Type-2 Cu-Depleted Fungus Laccase From Trametes Hir 1e-41
1a65_A 504 Type-2 Cu-depleted Laccase From Coprinus Cinereus L 1e-41
1a65_A 504 Type-2 Cu-depleted Laccase From Coprinus Cinereus L 7e-04
1hfu_A 503 Type-2 Cu-Depleted Laccase From Coprinus Cinereus A 1e-41
1hfu_A 503 Type-2 Cu-Depleted Laccase From Coprinus Cinereus A 7e-04
1kya_A 499 Active Laccase From Trametes Versicolor Complexed W 3e-41
3div_A 499 Crystal Structure Of Laccase From Cerrena Maxima At 5e-41
4a2f_A 497 Coriolopsis Gallica Laccase Collected At 12.65 Kev 8e-40
4a2d_A 496 Coriolopsis Gallica Laccase T2 Copper Depleted At P 8e-40
2hrg_A 496 Crystal Structure Of Blue Laccase From Trametes Tro 2e-39
2xyb_A 497 Crystal Structure Of A Fully Functional Laccase Fro 5e-38
2h5u_A 499 Crystal Structure Of Laccase From Cerrena Maxima At 6e-38
3t6v_A 495 Crystal Structure Of Laccase From Steccherinum Ochr 7e-38
3t6v_A 495 Crystal Structure Of Laccase From Steccherinum Ochr 4e-04
1v10_A 521 Structure Of Rigidoporus Lignosus Laccase From Hemi 3e-37
1v10_A 521 Structure Of Rigidoporus Lignosus Laccase From Hemi 9e-06
1aoz_A 552 Refined Crystal Structure Of Ascorbate Oxidase At 1 1e-36
3sqr_A 580 Crystal Structure Of Laccase From Botrytis Aclada A 3e-35
3v9e_A 580 Structure Of The L513m Mutant Of The Laccase From B 3e-35
1zpu_A 534 Crystal Structure Of Fet3p, A Multicopper Oxidase T 6e-26
3dkh_A 559 L559a Mutant Of Melanocarpus Albomyces Laccase Leng 3e-25
1gw0_A 559 Crystal Structure Of Laccase From Melanocarpus Albo 3e-25
2q9o_A 559 Near-Atomic Resolution Structure Of A Melanocarpus 8e-25
3pps_A 604 Crystal Structure Of An Ascomycete Fungal Laccase F 8e-23
3g5w_A318 Crystal Structure Of Blue Copper Oxidase From Nitro 9e-21
3zx1_A481 Multicopper Oxidase From Campylobacter Jejuni: A Me 1e-13
2xu9_A439 Crystal Structure Of Laccase From Thermus Thermophi 5e-12
3gdc_A288 Crystal Structure Of Multicopper Oxidase Length = 2 3e-08
3nsy_A 511 The Multi-Copper Oxidase Cueo With Six Met To Ser M 2e-07
2yxv_A446 The Deletion Mutant Of Multicopper Oxidase Cueo Len 2e-07
1pf3_A 498 Crystal Structure Of The M441l Mutant Of The Multic 2e-07
3qqx_A 505 Reduced Native Intermediate Of The Multicopper Oxid 2e-07
3nsc_A 505 C500s Mutant Of Cueo Bound To Cu(Ii) Length = 505 2e-07
1kv7_A 488 Crystal Structure Of Cueo, A Multi-Copper Oxidase F 2e-07
3nsf_A 505 Apo Form Of The Multicopper Oxidase Cueo Length = 5 3e-07
3uaa_A 489 Multicopper Oxidase Cueo Mutant C500se506q (Data1) 3e-07
3tas_A313 Small Laccase From Streptomyces Viridosporus T7a Le 4e-04
4gy4_A278 Role Of The Biradical Intermediate Observed During 7e-04
3cg8_A343 Laccase From Streptomyces Coelicolor Length = 343 7e-04
>pdb|2HZH|A Chain A, Crystal Structure Of Laccase From Coriolus Zonatus At 2.6 A Resolution Length = 499 Back     alignment and structure 
Iteration: 1

 Score =  175 bits (443), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 102/290 (35%), Positives = 147/290 (50%), Gaps = 27/290 (9%)
Query: 88  KGCVTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMID----REVTLHWHGVYQK 143
              V ADG  R  + +N   PGP I   KGD   ++V N++ +    +  ++HWHG +QK
Sbjct: 12  NAAVAADGHSRDAVVVNGGTPGPLITGNKGDQFQLNVINNLTNFTMLKSTSVHWHGFFQK 71
Query: 144 VTPWMDGVPMVTQCPIPSSTTFRYKFPA-MPSGTFFYHSHVGLQKMDGLEGSMIIRTPKT 202
            T W DG   V QCPI + ++F Y F   + +GTF+YHSH+  Q  DG  G  ++  P  
Sbjct: 72  GTNWADGPAFVNQCPIAAGSSFLYDFSTPIQAGTFWYHSHLSTQYCDGDRGPFVVYDPN- 130
Query: 203 ADPHAELYDFDLYSHVIIVTDWMHSMTDS--KFPGNTYNDTRIKPDAILINGQNQNPKDN 260
            DP A LYD D  + VI +TDW H+   +    PG          DA LINGQ + P   
Sbjct: 131 -DPSANLYDVDNLNTVITLTDWYHTAAQNGPAKPGGA--------DATLINGQGRGPS-- 179
Query: 261 SPRVPMHFFKVQRDKRYLMRIIGGSCLACPLIFTIEKHQLQVIASDGTAVEPLVVDSVTL 320
           SP   +    V   KRY  R++  SC      F+I+ HQ+ +I  D   V+PLVV  + +
Sbjct: 180 SPSADLAVISVTAGKRYRFRLVSNSCDPN-YTFSIDGHQMTIIQVDSINVQPLVVLKIQI 238
Query: 321 FPGDRVDVIIHTNQSNNLYWMQAK------TLCDSITAEAVLQYEGEKLT 364
           +   R   I++ NQ+ N YW++A          + I + A+L+Y G   T
Sbjct: 239 YAAQRYSFILNANQAVNNYWIRANPNQGNVGFTNGINS-AILRYSGAAAT 287
>pdb|2QT6|A Chain A, Crystal Structure Determination Of A Blue Laccase From Lentinus Tigrinus Length = 498 Back     alignment and structure
>pdb|2QT6|A Chain A, Crystal Structure Determination Of A Blue Laccase From Lentinus Tigrinus Length = 498 Back     alignment and structure
>pdb|1GYC|A Chain A, Crystal Structure Determination At Room Temperature Of A Laccase From Trametes Versicolor In Its Oxidised Form Containing A Full Complement Of Copper Ions Length = 499 Back     alignment and structure
>pdb|1GYC|A Chain A, Crystal Structure Determination At Room Temperature Of A Laccase From Trametes Versicolor In Its Oxidised Form Containing A Full Complement Of Copper Ions Length = 499 Back     alignment and structure
>pdb|3KW7|A Chain A, Crystal Structure Of Lacb From Trametes Sp. Ah28-2 Length = 502 Back     alignment and structure
>pdb|3KW7|A Chain A, Crystal Structure Of Lacb From Trametes Sp. Ah28-2 Length = 502 Back     alignment and structure
>pdb|3FPX|A Chain A, Native Fungus Laccase From Trametes Hirsuta Length = 499 Back     alignment and structure
>pdb|3PXL|A Chain A, Type-2 Cu-Depleted Fungus Laccase From Trametes Hirsuta Length = 499 Back     alignment and structure
>pdb|1A65|A Chain A, Type-2 Cu-depleted Laccase From Coprinus Cinereus Length = 504 Back     alignment and structure
>pdb|1A65|A Chain A, Type-2 Cu-depleted Laccase From Coprinus Cinereus Length = 504 Back     alignment and structure
>pdb|1HFU|A Chain A, Type-2 Cu-Depleted Laccase From Coprinus Cinereus At 1.68 A Resolution Length = 503 Back     alignment and structure
>pdb|1HFU|A Chain A, Type-2 Cu-Depleted Laccase From Coprinus Cinereus At 1.68 A Resolution Length = 503 Back     alignment and structure
>pdb|1KYA|A Chain A, Active Laccase From Trametes Versicolor Complexed With 2,5-Xylidine Length = 499 Back     alignment and structure
>pdb|3DIV|A Chain A, Crystal Structure Of Laccase From Cerrena Maxima At 1.76a Resolution Length = 499 Back     alignment and structure
>pdb|4A2F|A Chain A, Coriolopsis Gallica Laccase Collected At 12.65 Kev Length = 497 Back     alignment and structure
>pdb|4A2D|A Chain A, Coriolopsis Gallica Laccase T2 Copper Depleted At Ph 4.5 Length = 496 Back     alignment and structure
>pdb|2HRG|A Chain A, Crystal Structure Of Blue Laccase From Trametes Trogii Complexed With P-Methylbenzoate Length = 496 Back     alignment and structure
>pdb|2XYB|A Chain A, Crystal Structure Of A Fully Functional Laccase From The Ligninolytic Fungus Pycnoporus Cinnabarinus Length = 497 Back     alignment and structure
>pdb|2H5U|A Chain A, Crystal Structure Of Laccase From Cerrena Maxima At 1.9a Resolution Length = 499 Back     alignment and structure
>pdb|3T6V|A Chain A, Crystal Structure Of Laccase From Steccherinum Ochraceum Length = 495 Back     alignment and structure
>pdb|3T6V|A Chain A, Crystal Structure Of Laccase From Steccherinum Ochraceum Length = 495 Back     alignment and structure
>pdb|1V10|A Chain A, Structure Of Rigidoporus Lignosus Laccase From Hemihedrally Twinned Crystals Length = 521 Back     alignment and structure
>pdb|1V10|A Chain A, Structure Of Rigidoporus Lignosus Laccase From Hemihedrally Twinned Crystals Length = 521 Back     alignment and structure
>pdb|1AOZ|A Chain A, Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution Length = 552 Back     alignment and structure
>pdb|3SQR|A Chain A, Crystal Structure Of Laccase From Botrytis Aclada At 1.67 A Resolution Length = 580 Back     alignment and structure
>pdb|3V9E|A Chain A, Structure Of The L513m Mutant Of The Laccase From B.aclada Length = 580 Back     alignment and structure
>pdb|1ZPU|A Chain A, Crystal Structure Of Fet3p, A Multicopper Oxidase That Functions In Iron Import Length = 534 Back     alignment and structure
>pdb|3DKH|A Chain A, L559a Mutant Of Melanocarpus Albomyces Laccase Length = 559 Back     alignment and structure
>pdb|1GW0|A Chain A, Crystal Structure Of Laccase From Melanocarpus Albomyces In Four Copper Form Length = 559 Back     alignment and structure
>pdb|2Q9O|A Chain A, Near-Atomic Resolution Structure Of A Melanocarpus Albomyces Laccase Length = 559 Back     alignment and structure
>pdb|3PPS|A Chain A, Crystal Structure Of An Ascomycete Fungal Laccase From Thielavia Arenaria Length = 604 Back     alignment and structure
>pdb|3G5W|A Chain A, Crystal Structure Of Blue Copper Oxidase From Nitrosomonas Europaea Length = 318 Back     alignment and structure
>pdb|3ZX1|A Chain A, Multicopper Oxidase From Campylobacter Jejuni: A Metallo-Oxidase Length = 481 Back     alignment and structure
>pdb|2XU9|A Chain A, Crystal Structure Of Laccase From Thermus Thermophilus Hb27 Length = 439 Back     alignment and structure
>pdb|3GDC|A Chain A, Crystal Structure Of Multicopper Oxidase Length = 288 Back     alignment and structure
>pdb|3NSY|A Chain A, The Multi-Copper Oxidase Cueo With Six Met To Ser Mutations (M358s, M361s,M362s,M364s,M366s,M368s) Length = 511 Back     alignment and structure
>pdb|2YXV|A Chain A, The Deletion Mutant Of Multicopper Oxidase Cueo Length = 446 Back     alignment and structure
>pdb|1PF3|A Chain A, Crystal Structure Of The M441l Mutant Of The Multicopper Oxidase Cueo Length = 498 Back     alignment and structure
>pdb|3QQX|A Chain A, Reduced Native Intermediate Of The Multicopper Oxidase Cueo Length = 505 Back     alignment and structure
>pdb|3NSC|A Chain A, C500s Mutant Of Cueo Bound To Cu(Ii) Length = 505 Back     alignment and structure
>pdb|1KV7|A Chain A, Crystal Structure Of Cueo, A Multi-Copper Oxidase From E. Coli Involved In Copper Homeostasis Length = 488 Back     alignment and structure
>pdb|3NSF|A Chain A, Apo Form Of The Multicopper Oxidase Cueo Length = 505 Back     alignment and structure
>pdb|3UAA|A Chain A, Multicopper Oxidase Cueo Mutant C500se506q (Data1) Length = 489 Back     alignment and structure
>pdb|3TAS|A Chain A, Small Laccase From Streptomyces Viridosporus T7a Length = 313 Back     alignment and structure
>pdb|4GY4|A Chain A, Role Of The Biradical Intermediate Observed During The Turnover Of Slac: A Two-Domain Laccase From Streptomyces Coelicolor Length = 278 Back     alignment and structure
>pdb|3CG8|A Chain A, Laccase From Streptomyces Coelicolor Length = 343 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query445
2q9o_A 559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 1e-107
2q9o_A 559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 7e-15
3t6v_A 495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 1e-105
3t6v_A 495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 1e-15
3pxl_A 499 Laccase; 4-copper protein, metal-binding, oxidored 1e-105
3pxl_A 499 Laccase; 4-copper protein, metal-binding, oxidored 1e-13
1aoz_A 552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 1e-103
1aoz_A 552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 2e-13
3sqr_A 580 Laccase; multicopper oxidase, glycosylation, oxido 1e-103
3sqr_A 580 Laccase; multicopper oxidase, glycosylation, oxido 5e-13
1v10_A 521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 1e-101
1v10_A 521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 7e-14
1hfu_A 503 Laccase 1; oxidoreductase, blue multi-copper oxida 1e-99
1hfu_A 503 Laccase 1; oxidoreductase, blue multi-copper oxida 3e-14
1zpu_A 534 Iron transport multicopper oxidase FET3; ferroxida 2e-90
1zpu_A 534 Iron transport multicopper oxidase FET3; ferroxida 1e-13
3g5w_A318 Multicopper oxidase type 1; two domain, laccase, n 1e-83
3g5w_A318 Multicopper oxidase type 1; two domain, laccase, n 6e-08
2zwn_A339 Two-domain type laccase; muticopper oxidase, oxido 4e-83
2zwn_A 339 Two-domain type laccase; muticopper oxidase, oxido 7e-08
2xu9_A439 Laccase; oxidoreductase, multicopper oxidases; 1.5 4e-58
3aw5_A448 Multicopper oxidase; beta barrel, oxidoreductase; 3e-46
3gdc_A288 Multicopper oxidase; beta sandwich, plasmid, oxido 7e-46
3abg_A 534 Bilirubin oxidase; cleavage on PAIR of basic resid 5e-43
3zx1_A481 Oxidoreductase, putative; laccase, metallo-oxidase 2e-41
3od3_A 488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 3e-38
2uxt_A451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 4e-36
3kw8_A276 Laccase, putative copper oxidase; two-domain lacca 5e-31
2wsd_A513 Spore coat protein A; oxidoreductase, multi-copper 1e-30
3cg8_A343 Laccase; oxidoreductase, multicopper blue protein; 9e-30
1sdd_A306 Coagulation factor V; copper-binding protein, cofa 8e-29
2zoo_A442 Probable nitrite reductase; electron transfer, ele 2e-28
2r7e_A742 Coagulation factor VIII; ceruloplasmin fold, cuppe 4e-28
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 3e-24
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 4e-04
2j5w_A1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 1e-26
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 1e-25
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 1e-19
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 2e-05
1kbv_A327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 2e-24
2dv6_A447 Nitrite reductase; electron transfer, reduction, d 7e-24
2dv6_A447 Nitrite reductase; electron transfer, reduction, d 8e-10
2g23_A 612 PHS, phenoxazinone synthase; copper, metalloprotei 9e-22
2bw4_A340 Copper-containing nitrite reductase; oxidoreductas 4e-21
1oe1_A336 Dissimilatory copper-containing nitrite reductase; 3e-17
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 9e-16
1mzy_A333 Copper-containing nitrite reductase; mutant M182T, 2e-15
2r7e_B 770 Coagulation factor VIII; ceruloplasmin fold, cuppe 1e-09
2cal_A154 Rusticyanin; iron respiratory electron transport c 1e-05
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Length = 559 Back     alignment and structure
 Score =  328 bits (843), Expect = e-107
 Identities = 87/328 (26%), Positives = 138/328 (42%), Gaps = 28/328 (8%)

Query: 43  NNLCARPC-DNAKPLVCYYSFTLENYATVGPACADCLKGNQKACRRKGCVTADGF-ERAI 100
           N    R C  +   +   Y  +  +         +  + +         +  DG  +  +
Sbjct: 5   NTPSNRACWSDGFDINTDYEVSTPDTGVTQSYVFNLTEVD-------NWMGPDGVVKEKV 57

Query: 101 LSINRQLPGPSIQVCKGDTIIVDVKNHMIDREVTLHWHGVYQKVTPWMDGVPMVTQCPI- 159
           + IN  + GP+I    GDT+ V V N+++    ++HWHG+ QK T   DG   VT+CPI 
Sbjct: 58  MLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIXQKDTNLHDGANGVTECPIP 117

Query: 160 PSSTTFRYKFPAMPSGTFFYHSHVGLQKMDGLEGSMIIRTPKTADPHAELYDFDLYSHVI 219
           P      Y++ A   GT +YHSH   Q  +G+ G++ I       P +  YD DL   V 
Sbjct: 118 PKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQIN-----GPASLPYDIDL--GVF 170

Query: 220 IVTDWMHSMTDSKFPGNTYNDTRIKPDAILINGQNQNPKDNSPRVPMHFFKVQRDKRYLM 279
            +TD+ +   D        N      D +LING   NP  N+         +   KR+ +
Sbjct: 171 PITDYYYRAADDLVHFTQNNAPPF-SDNVLINGTAVNP--NTGEGQYANVTLTPGKRHRL 227

Query: 280 RIIGGSCLACPLIFTIEKHQLQVIASDGTAVEPLVVDSVTLFPGDRVDVIIHTNQSNNLY 339
           RI+  S        ++  H + VIA+D   V  + VDS+ L  G R DV+I  +++ + Y
Sbjct: 228 RILNTSTE-NHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNY 286

Query: 340 WMQAKTLCDS-------ITAEAVLQYEG 360
           W        +           A+  Y G
Sbjct: 287 WFNVTFGGQAACGGSLNPHPAAIFHYAG 314
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Length = 559 Back     alignment and structure
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Length = 495 Back     alignment and structure
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Length = 495 Back     alignment and structure
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Length = 499 Back     alignment and structure
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Length = 499 Back     alignment and structure
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Length = 552 Back     alignment and structure
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Length = 552 Back     alignment and structure
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Length = 580 Back     alignment and structure
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Length = 580 Back     alignment and structure
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Length = 521 Back     alignment and structure
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Length = 521 Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Length = 503 Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Length = 503 Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Length = 534 Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Length = 534 Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Length = 318 Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Length = 318 Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Length = 339 Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Length = 339 Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Length = 439 Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Length = 448 Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Length = 288 Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Length = 534 Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Length = 481 Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Length = 488 Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Length = 451 Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} Length = 276 Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Length = 513 Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Length = 343 Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Length = 306 Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Length = 442 Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Length = 742 Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Length = 742 Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Length = 742 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Length = 327 Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Length = 447 Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Length = 447 Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Length = 340 Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Length = 336 Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Length = 647 Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Length = 333 Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Length = 770 Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query445
3t6v_A495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 100.0
3pxl_A499 Laccase; 4-copper protein, metal-binding, oxidored 100.0
1aoz_A 552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 100.0
3sqr_A580 Laccase; multicopper oxidase, glycosylation, oxido 100.0
1zpu_A534 Iron transport multicopper oxidase FET3; ferroxida 100.0
1v10_A521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 100.0
1hfu_A503 Laccase 1; oxidoreductase, blue multi-copper oxida 100.0
2q9o_A 559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 100.0
2uxt_A451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 100.0
2xu9_A439 Laccase; oxidoreductase, multicopper oxidases; 1.5 100.0
3zx1_A481 Oxidoreductase, putative; laccase, metallo-oxidase 100.0
3od3_A488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 100.0
2wsd_A513 Spore coat protein A; oxidoreductase, multi-copper 100.0
3abg_A534 Bilirubin oxidase; cleavage on PAIR of basic resid 100.0
3aw5_A448 Multicopper oxidase; beta barrel, oxidoreductase; 100.0
3gyr_A612 PHS, phenoxazinone synthase; metalloprotein, lacca 100.0
2g23_A612 PHS, phenoxazinone synthase; copper, metalloprotei 100.0
3g5w_A318 Multicopper oxidase type 1; two domain, laccase, n 100.0
2zwn_A339 Two-domain type laccase; muticopper oxidase, oxido 100.0
1kbv_A327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 100.0
3gdc_A288 Multicopper oxidase; beta sandwich, plasmid, oxido 100.0
1mzy_A333 Copper-containing nitrite reductase; mutant M182T, 100.0
3kw8_A276 Laccase, putative copper oxidase; two-domain lacca 100.0
1oe1_A336 Dissimilatory copper-containing nitrite reductase; 100.0
2zoo_A442 Probable nitrite reductase; electron transfer, ele 100.0
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 100.0
2bw4_A340 Copper-containing nitrite reductase; oxidoreductas 100.0
3tas_A313 Small laccase, multi-copper oxidase; two-domain la 100.0
3t9w_A299 Small laccase, multi-copper oxidase; two-domain co 100.0
1sdd_A306 Coagulation factor V; copper-binding protein, cofa 100.0
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 100.0
3cg8_A343 Laccase; oxidoreductase, multicopper blue protein; 100.0
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 100.0
2r7e_B 770 Coagulation factor VIII; ceruloplasmin fold, cuppe 100.0
2dv6_A447 Nitrite reductase; electron transfer, reduction, d 100.0
2dv6_A447 Nitrite reductase; electron transfer, reduction, d 100.0
2j5w_A1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 100.0
2r7e_A742 Coagulation factor VIII; ceruloplasmin fold, cuppe 100.0
2zwn_A 339 Two-domain type laccase; muticopper oxidase, oxido 99.9
3pxl_A 499 Laccase; 4-copper protein, metal-binding, oxidored 99.88
3t6v_A 495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 99.88
3sqr_A 580 Laccase; multicopper oxidase, glycosylation, oxido 99.88
3g5w_A318 Multicopper oxidase type 1; two domain, laccase, n 99.87
1zpu_A 534 Iron transport multicopper oxidase FET3; ferroxida 99.85
1v10_A 521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 99.85
1aoz_A 552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 99.85
1hfu_A 503 Laccase 1; oxidoreductase, blue multi-copper oxida 99.85
2q9o_A 559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 99.84
3gdc_A288 Multicopper oxidase; beta sandwich, plasmid, oxido 99.83
2uxt_A 451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 99.82
1kbv_A327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 99.81
3cg8_A343 Laccase; oxidoreductase, multicopper blue protein; 99.79
3t9w_A299 Small laccase, multi-copper oxidase; two-domain co 99.78
3tas_A313 Small laccase, multi-copper oxidase; two-domain la 99.78
3zx1_A 481 Oxidoreductase, putative; laccase, metallo-oxidase 99.77
2xu9_A 439 Laccase; oxidoreductase, multicopper oxidases; 1.5 99.76
3od3_A 488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 99.76
3aw5_A 448 Multicopper oxidase; beta barrel, oxidoreductase; 99.75
3kw8_A276 Laccase, putative copper oxidase; two-domain lacca 99.75
3abg_A 534 Bilirubin oxidase; cleavage on PAIR of basic resid 99.74
2zoo_A 442 Probable nitrite reductase; electron transfer, ele 99.73
2wsd_A 513 Spore coat protein A; oxidoreductase, multi-copper 99.72
3gyr_A 612 PHS, phenoxazinone synthase; metalloprotein, lacca 99.71
1sdd_A306 Coagulation factor V; copper-binding protein, cofa 99.69
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 99.69
2g23_A 612 PHS, phenoxazinone synthase; copper, metalloprotei 99.69
2bw4_A340 Copper-containing nitrite reductase; oxidoreductas 99.67
1mzy_A333 Copper-containing nitrite reductase; mutant M182T, 99.65
3cvb_A105 Plastocyanin; cupredoxin, SELF assembly, copper, e 99.63
1oe1_A336 Dissimilatory copper-containing nitrite reductase; 99.62
2r7e_B 770 Coagulation factor VIII; ceruloplasmin fold, cuppe 99.56
2cal_A154 Rusticyanin; iron respiratory electron transport c 99.49
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 99.4
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 99.33
2ov0_A105 Amicyanin; beta-sandwich, electron transport; 0.75 99.18
2gim_A106 Plastocyanin; beta sheet, Cu, helix, electron tran 99.0
2aan_A139 Auracyanin A; cupredoxin fold, electron transport; 98.88
4hci_A100 Cupredoxin 1; structural genomics, niaid, national 98.78
2plt_A98 Plastocyanin; electron transport; 1.50A {Chlamydom 98.73
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 98.66
1bxv_A91 Plastocyanin; copper protein, electron transfer; 1 98.65
1pcs_A98 Plastocyanin; electron transport; 2.15A {Synechocy 98.64
3erx_A123 Pseudoazurin; copper protein, high-resolution, E t 98.61
3tu6_A127 Pseudoazurin (blue copper protein); cupredoxins, b 98.58
1b3i_A97 PETE protein, protein (plastocyanin); electron tra 98.55
1kdj_A102 Plastocyanin; electron transfer, photosystem, PAI- 98.49
3ef4_A124 Pseudoazurin, blue copper protein; electron transf 98.48
1byp_A99 Protein (plastocyanin); electron transfer, photosy 98.48
1plc_A99 Plastocyanin; electron transport; 1.33A {Populus n 98.45
1paz_A123 Pseudoazurin precursor; electron transfer(cupropro 98.3
1pmy_A123 Pseudoazurin; electron transfer(cuproprotein); 1.5 98.28
3cvb_A105 Plastocyanin; cupredoxin, SELF assembly, copper, e 98.21
3c75_A132 Amicyanin; copper proteins, electron transfer comp 98.16
1iuz_A98 Plastocyanin; electron transport; 1.60A {Ulva pert 98.15
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 98.13
1cuo_A129 Protein (azurin ISO-2); beta barrel, periplasmic, 98.07
3ay2_A167 Lipid modified azurin protein; beta sandwich, bact 98.03
1id2_A106 Amicyanin; beta barrel, type-1 blue copper protein 97.93
2ux6_A122 Pseudoazurin; type-1 copper, metal-binding, redox 97.88
2ccw_A129 Azurin II, AZN-2; electron transport (cuproprotein 97.88
2aan_A139 Auracyanin A; cupredoxin fold, electron transport; 97.8
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 97.77
2iaa_C128 Azurin; quinoprotein, tryptophan tryptophylquinone 97.72
1nwp_A128 Azurin; electron transport, cupredoxin, electron t 97.71
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 97.65
4hci_A100 Cupredoxin 1; structural genomics, niaid, national 97.63
2cal_A154 Rusticyanin; iron respiratory electron transport c 97.62
2gim_A106 Plastocyanin; beta sheet, Cu, helix, electron tran 97.31
2plt_A98 Plastocyanin; electron transport; 1.50A {Chlamydom 96.86
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 96.85
3fsa_A125 Azurin; copper, cupredoxin fold, metal-binding, pr 96.78
2ov0_A105 Amicyanin; beta-sandwich, electron transport; 0.75 96.72
1pcs_A98 Plastocyanin; electron transport; 2.15A {Synechocy 96.7
1cuo_A129 Protein (azurin ISO-2); beta barrel, periplasmic, 96.7
1bxv_A91 Plastocyanin; copper protein, electron transfer; 1 96.57
3ay2_A167 Lipid modified azurin protein; beta sandwich, bact 96.57
2ccw_A129 Azurin II, AZN-2; electron transport (cuproprotein 96.44
1nwp_A128 Azurin; electron transport, cupredoxin, electron t 96.35
2iaa_C128 Azurin; quinoprotein, tryptophan tryptophylquinone 96.22
1kdj_A102 Plastocyanin; electron transfer, photosystem, PAI- 96.06
3erx_A123 Pseudoazurin; copper protein, high-resolution, E t 96.0
1b3i_A97 PETE protein, protein (plastocyanin); electron tra 95.95
2cua_A135 Protein (CUA); CUA center, electron transport; 1.6 95.88
3fsa_A125 Azurin; copper, cupredoxin fold, metal-binding, pr 95.87
1iuz_A98 Plastocyanin; electron transport; 1.60A {Ulva pert 95.63
1byp_A99 Protein (plastocyanin); electron transfer, photosy 95.57
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 95.57
1plc_A99 Plastocyanin; electron transport; 1.33A {Populus n 95.43
3tu6_A127 Pseudoazurin (blue copper protein); cupredoxins, b 95.09
3s8f_B168 Cytochrome C oxidase subunit 2; complex IV, respir 94.86
3c75_A132 Amicyanin; copper proteins, electron transfer comp 94.02
3ef4_A124 Pseudoazurin, blue copper protein; electron transf 93.72
1id2_A106 Amicyanin; beta barrel, type-1 blue copper protein 93.15
1paz_A123 Pseudoazurin precursor; electron transfer(cupropro 93.12
1pmy_A123 Pseudoazurin; electron transfer(cuproprotein); 1.5 93.04
2cua_A135 Protein (CUA); CUA center, electron transport; 1.6 92.77
3s8f_B168 Cytochrome C oxidase subunit 2; complex IV, respir 91.4
3isy_A120 Bsupi, intracellular proteinase inhibitor; intrace 91.37
2ux6_A122 Pseudoazurin; type-1 copper, metal-binding, redox 90.76
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Back     alignment and structure
Probab=100.00  E-value=2.1e-70  Score=573.10  Aligned_cols=345  Identities=29%  Similarity=0.551  Sum_probs=278.0

Q ss_pred             eecCCCeEEEEEEECCCCCCCeEEEEcCCEEEEEEEecCCC----CCceEeeCCcccCCCCCCCCCCcccccCCCCCCce
Q psy16562         90 CVTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMID----REVTLHWHGVYQKVTPWMDGVPMVTQCPIPSSTTF  165 (445)
Q Consensus        90 ~~~~dG~~~~~~~~Ng~~PGPtI~v~~GD~v~V~v~N~l~~----~~tsiHwHG~~~~~~~~~DGvp~~tq~pI~pG~~~  165 (445)
                      .+.+||++|.+|+|||++|||+|+|++||+|+|+|+|+|+.    ++|||||||++|++++||||+|++|||||+||++|
T Consensus        15 ~~~pdg~~~~~~~~NG~~PGP~I~~~~GD~v~v~v~N~l~~~~~~~~tsiHwHGl~~~~~~~~DGv~~vtq~pI~PG~sf   94 (495)
T 3t6v_A           15 DIVPDGFVRPAVNAGGTFPGPVIAGNVGDNFQIVTFNQLIECSMLVDTSIHWHGEFQKGTNWADGPAFITQCPIIVGNSF   94 (495)
T ss_dssp             EECTTSCCEEEEEETTSSSCCEEEEETTCEEEEEEEECCCCGGGCSCBCEEEETCCCTTCGGGSCCBTTTBCCBCTTCEE
T ss_pred             EEcCCCceEEEEEECCcccCCeEEEECCcEEEEEEEECCCCccCCCceEEEeCCcccCCCccccCCCccccCCCCCCCeE
Confidence            47799999999999999999999999999999999999984    37999999999999999999999999999999999


Q ss_pred             EEEEec-CCCcceEEecccchhhhcCceeEEEEeCCCCCCCCCCccccCCcceEEEEeeeeccCCCCccCCCCCCCCCCC
Q psy16562        166 RYKFPA-MPSGTFFYHSHVGLQKMDGLEGSMIIRTPKTADPHAELYDFDLYSHVIIVTDWMHSMTDSKFPGNTYNDTRIK  244 (445)
Q Consensus       166 ~Y~f~~-~~~GT~wYH~H~~~q~~~Gl~G~lIV~~~~~~~p~~~~~d~d~~e~~l~l~D~~~~~~~~~~~~~~~~~~~~~  244 (445)
                      +|+|++ .++||||||||.+.|+.+||+|+|||+++.  ++...+|++|..|++|+++||+++..... .    ......
T Consensus        95 tY~f~~~~~~GT~wYHsH~~~q~~~GL~G~lIV~~~~--~~~~~~~~~d~~e~~l~l~Dw~~~~~~~~-~----~~~p~~  167 (495)
T 3t6v_A           95 SYNFNVPGMAGTYWYHSHLTTQYCDGLRGPFVVYDPN--DPDANLYDVDDDTTIITLADWYHVLAKEM-G----AGGAIT  167 (495)
T ss_dssp             EEEEECTTCCEEEEEEECSTTGGGGTCEEEEEEECTT--CTTGGGCSBCSGGGEEEEEEECSSCGGGS-C----SSSCCC
T ss_pred             EEEEEeCCCCceeeeeccchhHHhcCceEEEEEcCcc--ccccccCCCCCceeEEEEecccCCchhhh-c----cCCCCC
Confidence            999999 589999999999999999999999999874  35555688876688999999999865431 1    112247


Q ss_pred             CCeEEEccccCCCCCCCCCcccceEEEecCcEEEEEEEccCCCceeEEEEecccceEEEccCCCcceeeEecEEEecCCc
Q psy16562        245 PDAILINGQNQNPKDNSPRVPMHFFKVQRDKRYLMRIIGGSCLACPLIFTIEKHQLQVIASDGTAVEPLVVDSVTLFPGD  324 (445)
Q Consensus       245 ~~~~lING~~~~~~~~~~~~p~~~i~v~~G~~~rlRliN~~~~~~~~~~~i~gh~~~via~DG~~v~P~~~~~~~I~pGe  324 (445)
                      ++++||||++.+.++ ....+.+.|+|++|++|||||||++.. +.+.|+|+||.|+||++||.+++|..++++.|+|||
T Consensus       168 ~d~~liNG~g~~~~~-~~~~~~~~~~v~~G~~~RlRliN~~~~-~~~~~~i~gh~~~via~DG~~~~P~~~~~l~i~pGq  245 (495)
T 3t6v_A          168 ADSTLIDGLGRTHVN-VAAVPLSVITVEVGKRYRMRLVSISCD-PNYDFSIDGHDMTIIETDGVDSQELTVDEIQIFAAQ  245 (495)
T ss_dssp             CSEEEETTBCCBSSS-CCCCCCCEEEECTTCEEEEEEEECCSS-CCEEEEETTCCEEEEEETTEEEEEEEESBEEECTTC
T ss_pred             CcEEEECCcCcCCCC-cccCCceEEEEcCCCEEEEEEEecCCC-eeEEEEECCCeEEEEEeCCcccCCEEeeeEEEcCce
Confidence            899999999764321 112456799999999999999999987 478999999999999999999999999999999999


Q ss_pred             eEEEEEecCCCCceEEEEEEec--CCC---ceeeEEEEEcCCCCC-CCCCCCC--C---C--CC--------CC------
Q psy16562        325 RVDVIIHTNQSNNLYWMQAKTL--CDS---ITAEAVLQYEGEKLT-YVSKRPK--S---D--SF--------PR------  377 (445)
Q Consensus       325 R~dv~v~~~~~~G~y~~~~~~~--~~~---~~~~ail~y~~~~~~-~~~~~P~--~---~--~~--------~~------  377 (445)
                      ||||+|++++++|+|||++...  |..   ....|+|+|.+.... +....+.  .   .  .+        +.      
T Consensus       246 R~dvlv~~~~~~g~y~i~a~~~~~~~~~~~~~~~ail~Y~~~~~~~p~~~~~~~~~~~~~~~~L~p~~~~~~p~~~~~~~  325 (495)
T 3t6v_A          246 RYSFVLNANQPVGNYWIRANPNSGGEGFDGGINSAILRYDGATTADPVTVASTVHTKCLIETDLHPLSRNGVPGNPHQGG  325 (495)
T ss_dssp             EEEEEEECCSCSSEEEEEEEESSSSCSCGGGTTEEEEEETTSCSSCCCCCCCSSCSSBCCGGGCCBSSCCCCSSCSSTTC
T ss_pred             EEEEEEECCCCCceEEEEEecccCccccCCCceEEEEEECCCCCCCCCCCCCCCCccccccccccccccccCCCccCCCC
Confidence            9999999999889999999865  322   234699999875431 1100000  0   0  00        00      


Q ss_pred             ------------CCCC-CCCCCC-----c------------------cceeEeeCCcEEEEEEE-cCCCCccceEEEEeC
Q psy16562        378 ------------GKPK-DNSPRV-----P------------------MHFFKVQRDKRYLMRII-GGSCLACPLIFTIEK  420 (445)
Q Consensus       378 ------------~~~~-~~~~~~-----~------------------~~~~~v~~G~~~~~rli-N~s~~~Hp~~~hihg  420 (445)
                                  +..+ .|+..+     +                  ...+.++.|++++|.|. |.+...|||  ||||
T Consensus       326 ~d~~~~l~~~~~~~~w~iNg~s~~~~~~P~L~~~~~g~~~~~~~~~~~~v~~~~~g~~V~ivl~~n~~~~~HP~--HLHG  403 (495)
T 3t6v_A          326 ADCNLNLSLGFACGNFVINGVSFTPPTVPVLLQICSGANTAADLLPSGSVISLPSNSTIEIALPAGAAGGPHPF--HLHG  403 (495)
T ss_dssp             SSEEEECCEEEETTEEEETTBCCCCCSSCHHHHHHTTCCSSTTSSSTTSEEEECTTCEEEEEEECCSSSCCCEE--EETT
T ss_pred             CcEEEEEEEEecCcEEEEcCEecCCCCCcchhhhhcCCcCcccccCCcceEEecCCCEEEEEEccCCCCCCcce--eecC
Confidence                        0000 011111     0                  11478899999999998 677788998  9999


Q ss_pred             eeEEEEecCCccC----CCeEEeEEEecC
Q psy16562        421 HQLQVIASDGTAV----EPLVVDSVTLFP  445 (445)
Q Consensus       421 h~f~Vi~~dG~~~----~p~~~Dtv~v~p  445 (445)
                      |+|+|++.+|...    .|.++||+.|.|
T Consensus       404 h~F~vl~~~g~~~~n~~~P~~rDtv~v~~  432 (495)
T 3t6v_A          404 HDFAVSESASNSTSNYDDPIWRDVVSIGG  432 (495)
T ss_dssp             CCEEEEECTTCCCCCSSSCCEESEEECCS
T ss_pred             CcEEEEecCCCCCcccCCCCCccEEEcCC
Confidence            9999999988754    589999999864
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Back     alignment and structure
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Back     alignment and structure
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Back     alignment and structure
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Back     alignment and structure
>3gyr_A PHS, phenoxazinone synthase; metalloprotein, laccase, multicopper oxidase, hexamer, oxidoreductase, antibiotic biosynthesis; 2.30A {Streptomyces antibioticus} Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} PDB: 4gxf_A* 4gy4_A* Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Back     alignment and structure
>3tas_A Small laccase, multi-copper oxidase; two-domain laccase, oxidoreductase, secreted; HET: PG4; 2.30A {Streptomyces viridosporus} PDB: 3tbb_A 3tbc_A* Back     alignment and structure
>3t9w_A Small laccase, multi-copper oxidase; two-domain copper oxidase, Cu-binding, oxidoreducta; 1.50A {Amycolatopsis SP} Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Back     alignment and structure
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Back     alignment and structure
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Back     alignment and structure
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Back     alignment and structure
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Back     alignment and structure
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Back     alignment and structure
>3t9w_A Small laccase, multi-copper oxidase; two-domain copper oxidase, Cu-binding, oxidoreducta; 1.50A {Amycolatopsis SP} Back     alignment and structure
>3tas_A Small laccase, multi-copper oxidase; two-domain laccase, oxidoreductase, secreted; HET: PG4; 2.30A {Streptomyces viridosporus} PDB: 3tbb_A 3tbc_A* Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} PDB: 4gxf_A* 4gy4_A* Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Back     alignment and structure
>3gyr_A PHS, phenoxazinone synthase; metalloprotein, laccase, multicopper oxidase, hexamer, oxidoreductase, antibiotic biosynthesis; 2.30A {Streptomyces antibioticus} Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Back     alignment and structure
>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... Back     alignment and structure
>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A Back     alignment and structure
>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} Back     alignment and structure
>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A Back     alignment and structure
>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Back     alignment and structure
>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A Back     alignment and structure
>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A Back     alignment and structure
>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A Back     alignment and structure
>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* Back     alignment and structure
>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A Back     alignment and structure
>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 Back     alignment and structure
>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A Back     alignment and structure
>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A Back     alignment and structure
>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* Back     alignment and structure
>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 Back     alignment and structure
>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A Back     alignment and structure
>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Back     alignment and structure
>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A Back     alignment and structure
>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 Back     alignment and structure
>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A Back     alignment and structure
>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A Back     alignment and structure
>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* Back     alignment and structure
>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Back     alignment and structure
>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A Back     alignment and structure
>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Back     alignment and structure
>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... Back     alignment and structure
>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... Back     alignment and structure
>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A Back     alignment and structure
>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A Back     alignment and structure
>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A Back     alignment and structure
>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A Back     alignment and structure
>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A Back     alignment and structure
>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* Back     alignment and structure
>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A Back     alignment and structure
>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A Back     alignment and structure
>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* Back     alignment and structure
>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* Back     alignment and structure
>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... Back     alignment and structure
>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A Back     alignment and structure
>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A Back     alignment and structure
>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ... Back     alignment and structure
>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 Back     alignment and structure
>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 Back     alignment and structure
>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* Back     alignment and structure
>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 Back     alignment and structure
>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* Back     alignment and structure
>3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ... Back     alignment and structure
>3isy_A Bsupi, intracellular proteinase inhibitor; intracellular proteinase inhibitor bsupi, beta sandwich, GRE structural genomics; HET: PG4; 2.61A {Bacillus subtilis} Back     alignment and structure
>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 445
d1hfua1131 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprin 2e-36
d1gyca1130 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, la 2e-36
d1v10a1136 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [T 7e-36
d1aoza1129 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cuc 2e-33
d1gyca2170 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, 5e-33
d1gyca2170 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, 6e-08
d1hfua2172 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Copr 2e-31
d1hfua2172 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Copr 2e-07
d1v10a2168 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus 3e-31
d1v10a2168 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus 5e-09
d2q9oa2181 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyce 4e-31
d2q9oa2181 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyce 4e-09
d2q9oa1162 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces 5e-27
d1sdda1180 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos t 5e-23
d1aoza2209 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (C 9e-23
d1aoza2209 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (C 6e-07
d1kbva1151 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisser 1e-22
d2j5wa1192 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapie 8e-22
d1oe2a1159 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcalige 1e-21
d2j5wa3207 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sap 4e-21
d1gska1181 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Baci 7e-21
d1kv7a1140 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Esch 2e-20
d2bw4a1157 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcalige 5e-19
d1e30a_153 b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidan 2e-17
d1mzya1153 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodoba 2e-17
d2j5wa4179 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sap 7e-17
d1kv7a2165 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Esc 1e-15
d1kv7a2165 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Esc 8e-06
d2j5wa5149 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sa 8e-15
d1sddb2139 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (B 4e-14
d1sdda2116 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos 9e-14
d2j5wa2145 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sap 3e-13
d1kcwa2146 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sap 3e-12
d1gska2174 b.6.1.3 (A:183-356) Spore coat protein A, CotA {Ba 6e-12
d1sddb167 b.6.1.3 (B:1657-1723) Coagulation factor V {Cow (B 8e-07
d1kbva2151 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisse 8e-06
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Length = 131 Back     information, alignment and structure

class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Multidomain cupredoxins
domain: Laccase
species: Inky cap fungus (Coprinus cinereus) [TaxId: 5346]

 Score =  128 bits (323), Expect = 2e-36
 Identities = 49/118 (41%), Positives = 65/118 (55%), Gaps = 6/118 (5%)

Query: 89  GCVTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMID----REVTLHWHGVYQKV 144
             V+ DGF RA + +N    GP I+  K D   ++V N + +    R  ++HWHG++Q+ 
Sbjct: 14  ANVSPDGFTRAGILVNGV-HGPLIRGGKNDNFELNVVNDLDNPTMLRPTSIHWHGLFQRG 72

Query: 145 TPWMDGVPMVTQCPIPSSTTFRYKFP-AMPSGTFFYHSHVGLQKMDGLEGSMIIRTPK 201
           T W DG   V QCPI     F YKF  A  +GTF+YHSH G Q  DGL G M+I    
Sbjct: 73  TNWADGADGVNQCPISPGHAFLYKFTPAGHAGTFWYHSHFGTQYCDGLRGPMVIYDDN 130
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Length = 130 Back     information, alignment and structure
>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} Length = 136 Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Length = 129 Back     information, alignment and structure
>d1gyca2 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Length = 170 Back     information, alignment and structure
>d1gyca2 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Length = 170 Back     information, alignment and structure
>d1hfua2 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Length = 172 Back     information, alignment and structure
>d1hfua2 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Length = 172 Back     information, alignment and structure
>d1v10a2 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus [TaxId: 219653]} Length = 168 Back     information, alignment and structure
>d1v10a2 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus [TaxId: 219653]} Length = 168 Back     information, alignment and structure
>d2q9oa2 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyces [TaxId: 204285]} Length = 181 Back     information, alignment and structure
>d2q9oa2 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyces [TaxId: 204285]} Length = 181 Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Length = 162 Back     information, alignment and structure
>d1sdda1 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 180 Back     information, alignment and structure
>d1aoza2 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Length = 209 Back     information, alignment and structure
>d1aoza2 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Length = 209 Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Length = 151 Back     information, alignment and structure
>d2j5wa1 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Length = 159 Back     information, alignment and structure
>d2j5wa3 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1gska1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Length = 181 Back     information, alignment and structure
>d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Length = 140 Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Length = 157 Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Length = 153 Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Length = 153 Back     information, alignment and structure
>d2j5wa4 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 179 Back     information, alignment and structure
>d1kv7a2 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Length = 165 Back     information, alignment and structure
>d1kv7a2 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Length = 165 Back     information, alignment and structure
>d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 139 Back     information, alignment and structure
>d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 116 Back     information, alignment and structure
>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 145 Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d1gska2 b.6.1.3 (A:183-356) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Length = 174 Back     information, alignment and structure
>d1sddb1 b.6.1.3 (B:1657-1723) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 67 Back     information, alignment and structure
>d1kbva2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Length = 151 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query445
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 100.0
d1v10a1136 Laccase {Rigidoporus lignosus [TaxId: 219653]} 100.0
d1hfua1131 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 100.0
d1gyca1130 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 100.0
d2q9oa1162 Laccase {Melanocarpus albomyces [TaxId: 204285]} 100.0
d1kv7a1140 multi-copper oxidase CueO {Escherichia coli [TaxId 100.0
d1oe2a1159 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.97
d2bw4a1157 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.97
d1gyca2170 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 99.97
d1hfua2172 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 99.97
d1v10a2168 Laccase {Rigidoporus lignosus [TaxId: 219653]} 99.97
d2q9oa2181 Laccase {Melanocarpus albomyces [TaxId: 204285]} 99.97
d1gska1181 Spore coat protein A, CotA {Bacillus subtilis [Tax 99.96
d1mzya1153 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 99.96
d1kbva1151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 99.96
d1aoza2209 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 99.94
d1sdda1180 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.92
d2j5wa3207 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.9
d2j5wa1192 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.89
d2j5wa4179 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1kv7a2165 multi-copper oxidase CueO {Escherichia coli [TaxId 99.85
d1gska2174 Spore coat protein A, CotA {Bacillus subtilis [Tax 99.84
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 99.82
d1sddb2139 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.73
d1kbva2151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 99.72
d2j5wa5149 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.72
d2j5wa2145 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1kcwa2146 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1sdda2116 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.6
d1fwxa1132 Nitrous oxide reductase, C-terminal domain {Paraco 99.57
d1kbva2151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 99.56
d1ibya_112 Red copper protein nitrosocyanin {Nitrosomonas eur 99.52
d1sddb2139 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.46
d1sddb167 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.38
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 99.38
d1v10a1136 Laccase {Rigidoporus lignosus [TaxId: 219653]} 99.36
d1gyca1130 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 99.35
d2j5wa5149 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.32
d2j5wa2145 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.29
d1hfua1131 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 99.23
d1kv7a1140 multi-copper oxidase CueO {Escherichia coli [TaxId 99.19
d1oe2a1159 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.17
d1qnia1131 Nitrous oxide reductase, C-terminal domain {Pseudo 99.13
d1kcwa2146 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.11
d2q9oa1162 Laccase {Melanocarpus albomyces [TaxId: 204285]} 99.11
d2q9oa2181 Laccase {Melanocarpus albomyces [TaxId: 204285]} 99.11
d1hfua2172 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 99.09
d2bw4a2173 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.09
d1gyca2170 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 99.06
d1oe1a2177 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.05
d2bw4a1157 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.05
d1sdda2116 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.02
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 99.02
d2bw4a2173 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.02
d1v10a2168 Laccase {Rigidoporus lignosus [TaxId: 219653]} 98.99
d1kbva1151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 98.95
d1mzya1153 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 98.94
d1aoza2209 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 98.92
d1kv7a3181 multi-copper oxidase CueO {Escherichia coli [TaxId 98.89
d1kv7a3181 multi-copper oxidase CueO {Escherichia coli [TaxId 98.85
d1qhqa_139 Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] 98.83
d1gska1181 Spore coat protein A, CotA {Bacillus subtilis [Tax 98.79
d1oe1a2177 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 98.71
d1hfua3200 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 98.66
d1gska3154 Spore coat protein A, CotA {Bacillus subtilis [Tax 98.6
d1v10a3190 Laccase {Rigidoporus lignosus [TaxId: 219653]} 98.59
d1gska3154 Spore coat protein A, CotA {Bacillus subtilis [Tax 98.59
d2plta_98 Plastocyanin {Green alga (Chlamydomonas reinhardti 98.55
d1gyca3199 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 98.45
d1mzya2178 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 98.44
d1aoza3214 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 98.41
d1ibya_112 Red copper protein nitrosocyanin {Nitrosomonas eur 98.31
d1kdja_102 Plastocyanin {Fern (Adiantum capillus-veneris) [Ta 98.29
d1pcsa_98 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.27
d2j5wa3207 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 98.27
d1hfua3200 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 98.23
d1sdda1180 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 98.21
d1gska2174 Spore coat protein A, CotA {Bacillus subtilis [Tax 98.19
d2q5ba1105 Plastocyanin {Cyanobacterium (Phormidium laminosum 98.19
d1bypa_99 Plastocyanin {White campion (Silene pratensis) [Ta 98.19
d1bxua_91 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.18
d1kv7a2165 multi-copper oxidase CueO {Escherichia coli [TaxId 98.15
d2j5wa1192 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 98.13
d1plca_99 Plastocyanin {Poplar (Populus nigra), variant ital 98.12
d2j5wa4179 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 98.11
d2ov0a1105 Amicyanin {Paracoccus denitrificans [TaxId: 266]} 98.11
d1v10a3190 Laccase {Rigidoporus lignosus [TaxId: 219653]} 98.05
d2q9oa3216 Laccase {Melanocarpus albomyces [TaxId: 204285]} 98.04
d2jxma197 Plastocyanin {Photosynthetic prokaryote (Prochloro 98.01
d1fwxa1132 Nitrous oxide reductase, C-terminal domain {Paraco 97.99
d1iuza_98 Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 97.95
d1pmya_123 Pseudoazurin {Methylobacterium extorquens, strain 97.93
d1paza_120 Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta 97.93
d1aoza3214 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 97.9
d1adwa_123 Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 97.85
d1bqka_124 Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 97.84
d1gyca3199 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 97.82
d2cj3a1105 Plastocyanin {Anabaena variabilis [TaxId: 1172]} 97.79
d1id2a_106 Amicyanin {Paracoccus versutus (Thiobacillus versu 97.61
d2ccwa1129 Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d 97.53
d1cuoa_129 Azurin {Methylomonas sp. j [TaxId: 32038]} 97.53
d2q9oa3216 Laccase {Melanocarpus albomyces [TaxId: 204285]} 97.5
d1jzga_128 Azurin {Pseudomonas aeruginosa [TaxId: 287]} 97.46
d2cuaa_122 Cytochrome c oxidase {Thermus thermophilus, ba3 ty 97.45
d1nwpa_128 Azurin {Pseudomonas putida [TaxId: 303]} 97.42
d1qnia1131 Nitrous oxide reductase, C-terminal domain {Pseudo 97.41
d1qhqa_139 Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] 97.4
d1mzya2178 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 97.18
d2ccwa1129 Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d 96.08
d1cuoa_129 Azurin {Methylomonas sp. j [TaxId: 32038]} 95.95
d2q5ba1105 Plastocyanin {Cyanobacterium (Phormidium laminosum 95.8
d2cuaa_122 Cytochrome c oxidase {Thermus thermophilus, ba3 ty 95.65
d1sddb167 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 95.55
d1jzga_128 Azurin {Pseudomonas aeruginosa [TaxId: 287]} 95.43
d1pcsa_98 Plastocyanin {Cyanobacterium (Synechocystis sp.), 95.33
d2cj3a1105 Plastocyanin {Anabaena variabilis [TaxId: 1172]} 95.28
d1nwpa_128 Azurin {Pseudomonas putida [TaxId: 303]} 95.2
d1plca_99 Plastocyanin {Poplar (Populus nigra), variant ital 94.83
d1bxua_91 Plastocyanin {Cyanobacterium (Synechocystis sp.), 94.1
d2plta_98 Plastocyanin {Green alga (Chlamydomonas reinhardti 93.96
d1iuza_98 Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 93.6
d1bypa_99 Plastocyanin {White campion (Silene pratensis) [Ta 93.28
d2jxma197 Plastocyanin {Photosynthetic prokaryote (Prochloro 91.66
d1kdja_102 Plastocyanin {Fern (Adiantum capillus-veneris) [Ta 90.95
d2ov0a1105 Amicyanin {Paracoccus denitrificans [TaxId: 266]} 90.02
d1adwa_123 Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 89.24
d1pmya_123 Pseudoazurin {Methylobacterium extorquens, strain 86.54
d1id2a_106 Amicyanin {Paracoccus versutus (Thiobacillus versu 86.51
d1bqka_124 Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 85.01
d1w8oa1103 Sialidase, "linker" domain {Micromonospora viridif 83.47
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Multidomain cupredoxins
domain: Ascorbate oxidase
species: Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]

Probab=100.00  E-value=1.2e-39  Score=279.03  Aligned_cols=126  Identities=37%  Similarity=0.790  Sum_probs=119.4

Q ss_pred             CceEEEEEEEEEeeecCccccccCCCcccccccceeecCCCeEEEEEEECCCCCCCeEEEEcCCEEEEEEEecCCCCCce
Q psy16562         55 PLVCYYSFTLENYATVGPACADCLKGNQKACRRKGCVTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMIDREVT  134 (445)
Q Consensus        55 p~~~~y~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dG~~~~~~~~Ng~~PGPtI~v~~GD~v~V~v~N~l~~~~ts  134 (445)
                      .++|+|+|+|++.                      .+++||.++.+|+|||++|||+|+|++||+|+|+|.|+|+.++++
T Consensus         1 ~~~~~~~~~v~~~----------------------~~~pdg~~~~~~~~NG~~PGP~i~v~~GD~v~i~l~N~l~~~~~~   58 (129)
T d1aoza1           1 SQIRHYKWEVEYM----------------------FWAPNCNENIVMGINGQFPGPTIRANAGDSVVVELTNKLHTEGVV   58 (129)
T ss_dssp             CCEEEEEEEEEEE----------------------EECTTSSCEEEEEETTBSSCCCEEEETTCEEEEEEEECCSSCCBC
T ss_pred             CcEEEEEEEEEEE----------------------EECCCCeEEEEEEECCCcCCCeEEEECCcEEEEEEEeCCCCCCee
Confidence            3789999999974                      357899999999999999999999999999999999999878999


Q ss_pred             EeeCCcccCCCCCCCCCCcccccCCCCCCceEEEEecCCCcceEEecccchhhhcCceeEEEEeCCCC
Q psy16562        135 LHWHGVYQKVTPWMDGVPMVTQCPIPSSTTFRYKFPAMPSGTFFYHSHVGLQKMDGLEGSMIIRTPKT  202 (445)
Q Consensus       135 iHwHG~~~~~~~~~DGvp~~tq~pI~pG~~~~Y~f~~~~~GT~wYH~H~~~q~~~Gl~G~lIV~~~~~  202 (445)
                      |||||+++...+++||+++++||+|+||++++|+|.++++||||||||++.|+.+||+|+|||+++++
T Consensus        59 iH~Hg~~~~~~~~~~~~~~~~~~~I~PG~s~~y~f~a~~~Gt~~YH~H~~~h~~~Gm~G~~iV~~~~~  126 (129)
T d1aoza1          59 IHWHGILQRGTPWADGTASISQCAINPGETFFYNFTVDNPGTFFYHGHLGMQRSAGLYGSLIVDPPQG  126 (129)
T ss_dssp             EEEETCCCTTCGGGSCCBTTTBCCBCTTCEEEEEEECCSCEEEEEEECSTTTGGGTCEEEEEEECCTT
T ss_pred             eeeccceeeccCccccccccccceECCCCEEEEEEECCCCCceEEecCCHHHHhCCCEEEEEEcCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999998864
>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1gyca2 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1hfua2 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1v10a2 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d2q9oa2 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1gska1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1aoza2 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1sdda1 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2j5wa3 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j5wa1 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j5wa4 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kv7a2 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gska2 b.6.1.3 (A:183-356) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kbva2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1kbva2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sddb1 b.6.1.3 (B:1657-1723) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d2q9oa2 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1hfua2 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d2bw4a2 b.6.1.3 (A:166-338) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1gyca2 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1oe1a2 b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d2bw4a2 b.6.1.3 (A:166-338) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1v10a2 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1aoza2 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1kv7a3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kv7a3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1gska1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1oe1a2 b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1hfua3 b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1gska3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1v10a3 b.6.1.3 (A:305-494) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d1gska3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1gyca3 b.6.1.3 (A:301-499) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1mzya2 b.6.1.3 (A:194-371) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1aoza3 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d2j5wa3 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hfua3 b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1sdda1 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gska2 b.6.1.3 (A:183-356) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Back     information, alignment and structure
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Back     information, alignment and structure
>d1kv7a2 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j5wa1 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} Back     information, alignment and structure
>d2j5wa4 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1v10a3 b.6.1.3 (A:305-494) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d2q9oa3 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Back     information, alignment and structure
>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Back     information, alignment and structure
>d1aoza3 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Back     information, alignment and structure
>d1gyca3 b.6.1.3 (A:301-499) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Back     information, alignment and structure
>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} Back     information, alignment and structure
>d2q9oa3 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} Back     information, alignment and structure
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1mzya2 b.6.1.3 (A:194-371) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Back     information, alignment and structure
>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Back     information, alignment and structure
>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} Back     information, alignment and structure
>d1sddb1 b.6.1.3 (B:1657-1723) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} Back     information, alignment and structure
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Back     information, alignment and structure
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Back     information, alignment and structure
>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Back     information, alignment and structure
>d1w8oa1 b.1.18.2 (A:403-505) Sialidase, "linker" domain {Micromonospora viridifaciens [TaxId: 1881]} Back     information, alignment and structure