Psyllid ID: psy16618


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50-
MGSASIDLTTLELGRCTDLILTLEDPNKPEENLEYVGYNVEKYNAEQRQYR
cccEEEEccEEEcccEEEEEEEEccccccccccccEEEEEEEEcHHHHHcc
cccccEEEHHHHHcccccEEEEEccccccHHcHHEEEEEEEcccHHHHccc
mgsasidlttlelgrCTDLiltledpnkpeenleyVGYNVEKYNAEQRQYR
mgsasidlttlelgrCTDLIltledpnkpeenleyvgynvekynaeqrqyr
MGSASIDLTTLELGRCTDLILTLEDPNKPEENLEYVGYNVEKYNAEQRQYR
******DLTTLELGRCTDLILTLE********LEYVGYNV***********
***ASIDLTTLELGRCTDLILTLEDPNKPEENLEYVGYNVEKY********
MGSASIDLTTLELGRCTDLILTLEDPNKPEENLEYVGYNVEKYNAEQRQYR
***ASIDLTTLELGRCTDLILTLEDPNKPEENLEYVGYNVEKYNAEQ****
ooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooo
oooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSASIDLTTLELGRCTDLILTLEDPNKPEENLEYVGYNVEKYNAEQRQYR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query51 2.2.26 [Sep-21-2011]
Q6DN14 999 Multiple C2 and transmemb no N/A 0.647 0.033 0.606 0.0004
>sp|Q6DN14|MCTP1_HUMAN Multiple C2 and transmembrane domain-containing protein 1 OS=Homo sapiens GN=MCTP1 PE=2 SV=2 Back     alignment and function desciption
 Score = 43.5 bits (101), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 20/33 (60%), Positives = 26/33 (78%)

Query: 1   MGSASIDLTTLELGRCTDLILTLEDPNKPEENL 33
           MGSA +DLT LEL R TD+ LTL+DP+ P+ +L
Sbjct: 340 MGSAFLDLTQLELNRPTDVTLTLKDPHYPDHDL 372





Homo sapiens (taxid: 9606)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST


Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query51
UNIPROTKB|F1MG14128 MCTP1 "Uncharacterized protein 0.647 0.257 0.606 2.4e-05
RGD|1305199 946 Mctp1 "multiple C2 domains, tr 0.647 0.034 0.606 0.00058
UNIPROTKB|Q6DN14 999 MCTP1 "Multiple C2 and transme 0.647 0.033 0.606 0.00062
UNIPROTKB|F1MG14 MCTP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 99 (39.9 bits), Expect = 2.4e-05, P = 2.4e-05
 Identities = 20/33 (60%), Positives = 26/33 (78%)

Query:     1 MGSASIDLTTLELGRCTDLILTLEDPNKPEENL 33
             MGSA +DLT LEL R TD+ LTL+DP+ P+ +L
Sbjct:    61 MGSAFLDLTQLELNRPTDVTLTLKDPHYPDHDL 93




GO:0016021 "integral to membrane" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
RGD|1305199 Mctp1 "multiple C2 domains, transmembrane 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6DN14 MCTP1 "Multiple C2 and transmembrane domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query51
cd04042121 cd04042, C2A_MCTP_PRT, C2 domain first repeat foun 2e-07
>gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
 Score = 43.4 bits (103), Expect = 2e-07
 Identities = 20/36 (55%), Positives = 28/36 (77%), Gaps = 1/36 (2%)

Query: 1   MGSASIDLTTLELGRCTDLILTLEDPNKPEENLEYV 36
           MGSA +DL+TLEL + T++ L LEDPN  +E+L Y+
Sbjct: 79  MGSAFVDLSTLELNKPTEVKLKLEDPNS-DEDLGYI 113


MCTPs are involved in Ca2+ signaling at the membrane. MCTP is composed of a variable N-terminal sequence, three C2 domains, two transmembrane regions (TMRs), and a short C-terminal sequence. It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligands for calcium ions. This cd contains the first C2 repeat, C2A, and has a type-II topology. Length = 121

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 51
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 98.25
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 95.65
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 95.24
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 94.97
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 94.22
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 93.66
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 93.05
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 92.39
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 92.38
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 91.71
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 91.36
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 91.35
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 91.24
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 90.81
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 90.73
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 90.24
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 89.95
PF06775 199 Seipin: Putative adipose-regulatory protein (Seipi 89.28
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 88.29
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 87.39
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 87.31
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 87.13
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 85.81
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 83.21
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 82.49
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 82.4
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 82.08
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 81.19
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 80.61
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
Probab=98.25  E-value=1.9e-06  Score=50.90  Aligned_cols=43  Identities=49%  Similarity=0.714  Sum_probs=40.6

Q ss_pred             CcceEEEcCceeccceEEEEEEecCCCCCCCCcceEEEEEEEEc
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLEDPNKPEENLEYVGYNVEKYN   44 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~Dp~~~e~dlG~I~l~vtL~p   44 (51)
                      ||.|.++|+++..++..+..+.|.|+++ +..+|+|.+.++++|
T Consensus        79 iG~~~~~l~~l~~~~~~~~~~~L~~~~~-~~~~G~l~l~~~~~~  121 (121)
T cd04042          79 MGSAFVDLSTLELNKPTEVKLKLEDPNS-DEDLGYISLVVTLTP  121 (121)
T ss_pred             eEEEEEEHHHcCCCCCeEEEEECCCCCC-ccCceEEEEEEEECC
Confidence            7999999999999999999999999887 678999999999987



MCTPs are involved in Ca2+ signaling at the membrane. MCTP is composed of a variable N-terminal sequence, three C2 domains, two transmembrane regions (TMRs), and a short C-terminal sequence. It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular protein

>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>PF06775 Seipin: Putative adipose-regulatory protein (Seipin); InterPro: IPR009617 Seipin is a protein of approximately 400 residues in humans, which is the product of a gene homologous to the murine guanine nucleotide-binding protein (G protein) gamma-3 linked gene Back     alignment and domain information
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query51
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 96.52
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 96.21
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 95.94
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 95.5
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 95.38
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 95.34
2r83_A 284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 94.73
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 93.9
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 92.75
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 89.22
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 89.14
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 87.29
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 86.07
1dqv_A 296 Synaptotagmin III; beta sandwich, calcium ION, C2 84.35
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 84.31
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 84.13
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
Probab=96.52  E-value=0.0085  Score=34.74  Aligned_cols=43  Identities=14%  Similarity=0.179  Sum_probs=33.7

Q ss_pred             CcceEEEcCceeccceEEEEEEecCCCCCCCCcceEEEEEEEEcc
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLEDPNKPEENLEYVGYNVEKYNA   45 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~Dp~~~e~dlG~I~l~vtL~pk   45 (51)
                      +|.+.++|+++  ....+.-+.|..........|+|.|.+++..|
T Consensus       106 lG~~~i~l~~l--~~~~~~w~~L~~~~~~~~~~G~i~l~l~~e~k  148 (148)
T 3kwu_A          106 LGQTIIEVRTL--SGEMDVWYNLDKRTDKSAVSGAIRLHISVEIK  148 (148)
T ss_dssp             EEEEEEEGGGC--CSEEEEEEECBCSSTTCCCCCEEEEEEEEEC-
T ss_pred             EEEEEEEHHHC--cCCCCEEEEcccCCCCCCCceEEEEEEEEEeC
Confidence            58999999998  45667778887665555688999999998764



>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query51
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 96.49
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 96.14
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 94.43
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 92.72
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 89.75
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 84.18
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 84.09
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: PLC-like (P variant)
domain: Domain from cytosolic phospholipase A2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=96.49  E-value=0.0012  Score=36.41  Aligned_cols=39  Identities=10%  Similarity=0.332  Sum_probs=33.3

Q ss_pred             CcceEEEcCceeccceEEEEEEecCCCCCCCCcceEEEEEEEEc
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLEDPNKPEENLEYVGYNVEKYN   44 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~Dp~~~e~dlG~I~l~vtL~p   44 (51)
                      ||.|.++|++|..+...+..+.|+++..     |.|.+.+.+.|
T Consensus        87 lG~~~i~L~~l~~~~~~~~~~~L~~~~~-----g~i~~~l~~~~  125 (126)
T d1rlwa_          87 LGTATFTVSSMKVGEKKEVPFIFNQVTE-----MVLEMSLEVAS  125 (126)
T ss_dssp             EEEEEEEGGGSCTTCEEEEEEEETTTEE-----EEEEEEEECCC
T ss_pred             EEEEEEEHHHccCCCeEEEEEEccCCCe-----EEEEEEEEEEe
Confidence            6999999999999999999999976543     88888777655



>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure