Psyllid ID: psy16567

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------
ACADCLKGNQKACRRKGCVTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMIDREVTLHWHGVYQKVTPWMDGVPMVTQCPIPSSTTFRYKFPAMPSGTFFYHSHVDRRPYCPEIEEKKKTG
cccccccccccEEEEccEEcccccEEEEEEEcccccccEEEEEcccEEEEEEEEcccccccEEEEccccccccccccccccccccccccccEEEEEEEccccccEEEcccccccccccEEEEccccc
ccccccccEEEEEEEccccccccccEEEEEEccEcccccEEEEcccEEEEEEEEccccccEcEEEEcccccccHHHcccEcccEccEccccEEEEEEEccccEEEEEEEcccHcccccEEEcccccc
acadclkgnqkacrrkgcvtadGFERAILSINrqlpgpsiqvckgdtiiVDVKNHMIDREVTLHWHGVyqkvtpwmdgvpmvtqcpipssttfrykfpampsgtffyhshvdrrpycpeieekkktg
acadclkgnqkacrrkgcvTADGFERAILSinrqlpgpsiqvcKGDTIIVDVKNHMIDREVTLHWHGVYQKVTPWMDGVPMVTQCPIPSSTTFRYKFPAMPSGtffyhshvdrrpYCPEIEEKKKTG
ACADCLKGNQKACRRKGCVTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMIDREVTLHWHGVYQKVTPWMDGVPMVTQCPIPSSTTFRYKFPAMPSGTFFYHSHVDRRPYCPEIEEKKKTG
*********QKACRRKGCVTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMIDREVTLHWHGVYQKVTPWMDGVPMVTQCPIPSSTTFRYKFPAMPSGTFFYHSHVDRRPYC**********
ACADCLKGNQKACRRKGCVTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMIDREVTLHWHGVYQKVTPWMDGVPMVTQCPIPSSTTFRYKFPAMPSGTFFYHSHVDRRPYCPE*EEK****
ACADCLKGNQKACRRKGCVTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMIDREVTLHWHGVYQKVTPWMDGVPMVTQCPIPSSTTFRYKFPAMPSGTFFYHSHVDRRPYCPEIEEKKKTG
ACADCLKGNQKACRRKGCVTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMIDREVTLHWHGVYQKVTPWMDGVPMVTQCPIPSSTTFRYKFPAMPSGTFFYHSHVDRRPYCPEIEEK****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ACADCLKGNQKACRRKGCVTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMIDREVTLHWHGVYQKVTPWMDGVPMVTQCPIPSSTTFRYKFPAMPSGTFFYHSHVDRRPYCPEIEEKKKTG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query127 2.2.26 [Sep-21-2011]
Q40588 578 L-ascorbate oxidase OS=Ni N/A N/A 0.716 0.157 0.428 3e-19
Q12542 520 Laccase-2 OS=Agaricus bis N/A N/A 0.748 0.182 0.465 4e-19
P24792 579 L-ascorbate oxidase OS=Cu N/A N/A 0.708 0.155 0.433 6e-19
Q12541 520 Laccase-1 OS=Agaricus bis N/A N/A 0.748 0.182 0.465 7e-19
P14133 587 L-ascorbate oxidase OS=Cu N/A N/A 0.724 0.156 0.391 1e-18
P37064 552 L-ascorbate oxidase OS=Cu N/A N/A 0.685 0.157 0.425 1e-18
Q99055 520 Laccase-4 OS=Trametes vil N/A N/A 0.787 0.192 0.424 2e-18
Q96WM9 581 Laccase-2 OS=Botryotinia N/A N/A 0.724 0.158 0.434 2e-18
Q12719 520 Laccase-4 OS=Trametes ver N/A N/A 0.771 0.188 0.423 3e-18
Q02497 520 Laccase OS=Trametes hirsu N/A N/A 0.763 0.186 0.419 6e-18
>sp|Q40588|ASO_TOBAC L-ascorbate oxidase OS=Nicotiana tabacum GN=AAO PE=2 SV=1 Back     alignment and function desciption
 Score = 93.6 bits (231), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/91 (42%), Positives = 54/91 (59%)

Query: 20  TADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMIDREVTLHWHGVYQKVTPWMDGV 79
           + DG E  ++ IN Q PGP+I+   GDT+ V + N +    V +HWHG+ Q  TPW DG 
Sbjct: 43  SPDGEESVVMGINGQFPGPTIRAKAGDTVAVHLTNKLHTEGVVIHWHGIRQIGTPWADGT 102

Query: 80  PMVTQCPIPSSTTFRYKFPAMPSGTFFYHSH 110
             ++QC I    TF Y+F    +GT+FYH H
Sbjct: 103 AAISQCAINPGETFLYRFKVDKAGTYFYHGH 133
May be involved in a redox system involving ascorbic acid.
Nicotiana tabacum (taxid: 4097)
EC: 1EC: .EC: 1EC: 0EC: .EC: 3EC: .EC: 3
>sp|Q12542|LAC2_AGABI Laccase-2 OS=Agaricus bisporus GN=lcc2 PE=1 SV=1 Back     alignment and function description
>sp|P24792|ASO_CUCMA L-ascorbate oxidase OS=Cucurbita maxima GN=AAO PE=1 SV=2 Back     alignment and function description
>sp|Q12541|LAC1_AGABI Laccase-1 OS=Agaricus bisporus GN=lcc1 PE=1 SV=1 Back     alignment and function description
>sp|P14133|ASO_CUCSA L-ascorbate oxidase OS=Cucumis sativus PE=1 SV=1 Back     alignment and function description
>sp|P37064|ASO_CUCPM L-ascorbate oxidase OS=Cucurbita pepo var. melopepo PE=1 SV=1 Back     alignment and function description
>sp|Q99055|LAC4_TRAVI Laccase-4 OS=Trametes villosa GN=LCC4 PE=3 SV=1 Back     alignment and function description
>sp|Q96WM9|LAC2_BOTFU Laccase-2 OS=Botryotinia fuckeliana GN=lcc2 PE=2 SV=1 Back     alignment and function description
>sp|Q12719|LAC4_TRAVE Laccase-4 OS=Trametes versicolor GN=LCC4 PE=3 SV=1 Back     alignment and function description
>sp|Q02497|LAC1_TRAHI Laccase OS=Trametes hirsuta PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query127
312382207 596 hypothetical protein AND_05200 [Anophele 0.866 0.184 0.6 6e-35
312379442 855 hypothetical protein AND_08709 [Anophele 0.874 0.129 0.603 8e-35
157121009 674 multicopper oxidase [Aedes aegypti] gi|1 0.866 0.163 0.618 1e-34
157121007 630 multicopper oxidase [Aedes aegypti] gi|1 0.874 0.176 0.576 2e-34
166202479 703 multicopper oxidase 5 [Anopheles gambiae 0.874 0.157 0.585 5e-34
166202477 686 multicopper oxidase 4 [Anopheles gambiae 0.866 0.160 0.581 1e-33
158293505 310 AGAP008733-PA [Anopheles gambiae str. PE 0.866 0.354 0.581 1e-33
157121011 632 multicopper oxidase [Aedes aegypti] gi|1 0.874 0.175 0.576 6e-33
194858976 927 GG25346 [Drosophila erecta] gi|190661164 0.858 0.117 0.581 1e-32
321470899 725 hypothetical protein DAPPUDRAFT_317026 [ 0.858 0.150 0.581 2e-32
>gi|312382207|gb|EFR27743.1| hypothetical protein AND_05200 [Anopheles darlingi] Back     alignment and taxonomy information
 Score =  152 bits (383), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 81/110 (73%)

Query: 1   ACADCLKGNQKACRRKGCVTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMIDRE 60
           AC DC  GN+  C    C+TADG ER +LS+NR++PGP+I VC+ D ++VD+ N M   E
Sbjct: 5   ACGDCRWGNRSHCFHPQCITADGMERGVLSLNRKIPGPTIHVCRNDVVVVDLHNMMEGLE 64

Query: 61  VTLHWHGVYQKVTPWMDGVPMVTQCPIPSSTTFRYKFPAMPSGTFFYHSH 110
            T+HWHGV+Q  TPWMDGVPM+TQCPIP  TTFRY F A  SGT +YHSH
Sbjct: 65  STIHWHGVHQTDTPWMDGVPMITQCPIPHGTTFRYVFNATESGTQYYHSH 114

Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|312379442|gb|EFR25713.1| hypothetical protein AND_08709 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|157121009|ref|XP_001653729.1| multicopper oxidase [Aedes aegypti] gi|108882975|gb|EAT47200.1| AAEL001640-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|157121007|ref|XP_001653728.1| multicopper oxidase [Aedes aegypti] gi|108882974|gb|EAT47199.1| AAEL001632-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|166202479|gb|ABY84644.1| multicopper oxidase 5 [Anopheles gambiae] Back     alignment and taxonomy information
>gi|166202477|gb|ABY84643.1| multicopper oxidase 4 [Anopheles gambiae] Back     alignment and taxonomy information
>gi|158293505|ref|XP_001688595.1| AGAP008733-PA [Anopheles gambiae str. PEST] gi|157016739|gb|EDO64012.1| AGAP008733-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157121011|ref|XP_001653730.1| multicopper oxidase [Aedes aegypti] gi|108882976|gb|EAT47201.1| AAEL001672-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|194858976|ref|XP_001969297.1| GG25346 [Drosophila erecta] gi|190661164|gb|EDV58356.1| GG25346 [Drosophila erecta] Back     alignment and taxonomy information
>gi|321470899|gb|EFX81873.1| hypothetical protein DAPPUDRAFT_317026 [Daphnia pulex] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query127
FB|FBgn0032116 959 Mco1 "Multicopper oxidase-1" [ 0.858 0.113 0.572 1.3e-32
FB|FBgn0259247 784 laccase2 "laccase 2" [Drosophi 0.724 0.117 0.559 1.9e-26
FB|FBgn0039387 677 MCO3 "multicopper oxidase 3" [ 0.850 0.159 0.409 2.2e-22
FB|FBgn0052557 645 CG32557 [Drosophila melanogast 0.755 0.148 0.484 3.2e-22
TAIR|locus:2178973 573 AT5G21100 [Arabidopsis thalian 0.677 0.150 0.5 4.4e-21
TAIR|locus:2135242 582 AT4G39830 [Arabidopsis thalian 0.700 0.152 0.483 3.7e-20
TAIR|locus:505006625 588 AT5G21105 [Arabidopsis thalian 0.677 0.146 0.430 2e-18
ASPGD|ASPL0000035520 570 lccB [Emericella nidulans (tax 0.700 0.156 0.460 5.1e-18
UNIPROTKB|G5EGX4 595 MGCH7_ch7g635 "Laccase-1" [Mag 0.748 0.159 0.443 5.2e-17
TAIR|locus:2150049 586 AT5G01050 [Arabidopsis thalian 0.677 0.146 0.477 6.5e-17
FB|FBgn0032116 Mco1 "Multicopper oxidase-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 367 (134.2 bits), Expect = 1.3e-32, P = 1.3e-32
 Identities = 63/110 (57%), Positives = 80/110 (72%)

Query:     1 ACADCLKGNQKACRRKGCVTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMIDRE 60
             AC DC + N   C R  CV  DG ER+I  +NR +PGP+I+VC+GD I+VDVKNH++   
Sbjct:   273 ACYDCPR-NLTDCSRPHCVMGDGLERSITVVNRMMPGPAIEVCEGDEIVVDVKNHLLGES 331

Query:    61 VTLHWHGVYQKVTPWMDGVPMVTQCPIPSSTTFRYKFPAMPSGTFFYHSH 110
              ++HWHG++QK TP+MDGVP +TQCPI    TFRY FPA  SGT F+HSH
Sbjct:   332 TSIHWHGLHQKKTPYMDGVPHITQCPITPHATFRYSFPADLSGTHFWHSH 381
GO:0005381 "iron ion transmembrane transporter activity" evidence=ISS
GO:0004322 "ferroxidase activity" evidence=ISS;IDA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005507 "copper ion binding" evidence=IEA
GO:0031233 "intrinsic to external side of plasma membrane" evidence=ISM
GO:0009986 "cell surface" evidence=IDA
GO:0055072 "iron ion homeostasis" evidence=IMP
GO:0045178 "basal part of cell" evidence=IDA
FB|FBgn0259247 laccase2 "laccase 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0039387 MCO3 "multicopper oxidase 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0052557 CG32557 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TAIR|locus:2178973 AT5G21100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2135242 AT4G39830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006625 AT5G21105 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000035520 lccB [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G5EGX4 MGCH7_ch7g635 "Laccase-1" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
TAIR|locus:2150049 AT5G01050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query127
pfam07732119 pfam07732, Cu-oxidase_3, Multicopper oxidase 1e-40
TIGR03388 541 TIGR03388, ascorbase, L-ascorbate oxidase, plant t 6e-30
PLN02604 566 PLN02604, PLN02604, oxidoreductase 9e-28
PLN02191 574 PLN02191, PLN02191, L-ascorbate oxidase 9e-26
TIGR03389 539 TIGR03389, laccase, laccase, plant 8e-23
COG2132 451 COG2132, SufI, Putative multicopper oxidases [Seco 7e-21
TIGR03390 538 TIGR03390, ascorbOXfungal, L-ascorbate oxidase, fu 1e-19
PLN02354 552 PLN02354, PLN02354, copper ion binding / oxidoredu 9e-17
TIGR01480 587 TIGR01480, copper_res_A, copper-resistance protein 2e-16
PLN02835 539 PLN02835, PLN02835, oxidoreductase 9e-15
PLN00044 596 PLN00044, PLN00044, multi-copper oxidase-related p 3e-14
PLN02792 536 PLN02792, PLN02792, oxidoreductase 3e-11
PRK10965 523 PRK10965, PRK10965, multicopper oxidase; Provision 4e-10
PLN02168 545 PLN02168, PLN02168, copper ion binding / pectinest 7e-09
PLN02991 543 PLN02991, PLN02991, oxidoreductase 6e-08
>gnl|CDD|219542 pfam07732, Cu-oxidase_3, Multicopper oxidase Back     alignment and domain information 
 Score =  130 bits (330), Expect = 1e-40
 Identities = 47/93 (50%), Positives = 65/93 (69%), Gaps = 2/93 (2%)

Query: 19  VTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMIDREVTLHWHGVYQKVTPWMDG 78
           VT  G  R ++ +N Q PGP+I+V +GDT++V+V N++ D   T+HWHG+ Q  TPW DG
Sbjct: 7   VTPLGGTRQVIGVNGQFPGPTIRVREGDTVVVNVTNNL-DEPTTIHWHGLRQPGTPWADG 65

Query: 79  VPMVTQCPIPSSTTFRYKFPAM-PSGTFFYHSH 110
           VP VTQCPIP   +F Y+F     +GT++YHSH
Sbjct: 66  VPGVTQCPIPPGESFTYRFTVKQQAGTYWYHSH 98

This entry contains many divergent copper oxidase-like domains that are not recognised by the pfam00394 model. Length = 119
>gnl|CDD|234193 TIGR03388, ascorbase, L-ascorbate oxidase, plant type Back     alignment and domain information
>gnl|CDD|215324 PLN02604, PLN02604, oxidoreductase Back     alignment and domain information
>gnl|CDD|177843 PLN02191, PLN02191, L-ascorbate oxidase Back     alignment and domain information
>gnl|CDD|234194 TIGR03389, laccase, laccase, plant Back     alignment and domain information
>gnl|CDD|225043 COG2132, SufI, Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|132431 TIGR03390, ascorbOXfungal, L-ascorbate oxidase, fungal type Back     alignment and domain information
>gnl|CDD|177987 PLN02354, PLN02354, copper ion binding / oxidoreductase Back     alignment and domain information
>gnl|CDD|233432 TIGR01480, copper_res_A, copper-resistance protein, CopA family Back     alignment and domain information
>gnl|CDD|178429 PLN02835, PLN02835, oxidoreductase Back     alignment and domain information
>gnl|CDD|165622 PLN00044, PLN00044, multi-copper oxidase-related protein; Provisional Back     alignment and domain information
>gnl|CDD|178389 PLN02792, PLN02792, oxidoreductase Back     alignment and domain information
>gnl|CDD|236810 PRK10965, PRK10965, multicopper oxidase; Provisional Back     alignment and domain information
>gnl|CDD|215113 PLN02168, PLN02168, copper ion binding / pectinesterase Back     alignment and domain information
>gnl|CDD|215536 PLN02991, PLN02991, oxidoreductase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 127
PF07732117 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR01 100.0
PLN02835 539 oxidoreductase 100.0
PLN02168 545 copper ion binding / pectinesterase 100.0
TIGR03389 539 laccase laccase, plant. Members of this protein fa 100.0
PLN02354 552 copper ion binding / oxidoreductase 100.0
PLN02191 574 L-ascorbate oxidase 100.0
PLN02991 543 oxidoreductase 100.0
TIGR03390 538 ascorbOXfungal L-ascorbate oxidase, fungal type. T 100.0
PLN00044 596 multi-copper oxidase-related protein; Provisional 100.0
PLN02792 536 oxidoreductase 100.0
TIGR03388 541 ascorbase L-ascorbate oxidase, plant type. Members 99.98
PLN02604 566 oxidoreductase 99.97
TIGR01480 587 copper_res_A copper-resistance protein, CopA famil 99.97
KOG1263|consensus 563 99.96
PRK10965 523 multicopper oxidase; Provisional 99.95
PRK10883 471 FtsI repressor; Provisional 99.94
TIGR02376 311 Cu_nitrite_red nitrite reductase, copper-containin 99.93
COG2132 451 SufI Putative multicopper oxidases [Secondary meta 99.87
TIGR01480587 copper_res_A copper-resistance protein, CopA famil 99.86
TIGR03095148 rusti_cyanin rusticyanin. Rusticyanin is a blue co 99.77
PF07731138 Cu-oxidase_2: Multicopper oxidase; InterPro: IPR01 99.51
TIGR03096135 nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de 99.42
PLN02835539 oxidoreductase 99.26
TIGR03388541 ascorbase L-ascorbate oxidase, plant type. Members 99.17
TIGR03389539 laccase laccase, plant. Members of this protein fa 99.17
COG2132451 SufI Putative multicopper oxidases [Secondary meta 99.14
PLN02604566 oxidoreductase 99.13
PLN02191574 L-ascorbate oxidase 99.08
PLN02354552 copper ion binding / oxidoreductase 99.06
PLN02168545 copper ion binding / pectinesterase 99.06
PLN02792536 oxidoreductase 99.06
PLN02991543 oxidoreductase 99.03
PRK10965523 multicopper oxidase; Provisional 99.02
TIGR03390538 ascorbOXfungal L-ascorbate oxidase, fungal type. T 98.96
PRK02888635 nitrous-oxide reductase; Validated 98.93
PF13473104 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 98.91
PLN00044596 multi-copper oxidase-related protein; Provisional 98.88
PRK10883471 FtsI repressor; Provisional 98.81
TIGR02376311 Cu_nitrite_red nitrite reductase, copper-containin 98.81
TIGR0265699 cyanin_plasto plastocyanin. Members of this family 98.78
TIGR0265783 amicyanin amicyanin. Members of this family are am 98.75
PF0012799 Copper-bind: Copper binding proteins, plastocyanin 98.67
PF00394159 Cu-oxidase: Multicopper oxidase; InterPro: IPR0011 98.54
KOG1263|consensus563 98.5
PRK02710119 plastocyanin; Provisional 98.45
TIGR02375116 pseudoazurin pseudoazurin. Pseudoazurin, also call 98.33
COG3794128 PetE Plastocyanin [Energy production and conversio 98.16
TIGR03102115 halo_cynanin halocyanin domain. Halocyanins are bl 98.13
PF06525196 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb 97.99
TIGR03094195 sulfo_cyanin sulfocyanin. Members of this family a 97.97
PF00116120 COX2: Cytochrome C oxidase subunit II, periplasmic 96.97
TIGR02695125 azurin azurin. Azurin is a blue copper-binding pro 96.43
COG4263637 NosZ Nitrous oxide reductase [Energy production an 96.12
PRK10378 375 inactive ferrous ion transporter periplasmic prote 95.88
TIGR02866201 CoxB cytochrome c oxidase, subunit II. Cytochrome 95.61
COG1622247 CyoA Heme/copper-type cytochrome/quinol oxidases, 94.12
COG4454158 Uncharacterized copper-binding protein [Inorganic 92.84
PF1269082 BsuPI: Intracellular proteinase inhibitor; InterPr 91.31
COG4263637 NosZ Nitrous oxide reductase [Energy production an 89.85
PF05938110 Self-incomp_S1: Plant self-incompatibility protein 89.62
MTH00047194 COX2 cytochrome c oxidase subunit II; Provisional 88.48
PF0550689 DUF756: Domain of unknown function (DUF756); Inter 88.31
PRK13202104 ureB urease subunit beta; Reviewed 85.09
PF1063378 NPCBM_assoc: NPCBM-associated, NEW3 domain of alph 81.56
MTH00140228 COX2 cytochrome c oxidase subunit II; Provisional 80.11
>PF07732 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR011707 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information 
Probab=100.00  E-value=2.4e-37  Score=212.26  Aligned_cols=109  Identities=44%  Similarity=0.846  Sum_probs=100.9

Q ss_pred             ceEeecCCceEEEEEECCCCCCCeEEEecCCEEEEEEEcCCCCCceEEEEeeeeeecCCCCCCCcccceeeeCCCCEEEE
Q psy16567         16 KGCVTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMIDREVTLHWHGVYQKVTPWMDGVPMVTQCPIPSSTTFRY   95 (127)
Q Consensus        16 ~~~v~~~G~~~~~~~~ng~~pgP~i~v~~Gd~v~v~~~N~~~~~~~siH~HG~~~~~~~~~DG~~~~~~~~i~PG~~~~y   95 (127)
                      +..+.++|..+++|+|||++|||+|++++||+|+|+|+|.++ .+++|||||+++...+|+||++..++++|.||++++|
T Consensus         4 ~~~~~~~~~~~~~~~~ng~~pGPtI~v~~Gd~v~i~~~N~l~-~~~siH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~Y   82 (117)
T PF07732_consen    4 ETTVSPDGGTRKVWTYNGQFPGPTIRVREGDTVRITVTNNLD-EPTSIHWHGLHQPPSPWMDGVPGVTQCPIAPGESFTY   82 (117)
T ss_dssp             EEEEETTSTEEEEEEETTBSSEEEEEEETTEEEEEEEEEESS-SGBSEEEETSBSTTGGGGSGGTTTSGSSBSTTEEEEE
T ss_pred             EEEEEeCCcEEEEEEECCCCCCCEEEEEcCCeeEEEEEeccc-cccccccceeeeeeeeecCCcccccceeEEeecceee
Confidence            456778888899999999999999999999999999999998 8999999999998877899999999999999999999


Q ss_pred             EEeCCC-ceeeEEccCCCCCc----eeeEEEEcCC
Q psy16567         96 KFPAMP-SGTFFYHSHVDRRP----YCPEIEEKKK  125 (127)
Q Consensus        96 ~~~~~~-~Gt~~yH~H~~~~~----~g~liV~d~~  125 (127)
                      +|++++ +||||||||...+.    +|+|||++++
T Consensus        83 ~~~~~~~~Gt~wYH~H~~~~~~~GL~G~~iV~~~~  117 (117)
T PF07732_consen   83 EFTANQQAGTYWYHSHVHGQQVMGLYGAIIVEPPE  117 (117)
T ss_dssp             EEEESSCSEEEEEEECSTTHHHTTEEEEEEEE-TT
T ss_pred             eEeeeccccceeEeeCCCchhcCcCEEEEEEcCCC
Confidence            999987 99999999998874    9999999874

Since free copper is toxic, even at very low concentrations, its homeostasis in living organisms is tightly controlled by subtle molecular mechanisms. In eukaryotes, before being transported inside the cell via the high-affinity copper transporters of the CTR family, the copper (II) ion is reduced to copper (I). In blue copper proteins such as cupredoxin, the copper (I) ion form is stabilised by a constrained His2Cys coordination environment. Multicopper oxidases oxidise their substrate by accepting electrons at a mononuclear copper centre and transferring them to a trinuclear copper centre; dioxygen binds to the trinuclear centre and, following the transfer of four electrons, is reduced to two molecules of water []. There are three spectroscopically different copper centres found in multicopper oxidases: type 1 (or blue), type 2 (or normal) and type 3 (or coupled binuclear) [, ]. Multicopper oxidases consist of 2, 3 or 6 of these homologous domains, which also share homology to the cupredoxins azurin and plastocyanin. Structurally, these domains consist of a cupredoxin-like fold, a beta-sandwich consisting of 7 strands in 2 beta-sheets, arranged in a Greek-key beta-barrel []. Multicopper oxidases include: Ceruloplasmin (1.16.3.1 from EC) (ferroxidase), a 6-domain enzyme found in the serum of mammals and birds that oxidizes different inorganic and organic substances; exhibits internal sequence homology that appears to have evolved from the triplication of a Cu-binding domain similar to that of laccase and ascorbate oxidase. Laccase (1.10.3.2 from EC) (urishiol oxidase), a 3-domain enzyme found in fungi and plants, which oxidizes different phenols and diamines. CueO is a laccase found in Escherichia coli that is involved in copper-resistance []. Ascorbate oxidase (1.10.3.3 from EC), a 3-domain enzyme found in higher plants. Nitrite reductase (1.7.2.1 from EC), a 2-domain enzyme containing type-1 and type-2 copper centres [, ]. In addition to the above enzymes there are a number of other proteins that are similar to the multi-copper oxidases in terms of structure and sequence, some of which have lost the ability to bind copper. These include: copper resistance protein A (copA) from a plasmid in Pseudomonas syringae; domain A of (non-copper binding) blood coagulation factors V (Fa V) and VIII (Fa VIII) []; yeast FET3 required for ferrous iron uptake []; yeast hypothetical protein YFL041w; and the fission yeast homologue SpAC1F7.08. This entry represents multicopper oxidase type 3 (or coupled binuclear) domains. ; GO: 0005507 copper ion binding; PDB: 2QT6_B 3KW7_B 2R7E_A 3CDZ_A 1SDD_A 3G5W_D 3UAC_A 2YXV_A 3OD3_A 3NSY_A ....
>PLN02835 oxidoreductase Back     alignment and domain information
>PLN02168 copper ion binding / pectinesterase Back     alignment and domain information
>TIGR03389 laccase laccase, plant Back     alignment and domain information
>PLN02354 copper ion binding / oxidoreductase Back     alignment and domain information
>PLN02191 L-ascorbate oxidase Back     alignment and domain information
>PLN02991 oxidoreductase Back     alignment and domain information
>TIGR03390 ascorbOXfungal L-ascorbate oxidase, fungal type Back     alignment and domain information
>PLN00044 multi-copper oxidase-related protein; Provisional Back     alignment and domain information
>PLN02792 oxidoreductase Back     alignment and domain information
>TIGR03388 ascorbase L-ascorbate oxidase, plant type Back     alignment and domain information
>PLN02604 oxidoreductase Back     alignment and domain information
>TIGR01480 copper_res_A copper-resistance protein, CopA family Back     alignment and domain information
>KOG1263|consensus Back     alignment and domain information
>PRK10965 multicopper oxidase; Provisional Back     alignment and domain information
>PRK10883 FtsI repressor; Provisional Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information
>COG2132 SufI Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01480 copper_res_A copper-resistance protein, CopA family Back     alignment and domain information
>TIGR03095 rusti_cyanin rusticyanin Back     alignment and domain information
>PF07731 Cu-oxidase_2: Multicopper oxidase; InterPro: IPR011706 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>TIGR03096 nitroso_cyanin nitrosocyanin Back     alignment and domain information
>PLN02835 oxidoreductase Back     alignment and domain information
>TIGR03388 ascorbase L-ascorbate oxidase, plant type Back     alignment and domain information
>TIGR03389 laccase laccase, plant Back     alignment and domain information
>COG2132 SufI Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02604 oxidoreductase Back     alignment and domain information
>PLN02191 L-ascorbate oxidase Back     alignment and domain information
>PLN02354 copper ion binding / oxidoreductase Back     alignment and domain information
>PLN02168 copper ion binding / pectinesterase Back     alignment and domain information
>PLN02792 oxidoreductase Back     alignment and domain information
>PLN02991 oxidoreductase Back     alignment and domain information
>PRK10965 multicopper oxidase; Provisional Back     alignment and domain information
>TIGR03390 ascorbOXfungal L-ascorbate oxidase, fungal type Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D Back     alignment and domain information
>PLN00044 multi-copper oxidase-related protein; Provisional Back     alignment and domain information
>PRK10883 FtsI repressor; Provisional Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information
>TIGR02656 cyanin_plasto plastocyanin Back     alignment and domain information
>TIGR02657 amicyanin amicyanin Back     alignment and domain information
>PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>PF00394 Cu-oxidase: Multicopper oxidase; InterPro: IPR001117 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>KOG1263|consensus Back     alignment and domain information
>PRK02710 plastocyanin; Provisional Back     alignment and domain information
>TIGR02375 pseudoazurin pseudoazurin Back     alignment and domain information
>COG3794 PetE Plastocyanin [Energy production and conversion] Back     alignment and domain information
>TIGR03102 halo_cynanin halocyanin domain Back     alignment and domain information
>PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus Back     alignment and domain information
>TIGR03094 sulfo_cyanin sulfocyanin Back     alignment and domain information
>PF00116 COX2: Cytochrome C oxidase subunit II, periplasmic domain This family corresponds to chains b and o Back     alignment and domain information
>TIGR02695 azurin azurin Back     alignment and domain information
>COG4263 NosZ Nitrous oxide reductase [Energy production and conversion] Back     alignment and domain information
>PRK10378 inactive ferrous ion transporter periplasmic protein EfeO; Provisional Back     alignment and domain information
>TIGR02866 CoxB cytochrome c oxidase, subunit II Back     alignment and domain information
>COG1622 CyoA Heme/copper-type cytochrome/quinol oxidases, subunit 2 [Energy production and conversion] Back     alignment and domain information
>COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF12690 BsuPI: Intracellular proteinase inhibitor; InterPro: IPR020481 BsuPI is a intracellular proteinase inhibitor that directly regulates the major intracellular proteinase (ISP-1) activity in vivo Back     alignment and domain information
>COG4263 NosZ Nitrous oxide reductase [Energy production and conversion] Back     alignment and domain information
>PF05938 Self-incomp_S1: Plant self-incompatibility protein S1; InterPro: IPR010264 This family consists of a series of plant proteins which are related to the Papaver rhoeas S1 self-incompatibility protein Back     alignment and domain information
>MTH00047 COX2 cytochrome c oxidase subunit II; Provisional Back     alignment and domain information
>PF05506 DUF756: Domain of unknown function (DUF756); InterPro: IPR008475 This domain is found, normally as a tandem repeat, at the C terminus of bacterial phospholipase C proteins Back     alignment and domain information
>PRK13202 ureB urease subunit beta; Reviewed Back     alignment and domain information
>PF10633 NPCBM_assoc: NPCBM-associated, NEW3 domain of alpha-galactosidase; InterPro: IPR018905 This domain has been named NEW3, but its function is not known Back     alignment and domain information
>MTH00140 COX2 cytochrome c oxidase subunit II; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query127
1aoz_A 552 Refined Crystal Structure Of Ascorbate Oxidase At 1 1e-19
3sqr_A 580 Crystal Structure Of Laccase From Botrytis Aclada A 1e-18
3v9e_A 580 Structure Of The L513m Mutant Of The Laccase From B 1e-18
3kw7_A 502 Crystal Structure Of Lacb From Trametes Sp. Ah28-2 2e-18
2qt6_A 498 Crystal Structure Determination Of A Blue Laccase F 5e-18
1kya_A 499 Active Laccase From Trametes Versicolor Complexed W 6e-18
2hzh_A 499 Crystal Structure Of Laccase From Coriolus Zonatus 8e-18
4a2f_A 497 Coriolopsis Gallica Laccase Collected At 12.65 Kev 1e-17
4a2d_A 496 Coriolopsis Gallica Laccase T2 Copper Depleted At P 1e-17
2hrg_A 496 Crystal Structure Of Blue Laccase From Trametes Tro 2e-17
1zpu_A 534 Crystal Structure Of Fet3p, A Multicopper Oxidase T 4e-17
1hfu_A 503 Type-2 Cu-Depleted Laccase From Coprinus Cinereus A 1e-16
1a65_A 504 Type-2 Cu-depleted Laccase From Coprinus Cinereus L 1e-16
2xyb_A 497 Crystal Structure Of A Fully Functional Laccase Fro 2e-16
1gyc_A 499 Crystal Structure Determination At Room Temperature 3e-16
3fpx_A 499 Native Fungus Laccase From Trametes Hirsuta Length 4e-16
3pxl_A 499 Type-2 Cu-Depleted Fungus Laccase From Trametes Hir 4e-16
2h5u_A 499 Crystal Structure Of Laccase From Cerrena Maxima At 1e-15
3div_A 499 Crystal Structure Of Laccase From Cerrena Maxima At 1e-15
3t6v_A 495 Crystal Structure Of Laccase From Steccherinum Ochr 3e-15
3g5w_A 318 Crystal Structure Of Blue Copper Oxidase From Nitro 7e-15
1gw0_A 559 Crystal Structure Of Laccase From Melanocarpus Albo 4e-13
3dkh_A 559 L559a Mutant Of Melanocarpus Albomyces Laccase Leng 4e-13
2q9o_A 559 Near-Atomic Resolution Structure Of A Melanocarpus 1e-12
3pps_A 604 Crystal Structure Of An Ascomycete Fungal Laccase F 8e-12
1v10_A 521 Structure Of Rigidoporus Lignosus Laccase From Hemi 8e-10
3gdc_A 288 Crystal Structure Of Multicopper Oxidase Length = 2 3e-08
3zx1_A 481 Multicopper Oxidase From Campylobacter Jejuni: A Me 3e-08
2xu9_A 439 Crystal Structure Of Laccase From Thermus Thermophi 6e-07
3uaa_A 489 Multicopper Oxidase Cueo Mutant C500se506q (Data1) 8e-05
1kv7_A 488 Crystal Structure Of Cueo, A Multi-Copper Oxidase F 8e-05
3nsc_A 505 C500s Mutant Of Cueo Bound To Cu(Ii) Length = 505 8e-05
3qqx_A 505 Reduced Native Intermediate Of The Multicopper Oxid 8e-05
1pf3_A 498 Crystal Structure Of The M441l Mutant Of The Multic 9e-05
3nsf_A 505 Apo Form Of The Multicopper Oxidase Cueo Length = 5 9e-05
3nsy_A 511 The Multi-Copper Oxidase Cueo With Six Met To Ser M 9e-05
2yxv_A 446 The Deletion Mutant Of Multicopper Oxidase Cueo Len 1e-04
3cg8_A 343 Laccase From Streptomyces Coelicolor Length = 343 3e-04
4gy4_A 278 Role Of The Biradical Intermediate Observed During 4e-04
3kw8_A 276 Two-Domain Laccase From Streptomyces Coelicolor At 5e-04
3tas_A 313 Small Laccase From Streptomyces Viridosporus T7a Le 6e-04
4gxf_A 279 Role Of The Biradical Intermediate Observed During 8e-04
>pdb|1AOZ|A Chain A, Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution Length = 552 Back     alignment and structure 
Iteration: 1

 Score = 91.3 bits (225), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 37/87 (42%), Positives = 53/87 (60%)
Query: 25  ERAILSINRQLPGPSIQVCKGDTIIVDVKNHMIDREVTLHWHGVYQKVTPWMDGVPMVTQ 84
           E  ++ IN Q PGP+I+   GD+++V++ N +    V +HWHG+ Q+ TPW DG   ++Q
Sbjct: 21  ENIVMGINGQFPGPTIRANAGDSVVVELTNKLHTEGVVIHWHGILQRGTPWADGTASISQ 80
Query: 85  CPIPSSTTFRYKFPAMPSGTFFYHSHV 111
           C I    TF Y F     GTFFYH H+
Sbjct: 81  CAINPGETFFYNFTVDNPGTFFYHGHL 107
>pdb|3SQR|A Chain A, Crystal Structure Of Laccase From Botrytis Aclada At 1.67 A Resolution Length = 580 Back     alignment and structure
>pdb|3V9E|A Chain A, Structure Of The L513m Mutant Of The Laccase From B.aclada Length = 580 Back     alignment and structure
>pdb|3KW7|A Chain A, Crystal Structure Of Lacb From Trametes Sp. Ah28-2 Length = 502 Back     alignment and structure
>pdb|2QT6|A Chain A, Crystal Structure Determination Of A Blue Laccase From Lentinus Tigrinus Length = 498 Back     alignment and structure
>pdb|1KYA|A Chain A, Active Laccase From Trametes Versicolor Complexed With 2,5-Xylidine Length = 499 Back     alignment and structure
>pdb|2HZH|A Chain A, Crystal Structure Of Laccase From Coriolus Zonatus At 2.6 A Resolution Length = 499 Back     alignment and structure
>pdb|4A2F|A Chain A, Coriolopsis Gallica Laccase Collected At 12.65 Kev Length = 497 Back     alignment and structure
>pdb|4A2D|A Chain A, Coriolopsis Gallica Laccase T2 Copper Depleted At Ph 4.5 Length = 496 Back     alignment and structure
>pdb|2HRG|A Chain A, Crystal Structure Of Blue Laccase From Trametes Trogii Complexed With P-Methylbenzoate Length = 496 Back     alignment and structure
>pdb|1ZPU|A Chain A, Crystal Structure Of Fet3p, A Multicopper Oxidase That Functions In Iron Import Length = 534 Back     alignment and structure
>pdb|1HFU|A Chain A, Type-2 Cu-Depleted Laccase From Coprinus Cinereus At 1.68 A Resolution Length = 503 Back     alignment and structure
>pdb|1A65|A Chain A, Type-2 Cu-depleted Laccase From Coprinus Cinereus Length = 504 Back     alignment and structure
>pdb|2XYB|A Chain A, Crystal Structure Of A Fully Functional Laccase From The Ligninolytic Fungus Pycnoporus Cinnabarinus Length = 497 Back     alignment and structure
>pdb|1GYC|A Chain A, Crystal Structure Determination At Room Temperature Of A Laccase From Trametes Versicolor In Its Oxidised Form Containing A Full Complement Of Copper Ions Length = 499 Back     alignment and structure
>pdb|3FPX|A Chain A, Native Fungus Laccase From Trametes Hirsuta Length = 499 Back     alignment and structure
>pdb|3PXL|A Chain A, Type-2 Cu-Depleted Fungus Laccase From Trametes Hirsuta Length = 499 Back     alignment and structure
>pdb|2H5U|A Chain A, Crystal Structure Of Laccase From Cerrena Maxima At 1.9a Resolution Length = 499 Back     alignment and structure
>pdb|3DIV|A Chain A, Crystal Structure Of Laccase From Cerrena Maxima At 1.76a Resolution Length = 499 Back     alignment and structure
>pdb|3T6V|A Chain A, Crystal Structure Of Laccase From Steccherinum Ochraceum Length = 495 Back     alignment and structure
>pdb|3G5W|A Chain A, Crystal Structure Of Blue Copper Oxidase From Nitrosomonas Europaea Length = 318 Back     alignment and structure
>pdb|1GW0|A Chain A, Crystal Structure Of Laccase From Melanocarpus Albomyces In Four Copper Form Length = 559 Back     alignment and structure
>pdb|3DKH|A Chain A, L559a Mutant Of Melanocarpus Albomyces Laccase Length = 559 Back     alignment and structure
>pdb|2Q9O|A Chain A, Near-Atomic Resolution Structure Of A Melanocarpus Albomyces Laccase Length = 559 Back     alignment and structure
>pdb|3PPS|A Chain A, Crystal Structure Of An Ascomycete Fungal Laccase From Thielavia Arenaria Length = 604 Back     alignment and structure
>pdb|1V10|A Chain A, Structure Of Rigidoporus Lignosus Laccase From Hemihedrally Twinned Crystals Length = 521 Back     alignment and structure
>pdb|3GDC|A Chain A, Crystal Structure Of Multicopper Oxidase Length = 288 Back     alignment and structure
>pdb|3ZX1|A Chain A, Multicopper Oxidase From Campylobacter Jejuni: A Metallo-Oxidase Length = 481 Back     alignment and structure
>pdb|2XU9|A Chain A, Crystal Structure Of Laccase From Thermus Thermophilus Hb27 Length = 439 Back     alignment and structure
>pdb|3UAA|A Chain A, Multicopper Oxidase Cueo Mutant C500se506q (Data1) Length = 489 Back     alignment and structure
>pdb|1KV7|A Chain A, Crystal Structure Of Cueo, A Multi-Copper Oxidase From E. Coli Involved In Copper Homeostasis Length = 488 Back     alignment and structure
>pdb|3NSC|A Chain A, C500s Mutant Of Cueo Bound To Cu(Ii) Length = 505 Back     alignment and structure
>pdb|3QQX|A Chain A, Reduced Native Intermediate Of The Multicopper Oxidase Cueo Length = 505 Back     alignment and structure
>pdb|1PF3|A Chain A, Crystal Structure Of The M441l Mutant Of The Multicopper Oxidase Cueo Length = 498 Back     alignment and structure
>pdb|3NSF|A Chain A, Apo Form Of The Multicopper Oxidase Cueo Length = 505 Back     alignment and structure
>pdb|3NSY|A Chain A, The Multi-Copper Oxidase Cueo With Six Met To Ser Mutations (M358s, M361s,M362s,M364s,M366s,M368s) Length = 511 Back     alignment and structure
>pdb|2YXV|A Chain A, The Deletion Mutant Of Multicopper Oxidase Cueo Length = 446 Back     alignment and structure
>pdb|3CG8|A Chain A, Laccase From Streptomyces Coelicolor Length = 343 Back     alignment and structure
>pdb|4GY4|A Chain A, Role Of The Biradical Intermediate Observed During The Turnover Of Slac: A Two-Domain Laccase From Streptomyces Coelicolor Length = 278 Back     alignment and structure
>pdb|3KW8|A Chain A, Two-Domain Laccase From Streptomyces Coelicolor At 2.3 A Resolution Length = 276 Back     alignment and structure
>pdb|3TAS|A Chain A, Small Laccase From Streptomyces Viridosporus T7a Length = 313 Back     alignment and structure
>pdb|4GXF|A Chain A, Role Of The Biradical Intermediate Observed During The Turnover Of Slac: A Two-Domain Laccase From Streptomyces Coelicolor Length = 279 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query127
1aoz_A 552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 4e-51
3sqr_A 580 Laccase; multicopper oxidase, glycosylation, oxido 2e-47
3t6v_A 495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 2e-47
3pxl_A 499 Laccase; 4-copper protein, metal-binding, oxidored 2e-47
2zwn_A 339 Two-domain type laccase; muticopper oxidase, oxido 5e-47
3g5w_A 318 Multicopper oxidase type 1; two domain, laccase, n 8e-47
2q9o_A 559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 2e-46
1zpu_A 534 Iron transport multicopper oxidase FET3; ferroxida 2e-45
1v10_A 521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 2e-44
1hfu_A 503 Laccase 1; oxidoreductase, blue multi-copper oxida 3e-44
3gdc_A 288 Multicopper oxidase; beta sandwich, plasmid, oxido 7e-32
2xu9_A 439 Laccase; oxidoreductase, multicopper oxidases; 1.5 4e-28
3kw8_A 276 Laccase, putative copper oxidase; two-domain lacca 1e-24
3cg8_A 343 Laccase; oxidoreductase, multicopper blue protein; 1e-24
3zx1_A 481 Oxidoreductase, putative; laccase, metallo-oxidase 3e-24
3od3_A 488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 5e-24
3aw5_A 448 Multicopper oxidase; beta barrel, oxidoreductase; 1e-23
3abg_A 534 Bilirubin oxidase; cleavage on PAIR of basic resid 2e-23
2zoo_A 442 Probable nitrite reductase; electron transfer, ele 9e-21
2uxt_A 451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 1e-19
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 6e-19
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 6e-17
1kbv_A 327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 1e-18
2bw4_A 340 Copper-containing nitrite reductase; oxidoreductas 3e-18
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 5e-18
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 5e-09
1sdd_A 306 Coagulation factor V; copper-binding protein, cofa 8e-18
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 5e-17
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 2e-15
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 6e-13
1oe1_A 336 Dissimilatory copper-containing nitrite reductase; 4e-16
2wsd_A 513 Spore coat protein A; oxidoreductase, multi-copper 2e-15
1mzy_A 333 Copper-containing nitrite reductase; mutant M182T, 3e-15
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 1e-12
2g23_A 612 PHS, phenoxazinone synthase; copper, metalloprotei 2e-11
2r7e_B 770 Coagulation factor VIII; ceruloplasmin fold, cuppe 7e-09
2cal_A154 Rusticyanin; iron respiratory electron transport c 8e-04
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Length = 552 Back     alignment and structure
 Score =  168 bits (428), Expect = 4e-51
 Identities = 37/94 (39%), Positives = 54/94 (57%)

Query: 19  VTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMIDREVTLHWHGVYQKVTPWMDG 78
              +  E  ++ IN Q PGP+I+   GD+++V++ N +    V +HWHG+ Q+ TPW DG
Sbjct: 15  WAPNCNENIVMGINGQFPGPTIRANAGDSVVVELTNKLHTEGVVIHWHGILQRGTPWADG 74

Query: 79  VPMVTQCPIPSSTTFRYKFPAMPSGTFFYHSHVD 112
              ++QC I    TF Y F     GTFFYH H+ 
Sbjct: 75  TASISQCAINPGETFFYNFTVDNPGTFFYHGHLG 108
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Length = 580 Back     alignment and structure
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Length = 495 Back     alignment and structure
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Length = 499 Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Length = 339 Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Length = 318 Back     alignment and structure
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Length = 559 Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Length = 534 Back     alignment and structure
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Length = 521 Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Length = 503 Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Length = 288 Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Length = 439 Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} Length = 276 Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Length = 343 Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Length = 481 Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Length = 488 Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Length = 448 Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Length = 534 Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Length = 442 Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Length = 451 Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Length = 742 Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Length = 742 Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Length = 327 Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Length = 340 Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Length = 447 Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Length = 447 Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Length = 306 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Length = 336 Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Length = 513 Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Length = 333 Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Length = 647 Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Length = 770 Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query127
3sqr_A 580 Laccase; multicopper oxidase, glycosylation, oxido 100.0
3t6v_A 495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 100.0
3pxl_A 499 Laccase; 4-copper protein, metal-binding, oxidored 100.0
1aoz_A 552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 100.0
1v10_A 521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 100.0
1zpu_A 534 Iron transport multicopper oxidase FET3; ferroxida 100.0
2q9o_A 559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 100.0
1hfu_A 503 Laccase 1; oxidoreductase, blue multi-copper oxida 100.0
3g5w_A 318 Multicopper oxidase type 1; two domain, laccase, n 99.98
3gdc_A 288 Multicopper oxidase; beta sandwich, plasmid, oxido 99.97
3zx1_A 481 Oxidoreductase, putative; laccase, metallo-oxidase 99.97
2zwn_A 339 Two-domain type laccase; muticopper oxidase, oxido 99.97
2uxt_A 451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 99.97
3abg_A 534 Bilirubin oxidase; cleavage on PAIR of basic resid 99.96
3od3_A 488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 99.96
2xu9_A 439 Laccase; oxidoreductase, multicopper oxidases; 1.5 99.96
3t9w_A 299 Small laccase, multi-copper oxidase; two-domain co 99.96
2wsd_A 513 Spore coat protein A; oxidoreductase, multi-copper 99.96
3gyr_A 612 PHS, phenoxazinone synthase; metalloprotein, lacca 99.96
3kw8_A 276 Laccase, putative copper oxidase; two-domain lacca 99.96
3tas_A 313 Small laccase, multi-copper oxidase; two-domain la 99.95
3aw5_A 448 Multicopper oxidase; beta barrel, oxidoreductase; 99.95
2g23_A 612 PHS, phenoxazinone synthase; copper, metalloprotei 99.94
1kbv_A 327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 99.94
1oe1_A 336 Dissimilatory copper-containing nitrite reductase; 99.93
1mzy_A 333 Copper-containing nitrite reductase; mutant M182T, 99.93
2bw4_A 340 Copper-containing nitrite reductase; oxidoreductas 99.93
1sdd_A 306 Coagulation factor V; copper-binding protein, cofa 99.93
2zoo_A 442 Probable nitrite reductase; electron transfer, ele 99.93
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 99.93
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 99.91
3cg8_A 343 Laccase; oxidoreductase, multicopper blue protein; 99.91
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 99.91
2r7e_B 770 Coagulation factor VIII; ceruloplasmin fold, cuppe 99.9
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 99.87
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 99.85
3kw8_A276 Laccase, putative copper oxidase; two-domain lacca 99.77
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 99.74
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 99.73
3cvb_A105 Plastocyanin; cupredoxin, SELF assembly, copper, e 99.72
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 99.67
3cg8_A343 Laccase; oxidoreductase, multicopper blue protein; 99.67
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 99.62
3zx1_A481 Oxidoreductase, putative; laccase, metallo-oxidase 99.56
3tas_A313 Small laccase, multi-copper oxidase; two-domain la 99.53
3t9w_A299 Small laccase, multi-copper oxidase; two-domain co 99.52
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 99.51
3gdc_A288 Multicopper oxidase; beta sandwich, plasmid, oxido 99.5
2cal_A154 Rusticyanin; iron respiratory electron transport c 99.5
2g23_A612 PHS, phenoxazinone synthase; copper, metalloprotei 99.47
3g5w_A318 Multicopper oxidase type 1; two domain, laccase, n 99.47
2ov0_A105 Amicyanin; beta-sandwich, electron transport; 0.75 99.46
2xu9_A439 Laccase; oxidoreductase, multicopper oxidases; 1.5 99.45
3t6v_A495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 99.44
3pxl_A499 Laccase; 4-copper protein, metal-binding, oxidored 99.44
1sdd_A306 Coagulation factor V; copper-binding protein, cofa 99.43
1hfu_A503 Laccase 1; oxidoreductase, blue multi-copper oxida 99.43
1v10_A521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 99.42
1zpu_A534 Iron transport multicopper oxidase FET3; ferroxida 99.4
2aan_A139 Auracyanin A; cupredoxin fold, electron transport; 99.38
2zwn_A339 Two-domain type laccase; muticopper oxidase, oxido 99.36
3abg_A534 Bilirubin oxidase; cleavage on PAIR of basic resid 99.33
1kbv_A327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 99.31
2gim_A106 Plastocyanin; beta sheet, Cu, helix, electron tran 99.3
3od3_A488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 99.3
4hci_A100 Cupredoxin 1; structural genomics, niaid, national 99.3
2wsd_A513 Spore coat protein A; oxidoreductase, multi-copper 99.29
3gyr_A612 PHS, phenoxazinone synthase; metalloprotein, lacca 99.28
1aoz_A552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 99.26
2q9o_A559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 99.24
3aw5_A448 Multicopper oxidase; beta barrel, oxidoreductase; 99.2
2zoo_A 442 Probable nitrite reductase; electron transfer, ele 99.16
2r7e_B 770 Coagulation factor VIII; ceruloplasmin fold, cuppe 99.15
2bw4_A340 Copper-containing nitrite reductase; oxidoreductas 99.15
2uxt_A451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 99.14
2plt_A98 Plastocyanin; electron transport; 1.50A {Chlamydom 99.12
3sqr_A580 Laccase; multicopper oxidase, glycosylation, oxido 99.12
1mzy_A333 Copper-containing nitrite reductase; mutant M182T, 99.12
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 99.11
1pcs_A98 Plastocyanin; electron transport; 2.15A {Synechocy 99.05
1bxv_A91 Plastocyanin; copper protein, electron transfer; 1 99.04
3ef4_A124 Pseudoazurin, blue copper protein; electron transf 98.99
1b3i_A97 PETE protein, protein (plastocyanin); electron tra 98.98
3erx_A123 Pseudoazurin; copper protein, high-resolution, E t 98.97
3tu6_A127 Pseudoazurin (blue copper protein); cupredoxins, b 98.95
1oe1_A336 Dissimilatory copper-containing nitrite reductase; 98.95
1byp_A99 Protein (plastocyanin); electron transfer, photosy 98.93
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 98.93
1kdj_A102 Plastocyanin; electron transfer, photosystem, PAI- 98.91
3c75_A132 Amicyanin; copper proteins, electron transfer comp 98.91
1plc_A99 Plastocyanin; electron transport; 1.33A {Populus n 98.89
1id2_A106 Amicyanin; beta barrel, type-1 blue copper protein 98.83
1cuo_A129 Protein (azurin ISO-2); beta barrel, periplasmic, 98.76
1iuz_A98 Plastocyanin; electron transport; 1.60A {Ulva pert 98.76
1paz_A123 Pseudoazurin precursor; electron transfer(cupropro 98.72
3ay2_A167 Lipid modified azurin protein; beta sandwich, bact 98.7
1pmy_A123 Pseudoazurin; electron transfer(cuproprotein); 1.5 98.7
2ux6_A122 Pseudoazurin; type-1 copper, metal-binding, redox 98.68
2iaa_C128 Azurin; quinoprotein, tryptophan tryptophylquinone 98.47
2ccw_A129 Azurin II, AZN-2; electron transport (cuproprotein 98.46
1nwp_A128 Azurin; electron transport, cupredoxin, electron t 98.38
2cua_A135 Protein (CUA); CUA center, electron transport; 1.6 98.1
3fsa_A125 Azurin; copper, cupredoxin fold, metal-binding, pr 97.95
3s8f_B168 Cytochrome C oxidase subunit 2; complex IV, respir 97.83
1cyx_A205 CYOA; electron transport; 2.30A {Escherichia coli} 94.02
2gsm_B262 Cytochrome C oxidase subunit 2; transmembrane prot 91.58
3hb3_B298 Cytochrome C oxidase subunit 2; electron transfer, 91.14
3isy_A120 Bsupi, intracellular proteinase inhibitor; intrace 87.28
1v54_B227 Cytochrome C oxidase polypeptide II; oxidoreductas 86.57
4ac7_B126 Urease subunit beta; hydrolase, bacillus pasteurii 84.75
4ubp_B126 Protein (urease (chain B)); bacillus pasteurii, ni 84.75
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Back     alignment and structure
Probab=100.00  E-value=1.2e-34  Score=241.63  Aligned_cols=110  Identities=38%  Similarity=0.689  Sum_probs=103.2

Q ss_pred             eEeecCCceEEEEEECCCCCCCeEEEecCCEEEEEEEcCCCCCceEEEEeeeeeecCCCCCCCcccceeeeCCCCEEEEE
Q psy16567         17 GCVTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMIDREVTLHWHGVYQKVTPWMDGVPMVTQCPIPSSTTFRYK   96 (127)
Q Consensus        17 ~~v~~~G~~~~~~~~ng~~pgP~i~v~~Gd~v~v~~~N~~~~~~~siH~HG~~~~~~~~~DG~~~~~~~~i~PG~~~~y~   96 (127)
                      ..+.+||.++.+|+|||++|||+|++++||+|+|+|+|+++.++++|||||+.+...+|+||++.++|++|.||++|+|+
T Consensus        77 ~~~~pdG~~~~~~~~NG~~PGP~I~~~~GD~v~V~v~N~l~~~~tsIHwHGl~~~~t~~~DGvp~vTq~pI~PG~sftY~  156 (580)
T 3sqr_A           77 STITPDGYTRSAMTFNGTVPGPAIIADWGDNLIIHVTNNLEHNGTSIHWHGIRQLGSLEYDGVPGVTQCPIAPGDTLTYK  156 (580)
T ss_dssp             EEECSSSBCEEEEEETTBSSCCCEEEETTCEEEEEEEECCSSCCBCEEETTCCCTTCGGGSCCBTTTBCCBCTTCEEEEE
T ss_pred             EEecCCCeEEEEEEECCccCCceEEEeCCCEEEEEEEECCCCCcceEEecccccCCCccccCCCccccCCCCCCCeEEEE
Confidence            45778999999999999999999999999999999999997468999999999987789999999999999999999999


Q ss_pred             EeCCCceeeEEccCCCCCc----eeeEEEEcCCC
Q psy16567         97 FPAMPSGTFFYHSHVDRRP----YCPEIEEKKKT  126 (127)
Q Consensus        97 ~~~~~~Gt~~yH~H~~~~~----~g~liV~d~~~  126 (127)
                      |+++++||||||||...|+    +|+|||++|++
T Consensus       157 f~~~q~GT~WYHsH~~~q~~~GL~G~lIV~~p~~  190 (580)
T 3sqr_A          157 FQVTQYGTTWYHSHFSLQYGDGLFGPLIINGPAT  190 (580)
T ss_dssp             EECCCCEEEEEEECSTTGGGGTCEEEEEEECCCS
T ss_pred             EECCCCcceEEeecccccccCcCEEEEEeeCccc
Confidence            9999999999999998886    99999998764
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Back     alignment and structure
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Back     alignment and structure
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Back     alignment and structure
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Back     alignment and structure
>3t9w_A Small laccase, multi-copper oxidase; two-domain copper oxidase, Cu-binding, oxidoreducta; 1.50A {Amycolatopsis SP} Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Back     alignment and structure
>3gyr_A PHS, phenoxazinone synthase; metalloprotein, laccase, multicopper oxidase, hexamer, oxidoreductase, antibiotic biosynthesis; 2.30A {Streptomyces antibioticus} Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} PDB: 4gxf_A* 4gy4_A* Back     alignment and structure
>3tas_A Small laccase, multi-copper oxidase; two-domain laccase, oxidoreductase, secreted; HET: PG4; 2.30A {Streptomyces viridosporus} PDB: 3tbb_A 3tbc_A* Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} PDB: 4gxf_A* 4gy4_A* Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Back     alignment and structure
>3tas_A Small laccase, multi-copper oxidase; two-domain laccase, oxidoreductase, secreted; HET: PG4; 2.30A {Streptomyces viridosporus} PDB: 3tbb_A 3tbc_A* Back     alignment and structure
>3t9w_A Small laccase, multi-copper oxidase; two-domain copper oxidase, Cu-binding, oxidoreducta; 1.50A {Amycolatopsis SP} Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Back     alignment and structure
>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Back     alignment and structure
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Back     alignment and structure
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Back     alignment and structure
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Back     alignment and structure
>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Back     alignment and structure
>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Back     alignment and structure
>3gyr_A PHS, phenoxazinone synthase; metalloprotein, laccase, multicopper oxidase, hexamer, oxidoreductase, antibiotic biosynthesis; 2.30A {Streptomyces antibioticus} Back     alignment and structure
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Back     alignment and structure
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Back     alignment and structure
>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 Back     alignment and structure
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Back     alignment and structure
>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A Back     alignment and structure
>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A Back     alignment and structure
>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 Back     alignment and structure
>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* Back     alignment and structure
>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A Back     alignment and structure
>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Back     alignment and structure
>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A Back     alignment and structure
>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A Back     alignment and structure
>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 Back     alignment and structure
>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A Back     alignment and structure
>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A Back     alignment and structure
>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* Back     alignment and structure
>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 Back     alignment and structure
>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A Back     alignment and structure
>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* Back     alignment and structure
>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A Back     alignment and structure
>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A Back     alignment and structure
>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* Back     alignment and structure
>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... Back     alignment and structure
>3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ... Back     alignment and structure
>1cyx_A CYOA; electron transport; 2.30A {Escherichia coli} SCOP: b.6.1.2 PDB: 1cyw_A Back     alignment and structure
>2gsm_B Cytochrome C oxidase subunit 2; transmembrane protein complex, oxidoreductase; HET: DMU HEA TRD; 2.00A {Rhodobacter sphaeroides} SCOP: b.6.1.2 f.17.2.1 PDB: 3dtu_B* 3fye_B* 3fyi_B* 3omi_B* 3om3_B* 3oma_B* 3omn_B* 1m56_B* 1m57_B* Back     alignment and structure
>3hb3_B Cytochrome C oxidase subunit 2; electron transfer, proton transfer, proton pumping, membrane protein, cell inner membrane, cell membrane, copper; HET: HEA LDA LMT; 2.25A {Paracoccus denitrificans} PDB: 1ar1_B* 3ehb_B* 1qle_B* Back     alignment and structure
>3isy_A Bsupi, intracellular proteinase inhibitor; intracellular proteinase inhibitor bsupi, beta sandwich, GRE structural genomics; HET: PG4; 2.61A {Bacillus subtilis} Back     alignment and structure
>1v54_B Cytochrome C oxidase polypeptide II; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: b.6.1.2 f.17.2.1 PDB: 1oco_B* 1occ_B* 1ocz_B* 1ocr_B* 1v55_B* 2dyr_B* 2dys_B* 2eij_B* 2eik_B* 2eil_B* 2eim_B* 2ein_B* 2occ_B* 2y69_B* 2ybb_M* 2zxw_B* 3abk_B* 3abl_B* 3abm_B* 3ag1_B* ... Back     alignment and structure
>4ac7_B Urease subunit beta; hydrolase, bacillus pasteurii; HET: CXM KCX FLC; 1.50A {Sporosarcina pasteurii} PDB: 1s3t_B* 3ubp_B* 1ie7_B* 4ubp_B* 1ubp_B* 2ubp_B* Back     alignment and structure
>4ubp_B Protein (urease (chain B)); bacillus pasteurii, nickel, acetohydroxamic acid, metalloenzyme, hydrolase; HET: KCX; 1.55A {Sporosarcina pasteurii} SCOP: b.85.3.1 PDB: 1s3t_B* 3ubp_B* 1ie7_B* 1ubp_B* 2ubp_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 127
d1hfua1131 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprin 9e-33
d1gyca1130 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, la 3e-31
d1v10a1136 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [T 3e-30
d1aoza1129 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cuc 9e-29
d2q9oa1162 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces 5e-22
d1kbva1151 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisser 2e-20
d1oe2a1159 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcalige 2e-20
d2j5wa1192 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapie 8e-20
d1sdda1180 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos t 6e-19
d1gska1181 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Baci 1e-18
d2j5wa3207 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sap 1e-18
d1kv7a1140 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Esch 4e-18
d2bw4a1157 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcalige 4e-18
d1mzya1153 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodoba 3e-16
d2j5wa4179 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sap 4e-15
d1e30a_153 b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidan 5e-14
d2j5wa5149 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sa 3e-13
d1sddb2139 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (B 2e-12
d1sdda2116 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos 2e-12
d2j5wa2145 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sap 1e-11
d1kcwa2146 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sap 3e-10
d1kbva2151 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisse 1e-04
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Length = 131 Back     information, alignment and structure

class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Multidomain cupredoxins
domain: Laccase
species: Inky cap fungus (Coprinus cinereus) [TaxId: 5346]

 Score =  109 bits (274), Expect = 9e-33
 Identities = 41/101 (40%), Positives = 56/101 (55%), Gaps = 6/101 (5%)

Query: 17  GCVTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMID----REVTLHWHGVYQKV 72
             V+ DGF RA + +N    GP I+  K D   ++V N + +    R  ++HWHG++Q+ 
Sbjct: 14  ANVSPDGFTRAGILVNGV-HGPLIRGGKNDNFELNVVNDLDNPTMLRPTSIHWHGLFQRG 72

Query: 73  TPWMDGVPMVTQCPIPSSTTFRYKFP-AMPSGTFFYHSHVD 112
           T W DG   V QCPI     F YKF  A  +GTF+YHSH  
Sbjct: 73  TNWADGADGVNQCPISPGHAFLYKFTPAGHAGTFWYHSHFG 113
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Length = 130 Back     information, alignment and structure
>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} Length = 136 Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Length = 129 Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Length = 162 Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Length = 151 Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Length = 159 Back     information, alignment and structure
>d2j5wa1 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1sdda1 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 180 Back     information, alignment and structure
>d1gska1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Length = 181 Back     information, alignment and structure
>d2j5wa3 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Length = 140 Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Length = 157 Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Length = 153 Back     information, alignment and structure
>d2j5wa4 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 179 Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Length = 153 Back     information, alignment and structure
>d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 139 Back     information, alignment and structure
>d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 116 Back     information, alignment and structure
>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 145 Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d1kbva2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Length = 151 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query127
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 100.0
d1v10a1136 Laccase {Rigidoporus lignosus [TaxId: 219653]} 100.0
d1gyca1130 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 100.0
d1hfua1131 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 100.0
d2q9oa1162 Laccase {Melanocarpus albomyces [TaxId: 204285]} 100.0
d1kv7a1140 multi-copper oxidase CueO {Escherichia coli [TaxId 100.0
d2bw4a1157 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.97
d1oe2a1159 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.97
d1mzya1153 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 99.96
d1gska1181 Spore coat protein A, CotA {Bacillus subtilis [Tax 99.96
d1kbva1151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 99.96
d1sdda1180 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.93
d2j5wa3207 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.91
d2j5wa1192 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.91
d2j5wa4179 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 99.87
d1kbva2151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 99.85
d2j5wa5149 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.83
d2j5wa2145 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1kcwa2146 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1sddb2139 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.81
d1fwxa1132 Nitrous oxide reductase, C-terminal domain {Paraco 99.76
d1ibya_112 Red copper protein nitrosocyanin {Nitrosomonas eur 99.75
d1sdda2116 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.73
d1qnia1131 Nitrous oxide reductase, C-terminal domain {Pseudo 99.52
d2bw4a2173 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.5
d1kv7a3181 multi-copper oxidase CueO {Escherichia coli [TaxId 99.44
d1hfua3200 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 99.41
d1gska3154 Spore coat protein A, CotA {Bacillus subtilis [Tax 99.35
d1sddb167 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.35
d1v10a3190 Laccase {Rigidoporus lignosus [TaxId: 219653]} 99.32
d1aoza3214 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 99.31
d1gyca3199 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 99.3
d1oe1a2177 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.28
d2q9oa3216 Laccase {Melanocarpus albomyces [TaxId: 204285]} 99.23
d1qhqa_139 Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] 99.2
d1pcsa_98 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.84
d2ov0a1105 Amicyanin {Paracoccus denitrificans [TaxId: 266]} 98.83
d2plta_98 Plastocyanin {Green alga (Chlamydomonas reinhardti 98.78
d2q5ba1105 Plastocyanin {Cyanobacterium (Phormidium laminosum 98.71
d2cuaa_122 Cytochrome c oxidase {Thermus thermophilus, ba3 ty 98.7
d2jxma197 Plastocyanin {Photosynthetic prokaryote (Prochloro 98.66
d1bxua_91 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.64
d1kdja_102 Plastocyanin {Fern (Adiantum capillus-veneris) [Ta 98.59
d1id2a_106 Amicyanin {Paracoccus versutus (Thiobacillus versu 98.57
d1v10a2168 Laccase {Rigidoporus lignosus [TaxId: 219653]} 98.5
d1pmya_123 Pseudoazurin {Methylobacterium extorquens, strain 98.47
d1cuoa_129 Azurin {Methylomonas sp. j [TaxId: 32038]} 98.45
d1plca_99 Plastocyanin {Poplar (Populus nigra), variant ital 98.44
d1hfua2172 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 98.42
d1bypa_99 Plastocyanin {White campion (Silene pratensis) [Ta 98.42
d2q9oa2181 Laccase {Melanocarpus albomyces [TaxId: 204285]} 98.42
d1iuza_98 Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 98.4
d1adwa_123 Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 98.38
d2cj3a1105 Plastocyanin {Anabaena variabilis [TaxId: 1172]} 98.38
d1mzya2178 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 98.37
d1paza_120 Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta 98.36
d1jzga_128 Azurin {Pseudomonas aeruginosa [TaxId: 287]} 98.33
d1gyca2170 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 98.3
d2ccwa1129 Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d 98.26
d1aoza2209 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 98.22
d1nwpa_128 Azurin {Pseudomonas putida [TaxId: 303]} 98.18
d1bqka_124 Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 98.16
d1kv7a2165 multi-copper oxidase CueO {Escherichia coli [TaxId 97.82
d1gska2174 Spore coat protein A, CotA {Bacillus subtilis [Tax 97.6
d1cyxa_158 Quinol oxidase (CyoA) {Escherichia coli [TaxId: 56 94.61
d1w8oa1103 Sialidase, "linker" domain {Micromonospora viridif 89.32
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Multidomain cupredoxins
domain: Ascorbate oxidase
species: Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]

Probab=100.00  E-value=6.1e-38  Score=215.52  Aligned_cols=111  Identities=35%  Similarity=0.718  Sum_probs=102.8

Q ss_pred             ceEeecCCceEEEEEECCCCCCCeEEEecCCEEEEEEEcCCCCCceEEEEeeeeeecCCCCCCCcccceeeeCCCCEEEE
Q psy16567         16 KGCVTADGFERAILSINRQLPGPSIQVCKGDTIIVDVKNHMIDREVTLHWHGVYQKVTPWMDGVPMVTQCPIPSSTTFRY   95 (127)
Q Consensus        16 ~~~v~~~G~~~~~~~~ng~~pgP~i~v~~Gd~v~v~~~N~~~~~~~siH~HG~~~~~~~~~DG~~~~~~~~i~PG~~~~y   95 (127)
                      ...+.+||.++.+|+|||++|||+|++++||+|+|+|.|+++..+++|||||+++...++.|+.+.+++++|.||++++|
T Consensus        12 ~~~~~pdg~~~~~~~~NG~~PGP~i~v~~GD~v~i~l~N~l~~~~~~iH~Hg~~~~~~~~~~~~~~~~~~~I~PG~s~~y   91 (129)
T d1aoza1          12 YMFWAPNCNENIVMGINGQFPGPTIRANAGDSVVVELTNKLHTEGVVIHWHGILQRGTPWADGTASISQCAINPGETFFY   91 (129)
T ss_dssp             EEEECTTSSCEEEEEETTBSSCCCEEEETTCEEEEEEEECCSSCCBCEEEETCCCTTCGGGSCCBTTTBCCBCTTCEEEE
T ss_pred             EEEECCCCeEEEEEEECCCcCCCeEEEECCcEEEEEEEeCCCCCCeeeeeccceeeccCccccccccccceECCCCEEEE
Confidence            34578999999999999999999999999999999999998656899999999988878899999999999999999999


Q ss_pred             EEeCCCceeeEEccCCCCCc----eeeEEEEcCCC
Q psy16567         96 KFPAMPSGTFFYHSHVDRRP----YCPEIEEKKKT  126 (127)
Q Consensus        96 ~~~~~~~Gt~~yH~H~~~~~----~g~liV~d~~~  126 (127)
                      +|+++++||||||||+..|.    +|+|||++|++
T Consensus        92 ~f~a~~~Gt~~YH~H~~~h~~~Gm~G~~iV~~~~~  126 (129)
T d1aoza1          92 NFTVDNPGTFFYHGHLGMQRSAGLYGSLIVDPPQG  126 (129)
T ss_dssp             EEECCSCEEEEEEECSTTTGGGTCEEEEEEECCTT
T ss_pred             EEECCCCCceEEecCCHHHHhCCCEEEEEEcCCCC
Confidence            99999999999999998886    99999998764
>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1gska1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1sdda1 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2j5wa3 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j5wa1 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j5wa4 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d1kbva2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2bw4a2 b.6.1.3 (A:166-338) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1kv7a3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hfua3 b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1gska3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sddb1 b.6.1.3 (B:1657-1723) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v10a3 b.6.1.3 (A:305-494) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d1aoza3 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1gyca3 b.6.1.3 (A:301-499) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1oe1a2 b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d2q9oa3 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Back     information, alignment and structure
>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Back     information, alignment and structure
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1v10a2 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Back     information, alignment and structure
>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} Back     information, alignment and structure
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} Back     information, alignment and structure
>d1hfua2 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Back     information, alignment and structure
>d2q9oa2 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1mzya2 b.6.1.3 (A:194-371) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Back     information, alignment and structure
>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gyca2 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Back     information, alignment and structure
>d1aoza2 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Back     information, alignment and structure
>d1kv7a2 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gska2 b.6.1.3 (A:183-356) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cyxa_ b.6.1.2 (A:) Quinol oxidase (CyoA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w8oa1 b.1.18.2 (A:403-505) Sialidase, "linker" domain {Micromonospora viridifaciens [TaxId: 1881]} Back     information, alignment and structure