Psyllid ID: psy16676

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-
MVFTYLAIFKEANRQEKQLHSRHYGNQLLLGNHGRDASYSNSNGDLAANRQEKQLHSRHYGNQLLLGNHGRDASYSNSNGDLAVGAGKLTLEDAHHSTPTKDRNIIKMKREHKAARTLGIIMGTFILCWLPFFLWYVITSLCGDACDCPDYVVAIFFWIGYFNSTLNPLIYAYFNRDFREAFKNTLQCAFCSLCRREPSDLDELDIRRASLRYDDRTKSVYSDTYLKHHIDRRTSSEFGNAIVSSSISFWIPCTIMVFTYLAIFKEANRQEKQLHSRHYGNQLLLGNHGRDASYSNSNGDLAVGAGKLTLEDAHHSTPTKDRNIIKMKREHKAARTLGIIMGTFILCWLPFFLWYVITSLCGDACDCPDYVVAIFFWIGYFNSTLNPLIYAYFNRDFREAFKNTLQCAFCSLCRREPSDLDELDIRRASLRYDDRTKSVYSDTYLKHHIDRRTSSEFGSSL
cEEEEHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccHHHHHccHHHHHHHHHHHHHHHcccccccccccccHHHccccccccccccccccccccccccccccccccccEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccHHHHcccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cEEHHHHHHHHHHHHHHHHHHHccccccccccccccccccEcccccccccccccEEccccccEEEEEEEEccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHEEEHHHHHHHHcHHHHHHccHHHHHHHHHHHHHHccHHHcccEEEEcEEEEEcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHcccccEEEHcccHHHHHHHHHHHHcccccccccccccccEEEcccccEEcccccccccccccccccccccccccccccc
MVFTYLAIFKEANRQEKQLHSrhygnqlllgnhgrdasysnsngdlaANRQEKQLHsrhygnqlllgnhgrdasysnsngdlavgagkltledahhstptkdrNIIKMKREHKAARTLGIIMGTFILCWLPFFLWYVITSlcgdacdcpdYVVAIFFWIGYfnstlnplIYAYFNRDFREAFKNTLQCAFCSlcrrepsdldeLDIRRAslryddrtksvysdtylkhhidrrtssefgnAIVSSSISFWIPCTIMVFTYLAIFKEANRQEKQLHSrhygnqlllgnhgrdasysnsngdlavgagkltledahhstptkdrNIIKMKREHKAARTLGIIMGTFILCWLPFFLWYVITSlcgdacdcpdYVVAIFFWIGYfnstlnplIYAYFNRDFREAFKNTLQCAFCSlcrrepsdldeLDIRRAslryddrtksvysdtylkhhidrrtssefgssl
MVFTYLAIFKEANRQEKQLHSRHYGNQLLLGNHGRDASYSNSNGDLAANRQEKQLHSRHYGNQLLLGNHGRDASYSNSNGDLAVGAGKltledahhstptkdrniikMKREHKAARTLGIIMGTFILCWLPFFLWYVITSLCGDACDCPDYVVAIFFWIGYFNSTLNPLIYAYFNRDFREAFKNTLQCAFCSLcrrepsdldeldirraslryddrtksvysdtylkhhidrrtssefgNAIVSSSISFWIPCTIMVFTYLAIFKEANRQEKQLHSRHYGNQLLLGNHGRDASYSNSNGDLAVGAGKltledahhstptkdrniikMKREHKAARTLGIIMGTFILCWLPFFLWYVITSLCGDACDCPDYVVAIFFWIGYFNSTLNPLIYAYFNRDFREAFKNTLQCAFCSLcrrepsdldeldirraslryddrtksvysdtylkhhidrrtssefgssl
MVFTYLAIFKEANRQEKQLHSRHYGNQLLLGNHGRDASYSNSNGDLAANRQEKQLHSRHYGNQLLLGNHGRDASYSNSNGDLAVGAGKLTLEDAHHSTPTKDRNIIKMKREHKAARTLGIIMGTFILCWLPFFLWYVITSLCGDACDCPDYVVAIFFWIGYFNSTLNPLIYAYFNRDFREAFKNTLQCAFCSLCRREPSDLDELDIRRASLRYDDRTKSVYSDTYLKHHIDRRTSSEFGNAIVSSSISFWIPCTIMVFTYLAIFKEANRQEKQLHSRHYGNQLLLGNHGRDASYSNSNGDLAVGAGKLTLEDAHHSTPTKDRNIIKMKREHKAARTLGIIMGTFILCWLPFFLWYVITSLCGDACDCPDYVVAIFFWIGYFNSTLNPLIYAYFNRDFREAFKNTLQCAFCSLCRREPSDLDELDIRRASLRYDDRTKSVYSDTYLKHHIDRRTSSEFGSSL
**FTYLAIFKE****************************************************************************************************HKAARTLGIIMGTFILCWLPFFLWYVITSLCGDACDCPDYVVAIFFWIGYFNSTLNPLIYAYFNRDFREAFKNTLQCAFCSLCRREPSDLDELDIRRASLRYDDRTKSVYSDTYLKHHIDRRTSSEFGNAIVSSSISFWIPCTIMVFTYLAIFKEAN*********HYGNQLLLG********************************************HKAARTLGIIMGTFILCWLPFFLWYVITSLCGDACDCPDYVVAIFFWIGYFNSTLNPLIYAYFNRDFREAFKNTLQCAFCSLCRREPSDLDELDIRRASLRYDDRTKSVYSDTYL****************
MVFTYLAIFKEANR***************************************************************************************************AARTLGIIMGTFILCWLPFFLWYVITSLCGDACDCPDYVVAIFFWIGYFNSTLNPLIYAYFNRDFREAFKNTLQCAFCSLCRREPSDLDELDIRRASLRYDDRTKSVYSDTYLKHHIDRRTSSEFGNAIVSSSISFWIPCTIMVFTYLAIFKEAN***************************************************************KAARTLGIIMGTFILCWLPFFLWYVITSLCGDACDCPDYVVAIFFWIGYFNSTLNPLIYAYFNRDFREAFKNTLQCAFCSL*************************************************
MVFTYLAIFKEANRQEKQLHSRHYGNQLLLGNHGRDASYSNSNGDLAANRQEKQLHSRHYGNQLLLGNHGRDASYSNSNGDLAVGAGKLTLEDAHHSTPTKDRNIIKMKREHKAARTLGIIMGTFILCWLPFFLWYVITSLCGDACDCPDYVVAIFFWIGYFNSTLNPLIYAYFNRDFREAFKNTLQCAFCSLCRREPSDLDELDIRRASLRYDDRTKSVYSDTYLKHHIDRRTSSEFGNAIVSSSISFWIPCTIMVFTYLAIFKEANRQEKQLHSRHYGNQLLLGNHGRDASYSNSNGDLAVGAGKLTLEDAHHSTPTKDRNIIKMKREHKAARTLGIIMGTFILCWLPFFLWYVITSLCGDACDCPDYVVAIFFWIGYFNSTLNPLIYAYFNRDFREAFKNTLQCAFCSLCRREPSDLDELDIRRASLRYDDRTKSVYSDTYLKHHIDR**********
MVFTYLAIFKEANRQEKQLH*******************SNSNGDLAANRQEKQLHSRHYGNQLLLGNHGRD****************************KDRNIIKMKREHKAARTLGIIMGTFILCWLPFFLWYVITSLCGDACDCPDYVVAIFFWIGYFNSTLNPLIYAYFNRDFREAFKNTLQCAFCSLCRREPSDLDELDIRRASLRYDDRTKSVYSDTYLKHHIDRRTSSEFGNAIVSSSISFWIPCTIMVFTYLAIFKEANRQEKQLHSR******************************************KDRNIIKMKREHKAARTLGIIMGTFILCWLPFFLWYVITSLCGDACDCPDYVVAIFFWIGYFNSTLNPLIYAYFNRDFREAFKNTLQCAFCSLCRREPSDLDELDIRRASLRYDDR**************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVFTYLAIFKEANRQEKQLHSRHYGNQLLLGNHGRDASYSNSNGDLAANRQEKQLHSRHYGNQLLLGNHGRDASYSNSNGDLAVGAGKLTLEDAHHSTPTKDRNIIKMKREHKAARTLGIIMGTFILCWLPFFLWYVITSLCGDACDCPDYVVAIFFWIGYFNSTLNPLIYAYFNRDFREAFKNTLQCAFCSLCRREPSDLDELDIRRASLRYDDRTKSVYSDTYLKHHIDRRTSSEFGNAIVSSSISFWIPCTIMVFTYLAIFKEANRQEKQLHSRHYGNQLLLGNHGRDASYSNSNGDLAVGAGKLTLEDAHHSTPTKDRNIIKMKREHKAARTLGIIMGTFILCWLPFFLWYVITSLCGDACDCPDYVVAIFFWIGYFNSTLNPLIYAYFNRDFREAFKNTLQCAFCSLCRREPSDLDELDIRRASLRYDDRTKSVYSDTYLKHHIDRRTSSEFGSSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query461 2.2.26 [Sep-21-2011]
Q4LBB9536 Octopamine receptor beta- no N/A 0.427 0.367 0.650 3e-71
Q4LBB61256 Octopamine receptor beta- no N/A 0.193 0.070 0.788 6e-41
Q9VCZ3508 Octopamine receptor beta- no N/A 0.327 0.297 0.497 2e-40
O42384416 5-hydroxytryptamine recep N/A N/A 0.255 0.283 0.457 2e-26
P34969479 5-hydroxytryptamine recep yes N/A 0.373 0.359 0.383 8e-26
P32304448 5-hydroxytryptamine recep yes N/A 0.373 0.383 0.378 2e-25
P32305448 5-hydroxytryptamine recep yes N/A 0.373 0.383 0.378 2e-25
P50407446 5-hydroxytryptamine recep yes N/A 0.373 0.385 0.383 2e-25
Q64264421 5-hydroxytryptamine recep no N/A 0.381 0.418 0.320 7e-25
P19327422 5-hydroxytryptamine recep no N/A 0.381 0.417 0.324 1e-24
>sp|Q4LBB9|OCTB2_DROME Octopamine receptor beta-2R OS=Drosophila melanogaster GN=Octbeta2R PE=2 SV=2 Back     alignment and function desciption
 Score =  269 bits (688), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 159/209 (76%), Gaps = 12/209 (5%)

Query: 241 AIVSSSISFWIPCTIMVFTYLAIFKEANRQEKQLHSRHYGNQLLLGNHGRDASYSNSNGD 300
           A++SSSISFWIPCTIM+FTYLAIF+EANRQEKQL  RH GN +L+       S     G+
Sbjct: 319 AVISSSISFWIPCTIMIFTYLAIFREANRQEKQLMMRH-GNAMLMHRPSMQPS-----GE 372

Query: 301 LAVGAGK---LTLEDAHHS-TPTKDRNIIKMKREHKAARTLGIIMGTFILCWLPFFLWYV 356
              G+G    LTL +     TPTKD+++IKMKREHKAARTLGIIMGTFILCWLPFFLWY 
Sbjct: 373 ALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKREHKAARTLGIIMGTFILCWLPFFLWYT 432

Query: 357 ITSLCGDACDCPDYVVAIFFWIGYFNSTLNPLIYAYFNRDFREAFKNTLQCAFCSLCRRE 416
           ++  C + C  PD VV+I FWIGYFNSTLNPLIYAYFNRDFREAF+NTL C FC+  +  
Sbjct: 433 LSMTC-EECQVPDIVVSILFWIGYFNSTLNPLIYAYFNRDFREAFRNTLLCLFCNWWKDR 491

Query: 417 PSDLDELDIRRASLRYDDRTKSVYSDTYL 445
              LD +DIRR+SLRYD R KSVYS++YL
Sbjct: 492 HLPLD-IDIRRSSLRYDQRAKSVYSESYL 519
Receptor for octopamine. Octopamine (OA) is a neurotransmitter, neurohormone, and neuromodulator in invertebrates. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Drosophila melanogaster (taxid: 7227)
>sp|Q4LBB6|OCTB3_DROME Octopamine receptor beta-3R OS=Drosophila melanogaster GN=Octbeta3R PE=2 SV=4 Back     alignment and function description
>sp|Q9VCZ3|OCTB1_DROME Octopamine receptor beta-1R OS=Drosophila melanogaster GN=oa2 PE=2 SV=1 Back     alignment and function description
>sp|O42384|5H1AB_TAKRU 5-hydroxytryptamine receptor 1A-beta OS=Takifugu rubripes GN=htr1a-B PE=3 SV=1 Back     alignment and function description
>sp|P34969|5HT7R_HUMAN 5-hydroxytryptamine receptor 7 OS=Homo sapiens GN=HTR7 PE=1 SV=2 Back     alignment and function description
>sp|P32304|5HT7R_MOUSE 5-hydroxytryptamine receptor 7 OS=Mus musculus GN=Htr7 PE=2 SV=2 Back     alignment and function description
>sp|P32305|5HT7R_RAT 5-hydroxytryptamine receptor 7 OS=Rattus norvegicus GN=Htr7 PE=2 SV=2 Back     alignment and function description
>sp|P50407|5HT7R_CAVPO 5-hydroxytryptamine receptor 7 OS=Cavia porcellus GN=HTR7 PE=2 SV=1 Back     alignment and function description
>sp|Q64264|5HT1A_MOUSE 5-hydroxytryptamine receptor 1A OS=Mus musculus GN=Htr1a PE=2 SV=2 Back     alignment and function description
>sp|P19327|5HT1A_RAT 5-hydroxytryptamine receptor 1A OS=Rattus norvegicus GN=Htr1a PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query461
291278187404 putative GPCR-type octopamine beta recep 0.472 0.539 0.755 1e-94
383852940435 PREDICTED: octopamine receptor beta-2R-l 0.472 0.501 0.743 8e-92
380021239442 PREDICTED: octopamine receptor beta-2R-l 0.472 0.493 0.743 2e-91
328776788438 PREDICTED: octopamine receptor beta-2R i 0.472 0.497 0.738 4e-91
350408093437 PREDICTED: octopamine receptor beta-2R-l 0.472 0.498 0.738 1e-90
340728118437 PREDICTED: octopamine receptor beta-2R-l 0.472 0.498 0.734 3e-90
322788170443 hypothetical protein SINV_06087 [Solenop 0.472 0.492 0.734 6e-90
242020588432 class A rhodopsin-like G-protein coupled 0.453 0.483 0.734 6e-88
328711645443 PREDICTED: octopamine receptor beta-2R-l 0.477 0.496 0.718 1e-85
91090654411 PREDICTED: similar to beta adrenergic re 0.496 0.557 0.662 1e-81
>gi|291278187|gb|ADD91575.1| putative GPCR-type octopamine beta receptor, partial [Schistocerca gregaria] Back     alignment and taxonomy information
 Score =  353 bits (905), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 173/229 (75%), Positives = 192/229 (83%), Gaps = 11/229 (4%)

Query: 241 AIVSSSISFWIPCTIMVFTYLAIFKEANRQEKQLHSRHYGNQLLLGNHGRDASYSNSNGD 300
            +VSS ISFWIPCTIM+FTYLAIF+EANRQEKQLHSR  GN +L+ +H     Y+NSNGD
Sbjct: 179 VVVSSLISFWIPCTIMIFTYLAIFREANRQEKQLHSR-IGNAMLMNHHRNSREYANSNGD 237

Query: 301 LAVGAG----KLTLEDAHH----STPTKDRNIIKMKREHKAARTLGIIMGTFILCWLPFF 352
           +   +G     LTL + HH    STPTKDRNIIKMKREHKAARTLGIIMGTFILCWLPFF
Sbjct: 238 VMSSSGGSSKTLTLHEVHHGDVHSTPTKDRNIIKMKREHKAARTLGIIMGTFILCWLPFF 297

Query: 353 LWYVITSLCGDACDCPDYVVAIFFWIGYFNSTLNPLIYAYFNRDFREAFKNTLQCAFCSL 412
           LWYV TSLC D C CP+ VV + FWIGYFNSTLNP+IYAYFNRDFREAFKNTLQCAFCSL
Sbjct: 298 LWYVSTSLC-DTCPCPELVVDLVFWIGYFNSTLNPIIYAYFNRDFREAFKNTLQCAFCSL 356

Query: 413 CRREPSDLDELDIRRASLRYDDRTKSVYSDTYLKHHIDRRTSSEFGSSL 461
           CRR PSDLD LD+RR SLRYD+RT+S+YS+TYL+ HIDRR SSEFGSSL
Sbjct: 357 CRRPPSDLDALDVRRHSLRYDERTRSIYSETYLR-HIDRRRSSEFGSSL 404

Source: Schistocerca gregaria

Species: Schistocerca gregaria

Genus: Schistocerca

Family: Acrididae

Order: Orthoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383852940|ref|XP_003701983.1| PREDICTED: octopamine receptor beta-2R-like isoform 2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|380021239|ref|XP_003694478.1| PREDICTED: octopamine receptor beta-2R-like [Apis florea] Back     alignment and taxonomy information
>gi|328776788|ref|XP_396348.4| PREDICTED: octopamine receptor beta-2R isoform 5 [Apis mellifera] Back     alignment and taxonomy information
>gi|350408093|ref|XP_003488300.1| PREDICTED: octopamine receptor beta-2R-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340728118|ref|XP_003402376.1| PREDICTED: octopamine receptor beta-2R-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|322788170|gb|EFZ13952.1| hypothetical protein SINV_06087 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|242020588|ref|XP_002430734.1| class A rhodopsin-like G-protein coupled receptor GPRoar1, putative [Pediculus humanus corporis] gi|212515931|gb|EEB17996.1| class A rhodopsin-like G-protein coupled receptor GPRoar1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|328711645|ref|XP_001944827.2| PREDICTED: octopamine receptor beta-2R-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|91090654|ref|XP_974214.1| PREDICTED: similar to beta adrenergic receptor [Tribolium castaneum] gi|270014321|gb|EFA10769.1| hypothetical protein TcasGA2_TC012597 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query461
FB|FBgn0038063536 Octbeta2R "Octbeta2R" [Drosoph 0.431 0.371 0.657 4.4e-68
FB|FBgn02509101256 Octbeta3R "Octbeta3R" [Drosoph 0.195 0.071 0.788 2.6e-45
FB|FBgn0038980508 oa2 "octopamine receptor 2" [D 0.236 0.214 0.575 5.6e-40
UNIPROTKB|J9NRM2448 HTR7 "Uncharacterized protein" 0.375 0.386 0.405 2.5e-26
UNIPROTKB|F1SCX6448 HTR7 "Uncharacterized protein" 0.375 0.386 0.405 2.5e-26
UNIPROTKB|F1PTX6482 HTR7 "Uncharacterized protein" 0.375 0.358 0.405 5.7e-26
MGI|MGI:99841448 Htr7 "5-hydroxytryptamine (ser 0.373 0.383 0.394 3.2e-25
RGD|71034448 Htr7 "5-hydroxytryptamine (ser 0.373 0.383 0.394 4.3e-25
UNIPROTKB|P34969479 HTR7 "5-hydroxytryptamine rece 0.373 0.359 0.4 4.3e-25
UNIPROTKB|Q5VX04479 HTR7 "5-hydroxytryptamine rece 0.373 0.359 0.4 4.3e-25
FB|FBgn0038063 Octbeta2R "Octbeta2R" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 691 (248.3 bits), Expect = 4.4e-68, P = 4.4e-68
 Identities = 136/207 (65%), Positives = 159/207 (76%)

Query:   241 AIVSSSISFWIPCTIMVFTYLAIFKEANRQEKQLHSRHYGNQLLLGNHGRDASYSNSNGD 300
             A++SSSISFWIPCTIM+FTYLAIF+EANRQEKQL  RH GN +L+       S    +G 
Sbjct:   319 AVISSSISFWIPCTIMIFTYLAIFREANRQEKQLMMRH-GNAMLMHRPSMQPSGEALSGS 377

Query:   301 LAVGAGK-LTLEDAHHS-TPTKDRNIIKMKREHKAARTLGIIMGTFILCWLPFFLWYVIT 358
                G+ K LTL +     TPTKD+++IKMKREHKAARTLGIIMGTFILCWLPFFLWY ++
Sbjct:   378 ---GSSKTLTLHEVEQEHTPTKDKHLIKMKREHKAARTLGIIMGTFILCWLPFFLWYTLS 434

Query:   359 SLCGDACDCPDYVVAIFFWIGYFNSTLNPLIYAYFNRDFREAFKNTLQCAFCSLCRREPS 418
               C + C  PD VV+I FWIGYFNSTLNPLIYAYFNRDFREAF+NTL C FC+  +    
Sbjct:   435 MTC-EECQVPDIVVSILFWIGYFNSTLNPLIYAYFNRDFREAFRNTLLCLFCNWWKDRHL 493

Query:   419 DLDELDIRRASLRYDDRTKSVYSDTYL 445
              LD +DIRR+SLRYD R KSVYS++YL
Sbjct:   494 PLD-IDIRRSSLRYDQRAKSVYSESYL 519
GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA;ISS
GO:0008227 "G-protein coupled amine receptor activity" evidence=ISS
GO:0016021 "integral to membrane" evidence=IEA;ISS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0004989 "octopamine receptor activity" evidence=IDA
GO:0045887 "positive regulation of synaptic growth at neuromuscular junction" evidence=IMP
FB|FBgn0250910 Octbeta3R "Octbeta3R" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038980 oa2 "octopamine receptor 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|J9NRM2 HTR7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SCX6 HTR7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PTX6 HTR7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:99841 Htr7 "5-hydroxytryptamine (serotonin) receptor 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|71034 Htr7 "5-hydroxytryptamine (serotonin) receptor 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P34969 HTR7 "5-hydroxytryptamine receptor 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5VX04 HTR7 "5-hydroxytryptamine receptor 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query461
pfam00001251 pfam00001, 7tm_1, 7 transmembrane receptor (rhodop 4e-17
pfam00001251 pfam00001, 7tm_1, 7 transmembrane receptor (rhodop 2e-15
PHA03087335 PHA03087, PHA03087, G protein-coupled chemokine re 0.001
PHA03087335 PHA03087, PHA03087, G protein-coupled chemokine re 0.001
>gnl|CDD|215646 pfam00001, 7tm_1, 7 transmembrane receptor (rhodopsin family) Back     alignment and domain information 
 Score = 80.4 bits (199), Expect = 4e-17
 Identities = 31/151 (20%), Positives = 58/151 (38%), Gaps = 44/151 (29%)

Query: 241 AIVSSSISFWIPCTIMVFTYLAIFKEANRQEKQLHSRHYGNQLLLGNHGRDASYSNSNGD 300
            ++S+ + F +P  +++  Y  I +   ++ +   S+                       
Sbjct: 144 TLLSTLLGFVLPLLVILVCYTLILRTLRKRARSGASQA---------------------- 181

Query: 301 LAVGAGKLTLEDAHHSTPTKDRNIIKMKREHKAARTLGIIMGTFILCWLPFFLWYVITSL 360
                                R      +E KAA+ L +++  F+LCWLP+ +  ++ SL
Sbjct: 182 ---------------------RAKRSSSKERKAAKMLLVVVVVFVLCWLPYHIVLLLDSL 220

Query: 361 CGDACDC-PDYVVAIFFWIGYFNSTLNPLIY 390
           C  +        + I  W+ Y NS LNP+IY
Sbjct: 221 CPLSIWRLLPTALLITLWLAYVNSCLNPIIY 251

This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins. Length = 251
>gnl|CDD|215646 pfam00001, 7tm_1, 7 transmembrane receptor (rhodopsin family) Back     alignment and domain information
>gnl|CDD|222976 PHA03087, PHA03087, G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222976 PHA03087, PHA03087, G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 461
KOG4219|consensus423 99.86
PHA03234338 DNA packaging protein UL33; Provisional 99.83
PHA03235409 DNA packaging protein UL33; Provisional 99.82
KOG4220|consensus503 99.81
PHA02834323 chemokine receptor-like protein; Provisional 99.78
PHA02638417 CC chemokine receptor-like protein; Provisional 99.73
KOG4220|consensus503 99.73
PHA03087335 G protein-coupled chemokine receptor-like protein; 99.63
PHA03234338 DNA packaging protein UL33; Provisional 99.62
KOG4219|consensus423 99.59
PHA03235409 DNA packaging protein UL33; Provisional 99.54
PF00001257 7tm_1: 7 transmembrane receptor (rhodopsin family) 99.53
PHA02834323 chemokine receptor-like protein; Provisional 99.49
PHA02638417 CC chemokine receptor-like protein; Provisional 99.43
PHA03087335 G protein-coupled chemokine receptor-like protein; 99.2
PF00001257 7tm_1: 7 transmembrane receptor (rhodopsin family) 99.07
KOG2087|consensus363 98.93
PF10324318 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemorecept 98.89
PF05296303 TAS2R: Mammalian taste receptor protein (TAS2R); I 98.43
PF10324318 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemorecept 98.09
PF10320257 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemorecep 98.05
PF10323283 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemorecept 98.0
PF10321313 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemorecept 97.62
PF10323283 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemorecept 97.51
PF10320257 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemorecep 97.28
PF10327303 7TM_GPCR_Sri: Serpentine type 7TM GPCR chemorecept 97.14
PF05462303 Dicty_CAR: Slime mold cyclic AMP receptor 97.07
KOG2087|consensus363 96.93
PF10328274 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemorecept 96.39
PF10317292 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemorecept 96.26
PF05296303 TAS2R: Mammalian taste receptor protein (TAS2R); I 96.1
PF02101405 Ocular_alb: Ocular albinism type 1 protein; InterP 95.87
PF1197076 Git3_C: G protein-coupled glucose receptor regulat 95.82
PF10318302 7TM_GPCR_Srh: Serpentine type 7TM GPCR chemorecept 95.35
PF10326307 7TM_GPCR_Str: Serpentine type 7TM GPCR chemorecept 94.27
PF10321313 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemorecept 94.1
PF1197076 Git3_C: G protein-coupled glucose receptor regulat 93.75
PF03402265 V1R: Vomeronasal organ pheromone receptor family, 93.57
PF10328274 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemorecept 92.65
KOG4193|consensus610 92.42
PF03125365 Sre: C. elegans Sre G protein-coupled chemorecepto 92.29
PF05462303 Dicty_CAR: Slime mold cyclic AMP receptor 91.97
KOG4564|consensus473 91.03
PF02101405 Ocular_alb: Ocular albinism type 1 protein; InterP 90.28
PF10327303 7TM_GPCR_Sri: Serpentine type 7TM GPCR chemorecept 89.89
PF10317292 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemorecept 89.46
PF02118275 Srg: Srg family chemoreceptor; InterPro: IPR000609 85.86
PF10319310 7TM_GPCR_Srj: Serpentine type 7TM GPCR chemorecept 85.75
PF10318302 7TM_GPCR_Srh: Serpentine type 7TM GPCR chemorecept 84.31
>KOG4219|consensus Back     alignment and domain information 
Probab=99.86  E-value=3.8e-22  Score=186.14  Aligned_cols=128  Identities=20%  Similarity=0.506  Sum_probs=106.6

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcccCCcccccCCCCCCCCCCCCCCcccCCccccccccCCCC
Q psy16676        238 FGNAIVSSSISFWIPCTIMVFTYLAIFKEANRQEKQLHSRHYGNQLLLGNHGRDASYSNSNGDLAVGAGKLTLEDAHHST  317 (461)
Q Consensus       238 ~~y~i~~~~~~f~iP~iii~~~Y~~I~~~lr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  317 (461)
                      ..|..++.++.+++|++||.++|..|...+|..+....                                          
T Consensus       207 ~~y~~vl~~lqYflPliVl~~~Yt~iav~LW~~~~~gd------------------------------------------  244 (423)
T KOG4219|consen  207 QGYNYVLLFLQYFLPLIVLGLAYTVIAVTLWGRRIPGD------------------------------------------  244 (423)
T ss_pred             cceeeeehhHHHHHHHHHHHHHHHHHHHHHHhccCccc------------------------------------------
Confidence            34888899999999999999999999999998752211                                          


Q ss_pred             CcchhhHHHHHhhhhHHHHHHHHHHHHHHhchhHHHHHHHHHhhCCC--CCChhHHHHHHHHHHHHhhhhhHHHhhhcCh
Q psy16676        318 PTKDRNIIKMKREHKAARTLGIIMGTFILCWLPFFLWYVITSLCGDA--CDCPDYVVAIFFWIGYFNSTLNPLIYAYFNR  395 (461)
Q Consensus       318 ~~~~~~~~~~~~~~k~~r~l~~vv~~F~icw~P~~v~~l~~~~~~~~--~~~~~~~~~~~~~l~~~ns~iNPiiY~~~~~  395 (461)
                       +..+.....++++|++||+++||++|.+||+||+++.++....++-  ......++....||+.+|+|.||+||+++|+
T Consensus       245 -~~d~~~~~~kak~K~vkmliiVV~~FaicWlPyh~y~il~~~~~~i~~~k~i~~vyl~~~WLaMSst~yNPiIY~~lN~  323 (423)
T KOG4219|consen  245 -QQDRKHEQLKAKKKVVKMLIIVVVIFAICWLPYHIYFILNATNPEINRKKFIQQVYLAIYWLAMSSTCYNPIIYCFLNK  323 (423)
T ss_pred             -hhchhhHHHHHHHHHHHHHHHHHHHHHHhccChhHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHhhhccHhhhhhHH
Confidence             1113445678899999999999999999999999999988755321  1233677788899999999999999999999


Q ss_pred             HHHHHHHHhhhcc
Q psy16676        396 DFREAFKNTLQCA  408 (461)
Q Consensus       396 ~fR~~~~~~~~~~  408 (461)
                      +||.+|++.|+|+
T Consensus       324 Rfr~gf~~~fr~c  336 (423)
T KOG4219|consen  324 RFRGGFRRAFRWC  336 (423)
T ss_pred             HHHHHHhhhhhee
Confidence            9999999999964

>PHA03234 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PHA03235 DNA packaging protein UL33; Provisional Back     alignment and domain information
>KOG4220|consensus Back     alignment and domain information
>PHA02834 chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA02638 CC chemokine receptor-like protein; Provisional Back     alignment and domain information
>KOG4220|consensus Back     alignment and domain information
>PHA03087 G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA03234 DNA packaging protein UL33; Provisional Back     alignment and domain information
>KOG4219|consensus Back     alignment and domain information
>PHA03235 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PHA02834 chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA02638 CC chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA03087 G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information
>PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG2087|consensus Back     alignment and domain information
>PF10324 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemoreceptor Srw; InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF05296 TAS2R: Mammalian taste receptor protein (TAS2R); InterPro: IPR007960 This family consists of several forms of mammalian taste receptor proteins (TAS2Rs) Back     alignment and domain information
>PF10324 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemoreceptor Srw; InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10320 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemoreceptor Srsx; InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10323 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemoreceptor Srv; InterPro: IPR019426 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10321 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemoreceptor Srt; InterPro: IPR019425 Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type [] Back     alignment and domain information
>PF10323 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemoreceptor Srv; InterPro: IPR019426 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10320 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemoreceptor Srsx; InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10327 7TM_GPCR_Sri: Serpentine type 7TM GPCR chemoreceptor Sri; InterPro: IPR019429 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF05462 Dicty_CAR: Slime mold cyclic AMP receptor Back     alignment and domain information
>KOG2087|consensus Back     alignment and domain information
>PF10328 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemoreceptor Srx; InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10317 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemoreceptor Srd; InterPro: IPR019421 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF05296 TAS2R: Mammalian taste receptor protein (TAS2R); InterPro: IPR007960 This family consists of several forms of mammalian taste receptor proteins (TAS2Rs) Back     alignment and domain information
>PF02101 Ocular_alb: Ocular albinism type 1 protein; InterPro: IPR001414 Ocular albinism type 1 (OA1) is an X-linked disorder characterised by severe impairment of visual acuity, retinal hypopigmentation and the presence of macromelanosomes Back     alignment and domain information
>PF11970 Git3_C: G protein-coupled glucose receptor regulating Gpa2 C-term; InterPro: IPR022596 This entry contains a functionally uncharacterised region belonging to the Git3 G-protein coupled receptor Back     alignment and domain information
>PF10318 7TM_GPCR_Srh: Serpentine type 7TM GPCR chemoreceptor Srh; InterPro: IPR019422 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10326 7TM_GPCR_Str: Serpentine type 7TM GPCR chemoreceptor Str; InterPro: IPR019428 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10321 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemoreceptor Srt; InterPro: IPR019425 Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type [] Back     alignment and domain information
>PF11970 Git3_C: G protein-coupled glucose receptor regulating Gpa2 C-term; InterPro: IPR022596 This entry contains a functionally uncharacterised region belonging to the Git3 G-protein coupled receptor Back     alignment and domain information
>PF03402 V1R: Vomeronasal organ pheromone receptor family, V1R; InterPro: IPR004072 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10328 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemoreceptor Srx; InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG4193|consensus Back     alignment and domain information
>PF03125 Sre: C Back     alignment and domain information
>PF05462 Dicty_CAR: Slime mold cyclic AMP receptor Back     alignment and domain information
>KOG4564|consensus Back     alignment and domain information
>PF02101 Ocular_alb: Ocular albinism type 1 protein; InterPro: IPR001414 Ocular albinism type 1 (OA1) is an X-linked disorder characterised by severe impairment of visual acuity, retinal hypopigmentation and the presence of macromelanosomes Back     alignment and domain information
>PF10327 7TM_GPCR_Sri: Serpentine type 7TM GPCR chemoreceptor Sri; InterPro: IPR019429 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10317 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemoreceptor Srd; InterPro: IPR019421 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF02118 Srg: Srg family chemoreceptor; InterPro: IPR000609 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10319 7TM_GPCR_Srj: Serpentine type 7TM GPCR chemoreceptor Srj; InterPro: IPR019423 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10318 7TM_GPCR_Srh: Serpentine type 7TM GPCR chemoreceptor Srh; InterPro: IPR019422 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query461
2vt4_A313 Turkey Beta1 Adrenergic Receptor With Stabilising M 1e-19
2y00_B315 Turkey Beta1 Adrenergic Receptor With Stabilising M 2e-19
3sn6_R514 Crystal Structure Of The Beta2 Adrenergic Receptor- 4e-19
3kj6_A366 Crystal Structure Of A Methylated Beta2 Adrenergic 1e-18
2r4r_A365 Crystal Structure Of The Human Beta2 Adrenoceptor L 1e-18
2r4s_A342 Crystal Structure Of The Human Beta2 Adrenoceptor L 2e-18
3rze_A452 Structure Of The Human Histamine H1 Receptor In Com 3e-17
3rze_A452 Structure Of The Human Histamine H1 Receptor In Com 3e-17
4gbr_A309 N-terminal T4 Lysozyme Fusion Facilitates Crystalli 4e-16
3pbl_A481 Structure Of The Human Dopamine D3 Receptor In Comp 1e-15
3pbl_A481 Structure Of The Human Dopamine D3 Receptor In Comp 1e-15
2rh1_A500 High Resolution Crystal Structure Of Human B2-Adren 2e-13
2rh1_A500 High Resolution Crystal Structure Of Human B2-Adren 2e-13
3p0g_A501 Structure Of A Nanobody-Stabilized Active State Of 2e-13
3p0g_A501 Structure Of A Nanobody-Stabilized Active State Of 2e-13
3d4s_A490 Cholesterol Bound Form Of Human Beta2 Adrenergic Re 3e-13
3d4s_A490 Cholesterol Bound Form Of Human Beta2 Adrenergic Re 3e-13
3pds_A458 Irreversible Agonist-Beta2 Adrenoceptor Complex Len 3e-13
3pds_A458 Irreversible Agonist-Beta2 Adrenoceptor Complex Len 3e-13
2ydo_A325 Thermostabilised Human A2a Receptor With Adenosine 4e-12
3vg9_A326 Crystal Structure Of Human Adenosine A2a Receptor W 4e-12
3pwh_A329 Thermostabilised Adenosine A2a Receptor Length = 32 2e-11
3eml_A488 The 2.6 A Crystal Structure Of A Human A2a Adenosin 5e-11
3eml_A488 The 2.6 A Crystal Structure Of A Human A2a Adenosin 5e-11
4eiy_A447 Crystal Structure Of The Chimeric Protein Of A2aar- 6e-11
4eiy_A447 Crystal Structure Of The Chimeric Protein Of A2aar- 6e-11
4daj_A479 Structure Of The M3 Muscarinic Acetylcholine Recept 2e-10
4daj_A479 Structure Of The M3 Muscarinic Acetylcholine Recept 2e-10
3uon_A467 Structure Of The Human M2 Muscarinic Acetylcholine 1e-09
3uon_A467 Structure Of The Human M2 Muscarinic Acetylcholine 1e-09
2lnl_A296 Structure Of Human Cxcr1 In Phospholipid Bilayers L 3e-05
2lnl_A296 Structure Of Human Cxcr1 In Phospholipid Bilayers L 3e-05
3v2w_A520 Crystal Structure Of A Lipid G Protein-Coupled Rece 2e-04
3v2w_A520 Crystal Structure Of A Lipid G Protein-Coupled Rece 2e-04
3oe6_A508 Crystal Structure Of The Cxcr4 Chemokine Receptor I 5e-04
3oe6_A508 Crystal Structure Of The Cxcr4 Chemokine Receptor I 5e-04
3odu_A502 The 2.5 A Structure Of The Cxcr4 Chemokine Receptor 6e-04
3odu_A502 The 2.5 A Structure Of The Cxcr4 Chemokine Receptor 6e-04
>pdb|2VT4|A Chain A, Turkey Beta1 Adrenergic Receptor With Stabilising Mutations And Bound Cyanopindolol Length = 313 Back     alignment and structure 
Iteration: 1

 Score = 94.4 bits (233), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 78/165 (47%), Gaps = 45/165 (27%)
Query: 241 AIVSSSISFWIPCTIMVFTYLAIFKEANRQEKQLHSRHYGNQLLLGNHGRDASYSNSNGD 300
           AI SS ISF+IP  IM+F  L +++EA  Q +++                          
Sbjct: 178 AIASSIISFYIPLLIMIFVALRVYREAKEQIRKIDR------------------------ 213
Query: 301 LAVGAGKLTLEDAHHSTPTKDRNIIKMKREHKAARTLGIIMGTFILCWLPFFLWYVITSL 360
                                R  + + REHKA +TLGIIMG F LCWLPFFL  ++   
Sbjct: 214 ------------------ASKRKRVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVF 255
Query: 361 CGDACDCPDYVVAIFFWIGYFNSTLNPLIYAYFNRDFREAFKNTL 405
             D    PD++   F W+GY NS +NP+IY   + DFR+AFK  L
Sbjct: 256 NRDL--VPDWLFVAFNWLGYANSAMNPIIYCR-SPDFRKAFKRLL 297
>pdb|2Y00|B Chain B, Turkey Beta1 Adrenergic Receptor With Stabilising Mutations And Bound Partial Agonist Dobutamine (Crystal Dob92) Length = 315 Back     alignment and structure
>pdb|3SN6|R Chain R, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 514 Back     alignment and structure
>pdb|3KJ6|A Chain A, Crystal Structure Of A Methylated Beta2 Adrenergic Receptor- Fab Complex Length = 366 Back     alignment and structure
>pdb|2R4R|A Chain A, Crystal Structure Of The Human Beta2 Adrenoceptor Length = 365 Back     alignment and structure
>pdb|2R4S|A Chain A, Crystal Structure Of The Human Beta2 Adrenoceptor Length = 342 Back     alignment and structure
>pdb|3RZE|A Chain A, Structure Of The Human Histamine H1 Receptor In Complex With Doxepin Length = 452 Back     alignment and structure
>pdb|3RZE|A Chain A, Structure Of The Human Histamine H1 Receptor In Complex With Doxepin Length = 452 Back     alignment and structure
>pdb|4GBR|A Chain A, N-terminal T4 Lysozyme Fusion Facilitates Crystallization Of A G Protein Coupled Receptor Length = 309 Back     alignment and structure
>pdb|3PBL|A Chain A, Structure Of The Human Dopamine D3 Receptor In Complex With Eticlopride Length = 481 Back     alignment and structure
>pdb|3PBL|A Chain A, Structure Of The Human Dopamine D3 Receptor In Complex With Eticlopride Length = 481 Back     alignment and structure
>pdb|2RH1|A Chain A, High Resolution Crystal Structure Of Human B2-Adrenergic G Protein- Coupled Receptor Length = 500 Back     alignment and structure
>pdb|2RH1|A Chain A, High Resolution Crystal Structure Of Human B2-Adrenergic G Protein- Coupled Receptor Length = 500 Back     alignment and structure
>pdb|3P0G|A Chain A, Structure Of A Nanobody-Stabilized Active State Of The Beta2 Adrenoceptor Length = 501 Back     alignment and structure
>pdb|3P0G|A Chain A, Structure Of A Nanobody-Stabilized Active State Of The Beta2 Adrenoceptor Length = 501 Back     alignment and structure
>pdb|3D4S|A Chain A, Cholesterol Bound Form Of Human Beta2 Adrenergic Receptor. Length = 490 Back     alignment and structure
>pdb|3D4S|A Chain A, Cholesterol Bound Form Of Human Beta2 Adrenergic Receptor. Length = 490 Back     alignment and structure
>pdb|3PDS|A Chain A, Irreversible Agonist-Beta2 Adrenoceptor Complex Length = 458 Back     alignment and structure
>pdb|3PDS|A Chain A, Irreversible Agonist-Beta2 Adrenoceptor Complex Length = 458 Back     alignment and structure
>pdb|2YDO|A Chain A, Thermostabilised Human A2a Receptor With Adenosine Bound Length = 325 Back     alignment and structure
>pdb|3VG9|A Chain A, Crystal Structure Of Human Adenosine A2a Receptor With An Allosteric Inverse-Agonist Antibody At 2.7 A Resolution Length = 326 Back     alignment and structure
>pdb|3PWH|A Chain A, Thermostabilised Adenosine A2a Receptor Length = 329 Back     alignment and structure
>pdb|3EML|A Chain A, The 2.6 A Crystal Structure Of A Human A2a Adenosine Receptor Bound To Zm241385. Length = 488 Back     alignment and structure
>pdb|3EML|A Chain A, The 2.6 A Crystal Structure Of A Human A2a Adenosine Receptor Bound To Zm241385. Length = 488 Back     alignment and structure
>pdb|4EIY|A Chain A, Crystal Structure Of The Chimeric Protein Of A2aar-Bril In Complex With Zm241385 At 1.8a Resolution Length = 447 Back     alignment and structure
>pdb|4EIY|A Chain A, Crystal Structure Of The Chimeric Protein Of A2aar-Bril In Complex With Zm241385 At 1.8a Resolution Length = 447 Back     alignment and structure
>pdb|4DAJ|A Chain A, Structure Of The M3 Muscarinic Acetylcholine Receptor Length = 479 Back     alignment and structure
>pdb|4DAJ|A Chain A, Structure Of The M3 Muscarinic Acetylcholine Receptor Length = 479 Back     alignment and structure
>pdb|3UON|A Chain A, Structure Of The Human M2 Muscarinic Acetylcholine Receptor Bound To An Antagonist Length = 467 Back     alignment and structure
>pdb|3UON|A Chain A, Structure Of The Human M2 Muscarinic Acetylcholine Receptor Bound To An Antagonist Length = 467 Back     alignment and structure
>pdb|2LNL|A Chain A, Structure Of Human Cxcr1 In Phospholipid Bilayers Length = 296 Back     alignment and structure
>pdb|2LNL|A Chain A, Structure Of Human Cxcr1 In Phospholipid Bilayers Length = 296 Back     alignment and structure
>pdb|3V2W|A Chain A, Crystal Structure Of A Lipid G Protein-Coupled Receptor At 3.35a Length = 520 Back     alignment and structure
>pdb|3V2W|A Chain A, Crystal Structure Of A Lipid G Protein-Coupled Receptor At 3.35a Length = 520 Back     alignment and structure
>pdb|3OE6|A Chain A, Crystal Structure Of The Cxcr4 Chemokine Receptor In Complex With A Small Molecule Antagonist It1t In I222 Spacegroup Length = 508 Back     alignment and structure
>pdb|3OE6|A Chain A, Crystal Structure Of The Cxcr4 Chemokine Receptor In Complex With A Small Molecule Antagonist It1t In I222 Spacegroup Length = 508 Back     alignment and structure
>pdb|3ODU|A Chain A, The 2.5 A Structure Of The Cxcr4 Chemokine Receptor In Complex With Small Molecule Antagonist It1t Length = 502 Back     alignment and structure
>pdb|3ODU|A Chain A, The 2.5 A Structure Of The Cxcr4 Chemokine Receptor In Complex With Small Molecule Antagonist It1t Length = 502 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query461
3sn6_R514 Lysozyme, beta-2 adrenergic receptor; seven transm 4e-48
3sn6_R514 Lysozyme, beta-2 adrenergic receptor; seven transm 3e-34
4amj_A315 Beta-1 adrenergic receptor; membrane protein, 7TMR 5e-42
4amj_A315 Beta-1 adrenergic receptor; membrane protein, 7TMR 3e-32
4eiy_A447 Adenosine receptor A2A/soluble cytochrome B562 CH; 1e-40
4eiy_A447 Adenosine receptor A2A/soluble cytochrome B562 CH; 1e-36
3eml_A488 Human adenosine A2A receptor/T4 lysozyme chimera; 2e-36
3eml_A488 Human adenosine A2A receptor/T4 lysozyme chimera; 2e-36
3eml_A488 Human adenosine A2A receptor/T4 lysozyme chimera; 7e-08
3v2y_A520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 2e-35
3v2y_A520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 2e-32
3pbl_A481 D(3) dopamine receptor, lysozyme chimera; structur 1e-33
3pbl_A481 D(3) dopamine receptor, lysozyme chimera; structur 1e-33
3pbl_A481 D(3) dopamine receptor, lysozyme chimera; structur 4e-08
3uon_A467 Human M2 muscarinic acetylcholine, receptor T4 LY 4e-33
3uon_A467 Human M2 muscarinic acetylcholine, receptor T4 LY 1e-32
2rh1_A500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 2e-32
2rh1_A500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 2e-32
2rh1_A500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 5e-09
3rze_A452 Histamine H1 receptor, lysozyme chimera; structura 4e-32
3rze_A452 Histamine H1 receptor, lysozyme chimera; structura 1e-31
2ks9_A364 Substance-P receptor; water, autodock, NK1, neurop 3e-19
2ks9_A364 Substance-P receptor; water, autodock, NK1, neurop 3e-19
4ea3_A434 Fusion protein of nociceptin receptor and cytochr; 9e-17
4ea3_A434 Fusion protein of nociceptin receptor and cytochr; 9e-17
4dkl_A464 MU-type opioid receptor, lysozyme chimera; G-prote 1e-16
4dkl_A464 MU-type opioid receptor, lysozyme chimera; G-prote 2e-16
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 2e-15
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 6e-13
1u19_A349 Rhodopsin; G protein-coupled receptor, membrane pr 2e-13
1u19_A349 Rhodopsin; G protein-coupled receptor, membrane pr 5e-13
3odu_A502 C-X-C chemokine receptor type 4, lysozyme chimera; 1e-11
3odu_A502 C-X-C chemokine receptor type 4, lysozyme chimera; 1e-11
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A Length = 514 Back     alignment and structure
 Score =  171 bits (435), Expect = 4e-48
 Identities = 58/178 (32%), Positives = 79/178 (44%), Gaps = 24/178 (13%)

Query: 241 AIVSSSISFWIPCTIMVFTYLAIFKEANRQEKQLHSRHYGNQLLLGNHGRDASYSNSNGD 300
           AI SS +SF++P  IMVF Y  +F+EA RQ +++        +   +             
Sbjct: 349 AIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRFHVQNLSQVEQD-------- 400

Query: 301 LAVGAGKLTLEDAHHSTPTKDRNIIKMKREHKAARTLGIIMGTFILCWLPFFLWYVITSL 360
                          +     R+     +EHKA +TLGIIMGTF LCWLPFF+  ++  +
Sbjct: 401 -------------GRTGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVI 447

Query: 361 CGDACDCPDYVVAIFFWIGYFNSTLNPLIYAYFNRDFREAFKNTLQCAFCSLCRREPS 418
                     V  +  WIGY NS  NPLIY   + DFR AF+  L     SL      
Sbjct: 448 QD--NLIRKEVYILLNWIGYVNSGFNPLIYC-RSPDFRIAFQELLCLRRSSLKAYGNG 502
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A Length = 514 Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Length = 315 Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Length = 315 Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Length = 447 Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Length = 447 Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Length = 488 Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Length = 488 Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Length = 488 Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Length = 520 Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Length = 520 Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, protein structure initiative, AC technologies center for gene to 3D structure; HET: ETQ MAL; 2.89A {Homo sapiens} Length = 481 Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, protein structure initiative, AC technologies center for gene to 3D structure; HET: ETQ MAL; 2.89A {Homo sapiens} Length = 481 Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, protein structure initiative, AC technologies center for gene to 3D structure; HET: ETQ MAL; 2.89A {Homo sapiens} Length = 481 Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Length = 467 Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Length = 467 Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Length = 500 Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Length = 500 Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Length = 500 Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Length = 452 Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Length = 452 Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Length = 364 Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Length = 364 Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Length = 464 Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Length = 464 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Length = 349 Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Length = 349 Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Length = 502 Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Length = 502 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query461
4grv_A510 Neurotensin receptor type 1, lysozyme chimera; G-p 99.91
2rh1_A500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 99.86
3eml_A488 Human adenosine A2A receptor/T4 lysozyme chimera; 99.84
3vw7_A484 Proteinase-activated receptor 1, lysozyme; high re 99.83
4eiy_A447 Adenosine receptor A2A/soluble cytochrome B562 CH; 99.83
3rze_A452 Histamine H1 receptor, lysozyme chimera; structura 99.82
3v2y_A520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 99.81
2ks9_A364 Substance-P receptor; water, autodock, NK1, neurop 99.81
3uon_A467 Human M2 muscarinic acetylcholine, receptor T4 LY 99.81
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 99.8
4grv_A510 Neurotensin receptor type 1, lysozyme chimera; G-p 99.79
4amj_A315 Beta-1 adrenergic receptor; membrane protein, 7TMR 99.79
3sn6_R514 Lysozyme, beta-2 adrenergic receptor; seven transm 99.79
3odu_A502 C-X-C chemokine receptor type 4, lysozyme chimera; 99.78
3pbl_A481 D(3) dopamine receptor, lysozyme chimera; structur 99.78
2lnl_A296 C-X-C chemokine receptor type 1; G protein coupled 99.78
4dkl_A464 MU-type opioid receptor, lysozyme chimera; G-prote 99.78
1u19_A349 Rhodopsin; G protein-coupled receptor, membrane pr 99.77
4ea3_A434 Fusion protein of nociceptin receptor and cytochr; 99.74
4eiy_A447 Adenosine receptor A2A/soluble cytochrome B562 CH; 99.68
3eml_A488 Human adenosine A2A receptor/T4 lysozyme chimera; 99.68
3vw7_A484 Proteinase-activated receptor 1, lysozyme; high re 99.66
2rh1_A500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 99.65
3v2y_A520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 99.62
3uon_A467 Human M2 muscarinic acetylcholine, receptor T4 LY 99.61
3rze_A452 Histamine H1 receptor, lysozyme chimera; structura 99.61
3odu_A502 C-X-C chemokine receptor type 4, lysozyme chimera; 99.59
4amj_A315 Beta-1 adrenergic receptor; membrane protein, 7TMR 99.58
3pbl_A481 D(3) dopamine receptor, lysozyme chimera; structur 99.57
4dkl_A464 MU-type opioid receptor, lysozyme chimera; G-prote 99.55
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 99.55
3sn6_R514 Lysozyme, beta-2 adrenergic receptor; seven transm 99.55
2ks9_A364 Substance-P receptor; water, autodock, NK1, neurop 99.53
1u19_A349 Rhodopsin; G protein-coupled receptor, membrane pr 99.51
2lnl_A296 C-X-C chemokine receptor type 1; G protein coupled 99.46
4ea3_A434 Fusion protein of nociceptin receptor and cytochr; 99.41
2koe_A40 Human cannabinoid receptor 1 - helix 7/8 peptide; 98.91
2koe_A40 Human cannabinoid receptor 1 - helix 7/8 peptide; 98.74
2ki9_A33 Cannabinoid receptor 2; GPCR, G-protein coupled re 98.46
2ki9_A33 Cannabinoid receptor 2; GPCR, G-protein coupled re 98.24
>4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} Back     alignment and structure
Probab=99.91  E-value=6.2e-25  Score=224.99  Aligned_cols=82  Identities=22%  Similarity=0.515  Sum_probs=63.8

Q ss_pred             HHhhhhHHHHHHHHHHHHHHhchhHHHHHHHHHhhCCCCCCh------hHHHHHHHHHHHHhhhhhHHHhhhcChHHHHH
Q psy16676        327 MKREHKAARTLGIIMGTFILCWLPFFLWYVITSLCGDACDCP------DYVVAIFFWIGYFNSTLNPLIYAYFNRDFREA  400 (461)
Q Consensus       327 ~~~~~k~~r~l~~vv~~F~icw~P~~v~~l~~~~~~~~~~~~------~~~~~~~~~l~~~ns~iNPiiY~~~~~~fR~~  400 (461)
                      .++++|++||+++|+++|++||+||+++.++..+.+......      .+++.++.||+|+|||+|||||+++|++||++
T Consensus       401 ~~~erk~~k~L~iVv~~F~iCWlPf~i~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~L~Y~NS~iNPiIY~~~n~~FR~a  480 (510)
T 4grv_A          401 VQALRHGVLVARAVVIAFVVCWLPYHVRRLMFCYISDEQWTTFLFDFYHYFYMLTNALAYASSAINPILYNLVSANFRQV  480 (510)
T ss_dssp             TTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTTCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCCCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCcccCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHH
Confidence            356789999999999999999999999999988875433222      34567788999999999999999999999999


Q ss_pred             HHHhhhcc
Q psy16676        401 FKNTLQCA  408 (461)
Q Consensus       401 ~~~~~~~~  408 (461)
                      |+++|+|+
T Consensus       481 Fk~iL~C~  488 (510)
T 4grv_A          481 FLSTLACL  488 (510)
T ss_dssp             --------
T ss_pred             HHHHHhhc
Confidence            99999875
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Back     alignment and structure
>3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Back     alignment and structure
>4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} Back     alignment and structure
>2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Back     alignment and structure
>3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Back     alignment and structure
>2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} Back     alignment and structure
>2koe_A Human cannabinoid receptor 1 - helix 7/8 peptide; GPCR, HCB1, membrane protein, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2koe_A Human cannabinoid receptor 1 - helix 7/8 peptide; GPCR, HCB1, membrane protein, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2ki9_A Cannabinoid receptor 2; GPCR, G-protein coupled receptor, membrane protein; NMR {Synthetic} Back     alignment and structure
>2ki9_A Cannabinoid receptor 2; GPCR, G-protein coupled receptor, membrane protein; NMR {Synthetic} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 461
d1u19a_348 f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 1e-18
d1u19a_348 f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 1e-18
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Length = 348 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 84.6 bits (208), Expect = 1e-18
 Identities = 24/92 (26%), Positives = 37/92 (40%), Gaps = 1/92 (1%)

Query: 108 MKREHKAARTLGIIMGTFILCWLPFFLWYVITSLCGDACDCPDYVVAIFFWIGYFNSTLN 167
            K E +  R + I++  F++CWLP+              D     + I  +    ++  N
Sbjct: 244 QKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTH-QGSDFGPIFMTIPAFFAKTSAVYN 302

Query: 168 PLIYAYFNRDFREAFKNTLQCAFCSLCRREPS 199
           P+IY   N+ FR     TL C    L   E S
Sbjct: 303 PVIYIMMNKQFRNCMVTTLCCGKNPLGDDEAS 334
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Length = 348 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query461
d1u19a_348 Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} 99.77
d1u19a_348 Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} 99.44
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.77  E-value=1.4e-18  Score=166.11  Aligned_cols=129  Identities=22%  Similarity=0.387  Sum_probs=103.6

Q ss_pred             ccccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcccCCcccccCCCCCCCCCCCCCCcccCCccccccc
Q psy16676        233 RTSSEFGNAIVSSSISFWIPCTIMVFTYLAIFKEANRQEKQLHSRHYGNQLLLGNHGRDASYSNSNGDLAVGAGKLTLED  312 (461)
Q Consensus       233 ~~~~~~~y~i~~~~~~f~iP~iii~~~Y~~I~~~lr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  312 (461)
                      .......|.++..++.+++|+++++++|.+|.+.+|++.+.                                       
T Consensus       196 ~~~~~~~~~~~~~~~~~~ip~~i~~~~y~~i~~~~~~~~~~---------------------------------------  236 (348)
T d1u19a_         196 EETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQ---------------------------------------  236 (348)
T ss_dssp             GGGTHHHHHHHHHHHTTHHHHHHHHHHHTTTTTSSCSCCCS---------------------------------------
T ss_pred             ccccchhhHHHHHHHHHHHHHHHHHHHHHHHHhhhcccccc---------------------------------------
Confidence            34556678888889999999999999999998877653211                                       


Q ss_pred             cCCCCCcchhhHHHHHhhhhHHHHHHHHHHHHHHhchhHHHHHHHHHhhCCCCCChhHHHHHHHHHHHHhhhhhHHHhhh
Q psy16676        313 AHHSTPTKDRNIIKMKREHKAARTLGIIMGTFILCWLPFFLWYVITSLCGDACDCPDYVVAIFFWIGYFNSTLNPLIYAY  392 (461)
Q Consensus       313 ~~~~~~~~~~~~~~~~~~~k~~r~l~~vv~~F~icw~P~~v~~l~~~~~~~~~~~~~~~~~~~~~l~~~ns~iNPiiY~~  392 (461)
                             .+......++++|++|++++++++|++||+||.++.++..... ..........+..+++++||++||+||++
T Consensus       237 -------~~~~~~~~~~~~~~~~~~~~i~~~f~~~~~P~~i~~~~~~~~~-~~~~~~~~~~~~~~l~~~ns~iNPiIY~~  308 (348)
T d1u19a_         237 -------QQESATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQ-GSDFGPIFMTIPAFFAKTSAVYNPVIYIM  308 (348)
T ss_dssp             -------SCSSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTT-TSCCCHHHHHHHHHHGGGGGTHHHHHHHH
T ss_pred             -------cchhhhhHHHHhhHhheEEEeehHHHHHhhHHHhhhheeeccC-CccccHHHHHHHHHHHHHHHHHHHHHHHh
Confidence                   0111234467889999999999999999999999988776653 33345667778889999999999999999


Q ss_pred             cChHHHHHHHHhhhcc
Q psy16676        393 FNRDFREAFKNTLQCA  408 (461)
Q Consensus       393 ~~~~fR~~~~~~~~~~  408 (461)
                      ++++||++++++++|+
T Consensus       309 ~~~~fR~~~~~~l~c~  324 (348)
T d1u19a_         309 MNKQFRNCMVTTLCCG  324 (348)
T ss_dssp             TCHHHHHHHHHHHTSS
T ss_pred             cCHHHHHHHHHHhCCC
Confidence            9999999999999754
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure