Psyllid ID: psy16764

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110---
MFQTELTMLRIVTEENSNLEIRNAYTSRRGSRVRFKTGSKFTAAIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFFRNIIGHNTTIKKTIWHMYKNAG
cHHHHHccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHccccccHHHHHHHHHHccc
ccccHHHHHHHEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccc
MFQTELTMLRIVTEENSNLEIRNAytsrrgsrvrfktgskfTAAIQGHTQIFLNKYihtvypsqptrfckiqlilprlksipslvlEELFFrniighntTIKKTIWHMYKNAG
mfqteltmlrivteensnleirnaytsrrgsrvrfKTGSKFTAAIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFFrniighnttiKKTIWHMYKNAG
MFQTELTMLRIVTEENSNLEIRNAYTSRRGSRVRFKTGSKFTAAIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFFRNIIGHNTTIKKTIWHMYKNAG
********LRIV********IRNAYT****SRVRFKTGSKFTAAIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFFRNIIGHNTTIKKTIWHMY****
MFQTELTMLRIVTEENSNLEIRNAYTSRRGSRV**KTGSKFTAAIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFFRNIIGHNTTIKKTIWHMYKN**
MFQTELTMLRIVTEENSNLEIRNAYTSRRGSRVRFKTGSKFTAAIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFFRNIIGHNTTIKKTIWHMYKNAG
*FQTELTMLRIVTEENSNLEIRNAY*********FKTGSKFTAAIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFFRNIIGHNTTIKKTIWHMYKNA*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFQTELTMLRIVTEENSNLEIRNAYTSRRGSRVRFKTGSKFTAAIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFFRNIIGHNTTIKKTIWHMYKNAG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query113 2.2.26 [Sep-21-2011]
Q91379385 Nuclear receptor subfamil yes N/A 0.778 0.228 0.426 9e-12
Q9Y466385 Nuclear receptor subfamil yes N/A 0.778 0.228 0.426 1e-11
Q64104385 Nuclear receptor subfamil yes N/A 0.778 0.228 0.426 1e-11
P70052386 Nuclear receptor subfamil N/A N/A 0.902 0.264 0.357 4e-11
Q9YGL3396 Nuclear receptor subfamil N/A N/A 0.610 0.174 0.471 5e-10
Q90733410 COUP transcription factor no N/A 0.566 0.156 0.415 6e-08
P16375543 Steroid receptor seven-up yes N/A 0.566 0.117 0.430 6e-08
Q9TTR7414 COUP transcription factor no N/A 0.566 0.154 0.415 8e-08
O09018414 COUP transcription factor no N/A 0.566 0.154 0.415 8e-08
P43135414 COUP transcription factor no N/A 0.566 0.154 0.415 9e-08
>sp|Q91379|NR2E1_CHICK Nuclear receptor subfamily 2 group E member 1 OS=Gallus gallus GN=NR2E1 PE=2 SV=1 Back     alignment and function desciption
 Score = 68.9 bits (167), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 38/89 (42%), Positives = 54/89 (60%), Gaps = 1/89 (1%)

Query: 24  AYTSRRGSRVRFKTGSKFTAAIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPS 83
           A  +  GS +R    +   AA+Q   Q+ LN YIHT YP+QP RF K+ L+LP L+SI  
Sbjct: 296 AVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISP 355

Query: 84  LVLEELFFRNIIGHNTTIKKTIWHMYKNA 112
             +EE+FF+  IG N  I + +  MYK++
Sbjct: 356 STIEEVFFKKTIG-NVPITRLLSDMYKSS 383
Orphan receptor that binds DNA as a monomer to hormone response elements (HRE) containing an extended core motif half-site sequence 5'-AAGGTCA-3' in which the 5' flanking nucleotides participate in determining receptor specificity. May be required to pattern anterior brain differentiation (By similarity). Involved in the regulation of retinal development.
Gallus gallus (taxid: 9031)
>sp|Q9Y466|NR2E1_HUMAN Nuclear receptor subfamily 2 group E member 1 OS=Homo sapiens GN=NR2E1 PE=2 SV=1 Back     alignment and function description
>sp|Q64104|NR2E1_MOUSE Nuclear receptor subfamily 2 group E member 1 OS=Mus musculus GN=Nr2e1 PE=1 SV=1 Back     alignment and function description
>sp|P70052|NR2E1_XENLA Nuclear receptor subfamily 2 group E member 1 OS=Xenopus laevis GN=nr2e1 PE=2 SV=1 Back     alignment and function description
>sp|Q9YGL3|NR2E1_ORYLA Nuclear receptor subfamily 2 group E member 1 OS=Oryzias latipes GN=nr2e1 PE=2 SV=1 Back     alignment and function description
>sp|Q90733|COT2_CHICK COUP transcription factor 2 OS=Gallus gallus GN=NR2F2 PE=2 SV=1 Back     alignment and function description
>sp|P16375|7UP1_DROME Steroid receptor seven-up, isoforms B/C OS=Drosophila melanogaster GN=svp PE=2 SV=1 Back     alignment and function description
>sp|Q9TTR7|COT2_BOVIN COUP transcription factor 2 OS=Bos taurus GN=NR2F2 PE=2 SV=1 Back     alignment and function description
>sp|O09018|COT2_RAT COUP transcription factor 2 OS=Rattus norvegicus GN=Nr2f2 PE=1 SV=1 Back     alignment and function description
>sp|P43135|COT2_MOUSE COUP transcription factor 2 OS=Mus musculus GN=Nr2f2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query113
47077588 422 unnamed protein product [Homo sapiens] g 0.778 0.208 0.426 3e-10
259013325 361 tailless [Saccoglossus kowalevskii] gi|3 0.592 0.185 0.5 3e-10
354469258 518 PREDICTED: nuclear receptor subfamily 2 0.778 0.169 0.426 3e-10
449273615 376 Nuclear receptor subfamily 2 group E mem 0.778 0.234 0.426 3e-10
74187239173 unnamed protein product [Mus musculus] 0.787 0.514 0.422 3e-10
291232333 308 PREDICTED: tailless-like [Saccoglossus k 0.592 0.217 0.5 4e-10
242013777 403 Orphan nuclear receptor NR2E1, putative 0.592 0.166 0.529 4e-10
449497928 532 PREDICTED: nuclear receptor subfamily 2 0.778 0.165 0.426 4e-10
45384018 385 nuclear receptor subfamily 2 group E mem 0.778 0.228 0.426 4e-10
300676833 385 nuclear receptor subfamily 2, group E, m 0.778 0.228 0.426 4e-10
>gi|47077588|dbj|BAD18677.1| unnamed protein product [Homo sapiens] gi|119568771|gb|EAW48386.1| nuclear receptor subfamily 2, group E, member 1, isoform CRA_b [Homo sapiens] Back     alignment and taxonomy information
 Score = 69.3 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 38/89 (42%), Positives = 54/89 (60%), Gaps = 1/89 (1%)

Query: 24  AYTSRRGSRVRFKTGSKFTAAIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPS 83
           A  +  GS +R    +   AA+Q   Q+ LN YIHT YP+QP RF K+ L+LP L+SI  
Sbjct: 333 AVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISP 392

Query: 84  LVLEELFFRNIIGHNTTIKKTIWHMYKNA 112
             +EE+FF+  IG N  I + +  MYK++
Sbjct: 393 STIEEVFFKKTIG-NVPITRLLSDMYKSS 420

Source: Homo sapiens

Species: Homo sapiens

Genus: Homo

Family: Hominidae

Order: Primates

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota
>gi|259013325|ref|NP_001158362.1| tailless [Saccoglossus kowalevskii] gi|32307797|gb|AAP79295.1| tailless [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|354469258|ref|XP_003497047.1| PREDICTED: nuclear receptor subfamily 2 group E member 1-like [Cricetulus griseus] Back     alignment and taxonomy information
>gi|449273615|gb|EMC83088.1| Nuclear receptor subfamily 2 group E member 1, partial [Columba livia] Back     alignment and taxonomy information
>gi|74187239|dbj|BAE22615.1| unnamed protein product [Mus musculus] Back     alignment and taxonomy information
>gi|291232333|ref|XP_002736112.1| PREDICTED: tailless-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|242013777|ref|XP_002427577.1| Orphan nuclear receptor NR2E1, putative [Pediculus humanus corporis] gi|212511992|gb|EEB14839.1| Orphan nuclear receptor NR2E1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|449497928|ref|XP_002192943.2| PREDICTED: nuclear receptor subfamily 2 group E member 1 [Taeniopygia guttata] Back     alignment and taxonomy information
>gi|45384018|ref|NP_990501.1| nuclear receptor subfamily 2 group E member 1 [Gallus gallus] gi|6094488|sp|Q91379.1|NR2E1_CHICK RecName: Full=Nuclear receptor subfamily 2 group E member 1; AltName: Full=Nuclear receptor TLX; AltName: Full=Protein tailless homolog; Short=Tll gi|619338|gb|AAB31467.1| nuclear receptor TLX [Gallus gallus] gi|745066|prf||2015392A nuclear receptor Tlx Back     alignment and taxonomy information
>gi|300676833|gb|ADK26709.1| nuclear receptor subfamily 2, group E, member 1 [Zonotrichia albicollis] gi|300676928|gb|ADK26800.1| nuclear receptor subfamily 2, group E, member 1 [Zonotrichia albicollis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query113
UNIPROTKB|F1NNE1175 F1NNE1 "Uncharacterized protei 0.778 0.502 0.426 1.3e-13
UNIPROTKB|F1NTE7269 F1NTE7 "Uncharacterized protei 0.778 0.327 0.426 1.3e-13
UNIPROTKB|Q91379385 NR2E1 "Nuclear receptor subfam 0.778 0.228 0.426 5.6e-13
UNIPROTKB|F1MN68385 NR2E1 "Uncharacterized protein 0.778 0.228 0.426 5.6e-13
UNIPROTKB|F1PD89385 NR2E1 "Uncharacterized protein 0.778 0.228 0.426 5.6e-13
UNIPROTKB|Q9Y466385 NR2E1 "Nuclear receptor subfam 0.778 0.228 0.426 5.6e-13
UNIPROTKB|I3LU21385 NR2E1 "Uncharacterized protein 0.778 0.228 0.426 5.6e-13
MGI|MGI:1100526385 Nr2e1 "nuclear receptor subfam 0.778 0.228 0.426 5.6e-13
ZFIN|ZDB-GENE-040801-127396 nr2e1 "nuclear receptor subfam 0.769 0.219 0.433 6e-13
UNIPROTKB|F1RT26421 NR2E1 "Uncharacterized protein 0.778 0.209 0.426 7e-13
UNIPROTKB|F1NNE1 F1NNE1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 177 (67.4 bits), Expect = 1.3e-13, P = 1.3e-13
 Identities = 38/89 (42%), Positives = 54/89 (60%)

Query:    24 AYTSRRGSRVRFKTGSKFTAAIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPS 83
             A  +  GS +R    +   AA+Q   Q+ LN YIHT YP+QP RF K+ L+LP L+SI  
Sbjct:    86 AVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISP 145

Query:    84 LVLEELFFRNIIGHNTTIKKTIWHMYKNA 112
               +EE+FF+  IG N  I + +  MYK++
Sbjct:   146 STIEEVFFKKTIG-NVPITRLLSDMYKSS 173
GO:0003677 "DNA binding" evidence=IEA
GO:0003707 "steroid hormone receptor activity" evidence=IEA
GO:0004879 "ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
UNIPROTKB|F1NTE7 F1NTE7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q91379 NR2E1 "Nuclear receptor subfamily 2 group E member 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MN68 NR2E1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PD89 NR2E1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y466 NR2E1 "Nuclear receptor subfamily 2 group E member 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LU21 NR2E1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1100526 Nr2e1 "nuclear receptor subfamily 2, group E, member 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-127 nr2e1 "nuclear receptor subfamily 2, group E, member 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RT26 NR2E1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query113
cd06950206 cd06950, NR_LBD_Tlx_PNR_like, The ligand binding d 5e-16
cd06948236 cd06948, NR_LBD_COUP-TF, Ligand binding domain of 3e-11
cd06951222 cd06951, NR_LBD_Dax1_like, The ligand binding doma 6e-10
cd07349222 cd07349, NR_LBD_SHP, The ligand binding domain of 2e-07
cd06952222 cd06952, NR_LBD_TR2_like, The ligand binding domai 2e-06
cd07350232 cd07350, NR_LBD_Dax1, The ligand binding domain of 5e-06
cd06943207 cd06943, NR_LBD_RXR_like, The ligand binding domai 2e-05
cd06931222 cd06931, NR_LBD_HNF4_like, The ligand binding doma 7e-05
cd06930165 cd06930, NR_LBD_F2, Ligand-binding domain of nucle 1e-04
>gnl|CDD|132748 cd06950, NR_LBD_Tlx_PNR_like, The ligand binding domain of Tailless-like proteins, orphan nuclear receptors Back     alignment and domain information 
 Score = 69.6 bits (171), Expect = 5e-16
 Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 6/70 (8%)

Query: 33  VRFKTGSKFT------AAIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVL 86
           V FK  ++         A+Q   Q+ LNK+I T YP+QP RF K+ L+LP L+ I S  +
Sbjct: 136 VLFKPETRGLKDPAQVEALQDQAQLMLNKHIRTRYPTQPARFGKLLLLLPSLRFISSSTI 195

Query: 87  EELFFRNIIG 96
           EELFF+  IG
Sbjct: 196 EELFFKKTIG 205

The ligand binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like family: This family includes photoreceptor cell-specific nuclear receptor (PNR), Tailless (TLX), and related receptors. TLX is an orphan receptor that is expressed by neural stem/progenitor cells in the adult brain of the subventricular zone (SVZ) and the dentate gyrus (DG). It plays a key role in neural development by promoting cell cycle progression and preventing apoptosis in the developing brain. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, TLX and PNR have a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD). Length = 206
>gnl|CDD|132746 cd06948, NR_LBD_COUP-TF, Ligand binding domain of chicken ovalbumin upstream promoter transcription factors, a member of the nuclear receptor family Back     alignment and domain information
>gnl|CDD|132749 cd06951, NR_LBD_Dax1_like, The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain Back     alignment and domain information
>gnl|CDD|132763 cd07349, NR_LBD_SHP, The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain Back     alignment and domain information
>gnl|CDD|132750 cd06952, NR_LBD_TR2_like, The ligand binding domain of the orphan nuclear receptors TR4 and TR2 Back     alignment and domain information
>gnl|CDD|132764 cd07350, NR_LBD_Dax1, The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain Back     alignment and domain information
>gnl|CDD|132741 cd06943, NR_LBD_RXR_like, The ligand binding domain of the retinoid X receptor and Ultraspiracle, members of nuclear receptor superfamily Back     alignment and domain information
>gnl|CDD|132729 cd06931, NR_LBD_HNF4_like, The ligand binding domain of heptocyte nuclear factor 4, which is explosively expanded in nematodes Back     alignment and domain information
>gnl|CDD|132728 cd06930, NR_LBD_F2, Ligand-binding domain of nuclear receptor family 2 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 113
cd07349222 NR_LBD_SHP The ligand binding domain of DAX1 prote 99.97
cd07069241 NR_LBD_Lrh-1 The ligand binding domain of the live 99.97
cd07070237 NR_LBD_SF-1 The ligand binding domain of nuclear r 99.97
cd06937231 NR_LBD_RAR The ligand binding domain (LBD) of reti 99.97
cd07350232 NR_LBD_Dax1 The ligand binding domain of DAX1 prot 99.97
cd06951222 NR_LBD_Dax1_like The ligand binding domain of DAX1 99.97
cd06944237 NR_LBD_Ftz-F1_like The ligand binding domain of FT 99.96
cd07348238 NR_LBD_NGFI-B The ligand binding domain of Nurr1, 99.96
cd06949235 NR_LBD_ER Ligand binding domain of Estrogen recept 99.96
cd07071238 NR_LBD_Nurr1 The ligand binding domain of Nurr1, a 99.96
cd06945239 NR_LBD_Nurr1_like The ligand binding domain of Nur 99.96
cd06948236 NR_LBD_COUP-TF Ligand binding domain of chicken ov 99.96
cd06932259 NR_LBD_PPAR The ligand binding domain of peroxisom 99.95
cd07072239 NR_LBD_DHR38_like Ligand binding domain of DHR38_l 99.95
cd06935243 NR_LBD_TR The ligand binding domain of thyroid hor 99.95
cd06941195 NR_LBD_DmE78_like The ligand binding domain of Dro 99.95
cd06952222 NR_LBD_TR2_like The ligand binding domain of the o 99.94
cd07076247 NR_LBD_GR Ligand binding domain of the glucocortic 99.94
cd06933238 NR_LBD_VDR The ligand binding domain of vitamin D 99.94
cd06946221 NR_LBD_ERR The ligand binding domain of estrogen r 99.94
cd07073246 NR_LBD_AR Ligand binding domain of the nuclear rec 99.94
cd07068221 NR_LBD_ER_like The ligand binding domain of estrog 99.94
cd06939241 NR_LBD_ROR_like The ligand binding domain of Retin 99.94
cd06954236 NR_LBD_LXR The ligand binding domain of Liver X re 99.94
cd06950206 NR_LBD_Tlx_PNR_like The ligand binding domain of T 99.93
cd06947246 NR_LBD_GR_Like Ligand binding domain of nuclear ho 99.93
cd06936221 NR_LBD_Fxr The ligand binding domain of Farnesoid 99.93
cd06934226 NR_LBD_PXR_like The ligand binding domain of xenob 99.93
cd06940189 NR_LBD_REV_ERB The ligand binding domain of REV-ER 99.93
cd06938231 NR_LBD_EcR The ligand binding domain (LBD) of the 99.91
cd06943207 NR_LBD_RXR_like The ligand binding domain of the r 99.91
cd07075248 NR_LBD_MR Ligand binding domain of the mineralocor 99.9
cd06931222 NR_LBD_HNF4_like The ligand binding domain of hept 99.89
cd06953213 NR_LBD_DHR4_like The ligand binding domain of orph 99.88
KOG4215|consensus432 99.86
cd06942191 NR_LBD_Sex_1_like The ligand binding domain of Cae 99.85
cd06929174 NR_LBD_F1 Ligand-binding domain of nuclear recepto 99.84
cd06930165 NR_LBD_F2 Ligand-binding domain of nuclear recepto 99.79
cd07074248 NR_LBD_PR Ligand binding domain of the progesteron 99.75
cd06157168 NR_LBD The ligand binding domain of nuclear recept 99.6
smart00430163 HOLI Ligand binding domain of hormone receptors. 99.57
PF00104203 Hormone_recep: Ligand-binding domain of nuclear ho 99.56
KOG4218|consensus475 99.48
KOG4217|consensus605 99.27
KOG4216|consensus479 99.21
KOG4846|consensus538 88.54
>cd07349 NR_LBD_SHP The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain Back     alignment and domain information 
Probab=99.97  E-value=6.1e-32  Score=196.03  Aligned_cols=103  Identities=26%  Similarity=0.361  Sum_probs=100.9

Q ss_pred             hHHhhccccCCHHHHHHHHHHHhhcCCCCCcccCCCChhHHHHHHHHHHHHHHHHHHhhCCCcchHHHHHHHhchhhhcC
Q psy16764          2 FQTELTMLRIVTEENSNLEIRNAYTSRRGSRVRFKTGSKFTAAIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSI   81 (113)
Q Consensus         2 f~~~l~~L~ld~~E~~~Lkai~l~~~~~g~~~~~l~~~~~Ve~lqe~~~~aL~~~~~~~~p~~~~Rf~kLLl~Lp~Lr~l   81 (113)
                      |..+|++|++|++||+|||||+||+||+    +|+.+..+|+++||+++.||++|+..+||++|.||+|||++||+||++
T Consensus       120 ~~~~l~~L~ld~~Eya~LkaivLf~pd~----~gl~~~~~V~~lqe~~~~aL~~~~~~~~p~~~~r~~kLLl~Lp~LR~i  195 (222)
T cd07349         120 CLNKFWSLDLSPKEYAYLKGTILFNPDV----PGLTASSHVGHLQQEAQWALCEVLEPLHPQDQGRFARILLTASTLKSI  195 (222)
T ss_pred             HHHHHHHcCCCHHHHHHHHHHHHcCCCc----ccCCCHHHHHHHHHHHHHHHHHHHHHHCCCcccHHHHHHHHhHHHhcC
Confidence            7789999999999999999999999998    799999999999999999999999999999999999999999999999


Q ss_pred             ChhhhhhhhcccccCCCCcHHHHHHHHH
Q psy16764         82 PSLVLEELFFRNIIGHNTTIKKTIWHMY  109 (113)
Q Consensus        82 ~~~~~e~L~f~~~~g~~~~i~~Ll~eml  109 (113)
                      +++.+|++||.+.+| +++|++++.||+
T Consensus       196 ~~~~ie~lff~~~~g-~~~i~~Ll~eml  222 (222)
T cd07349         196 PPSLITDLFFRPIIG-DADIAELLGDML  222 (222)
T ss_pred             CHHHHHHHhCccccC-CCcHHHHHHHhC
Confidence            999999999999999 999999999996

The ligand binding domain of the Small Heterodimer Partner (SHP): SHP is a member of the nuclear receptor superfamily. SHP has a ligand binding domain, but lacks the DNA binding domain, typical to almost all of the nuclear receptors. It functions as a transcriptional coregulator by directly interacting with other nuclear receptors through its AF-2 motif. The closest relative of SHP is DAX1 and they can form heterodimer. SHP is an orphan receptor, lacking an identified ligand.
>cd07069 NR_LBD_Lrh-1 The ligand binding domain of the liver receptor homolog-1, a member of nuclear receptor superfamily, Back     alignment and domain information
>cd07070 NR_LBD_SF-1 The ligand binding domain of nuclear receptor steroidogenic factor 1, a member of nuclear receptor superfamily Back     alignment and domain information
>cd06937 NR_LBD_RAR The ligand binding domain (LBD) of retinoic acid receptor (RAR), a members of the nuclear receptor superfamily Back     alignment and domain information
>cd07350 NR_LBD_Dax1 The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain Back     alignment and domain information
>cd06951 NR_LBD_Dax1_like The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain Back     alignment and domain information
>cd06944 NR_LBD_Ftz-F1_like The ligand binding domain of FTZ-F1 like nuclear receptors Back     alignment and domain information
>cd07348 NR_LBD_NGFI-B The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors Back     alignment and domain information
>cd06949 NR_LBD_ER Ligand binding domain of Estrogen receptor, which are activated by the hormone 17beta-estradiol (estrogen) Back     alignment and domain information
>cd07071 NR_LBD_Nurr1 The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors Back     alignment and domain information
>cd06945 NR_LBD_Nurr1_like The ligand binding domain of Nurr1 and related nuclear receptor proteins, members of nuclear receptor superfamily Back     alignment and domain information
>cd06948 NR_LBD_COUP-TF Ligand binding domain of chicken ovalbumin upstream promoter transcription factors, a member of the nuclear receptor family Back     alignment and domain information
>cd06932 NR_LBD_PPAR The ligand binding domain of peroxisome proliferator-activated receptors Back     alignment and domain information
>cd07072 NR_LBD_DHR38_like Ligand binding domain of DHR38_like proteins, members of the nuclear receptor superfamily Back     alignment and domain information
>cd06935 NR_LBD_TR The ligand binding domain of thyroid hormone receptor, a members of a superfamily of nuclear receptors Back     alignment and domain information
>cd06941 NR_LBD_DmE78_like The ligand binding domain of Drosophila ecdysone-induced protein 78, a member of the nuclear receptor superfamily Back     alignment and domain information
>cd06952 NR_LBD_TR2_like The ligand binding domain of the orphan nuclear receptors TR4 and TR2 Back     alignment and domain information
>cd07076 NR_LBD_GR Ligand binding domain of the glucocorticoid receptor, a member of the nuclear receptor superfamily Back     alignment and domain information
>cd06933 NR_LBD_VDR The ligand binding domain of vitamin D receptors, a member of the nuclear receptor superfamily Back     alignment and domain information
>cd06946 NR_LBD_ERR The ligand binding domain of estrogen receptor-related nuclear receptors Back     alignment and domain information
>cd07073 NR_LBD_AR Ligand binding domain of the nuclear receptor androgen receptor, ligand activated transcription regulator Back     alignment and domain information
>cd07068 NR_LBD_ER_like The ligand binding domain of estrogen receptor and estrogen receptor-related receptors Back     alignment and domain information
>cd06939 NR_LBD_ROR_like The ligand binding domain of Retinoid-related orphan receptors, of the nuclear receptor superfamily Back     alignment and domain information
>cd06954 NR_LBD_LXR The ligand binding domain of Liver X receptors, a family of nuclear receptors of ligand-activated transcription factors Back     alignment and domain information
>cd06950 NR_LBD_Tlx_PNR_like The ligand binding domain of Tailless-like proteins, orphan nuclear receptors Back     alignment and domain information
>cd06947 NR_LBD_GR_Like Ligand binding domain of nuclear hormone receptors:glucocorticoid receptor, mineralocorticoid receptor , progesterone receptor, and androgen receptor Back     alignment and domain information
>cd06936 NR_LBD_Fxr The ligand binding domain of Farnesoid X receptor:a member of the nuclear receptor superfamily of ligand-activated transcription factors Back     alignment and domain information
>cd06934 NR_LBD_PXR_like The ligand binding domain of xenobiotic receptors:pregnane X receptor and constitutive androstane receptor Back     alignment and domain information
>cd06940 NR_LBD_REV_ERB The ligand binding domain of REV-ERB receptors, members of the nuclear receptor superfamily Back     alignment and domain information
>cd06938 NR_LBD_EcR The ligand binding domain (LBD) of the Ecdysone receptor, a member of the nuclear receptors super family Back     alignment and domain information
>cd06943 NR_LBD_RXR_like The ligand binding domain of the retinoid X receptor and Ultraspiracle, members of nuclear receptor superfamily Back     alignment and domain information
>cd07075 NR_LBD_MR Ligand binding domain of the mineralocorticoid receptor, a member of the nuclear receptor superfamily Back     alignment and domain information
>cd06931 NR_LBD_HNF4_like The ligand binding domain of heptocyte nuclear factor 4, which is explosively expanded in nematodes Back     alignment and domain information
>cd06953 NR_LBD_DHR4_like The ligand binding domain of orphan nuclear receptor Ecdysone-induced receptor DHR4 Back     alignment and domain information
>KOG4215|consensus Back     alignment and domain information
>cd06942 NR_LBD_Sex_1_like The ligand binding domain of Caenorhabditis elegans nuclear hormone receptor Sex-1 protein Back     alignment and domain information
>cd06929 NR_LBD_F1 Ligand-binding domain of nuclear receptor family 1 Back     alignment and domain information
>cd06930 NR_LBD_F2 Ligand-binding domain of nuclear receptor family 2 Back     alignment and domain information
>cd07074 NR_LBD_PR Ligand binding domain of the progesterone receptor, a member of the nuclear hormone receptor Back     alignment and domain information
>cd06157 NR_LBD The ligand binding domain of nuclear receptors, a family of ligand-activated transcription regulators Back     alignment and domain information
>smart00430 HOLI Ligand binding domain of hormone receptors Back     alignment and domain information
>PF00104 Hormone_recep: Ligand-binding domain of nuclear hormone receptor; InterPro: IPR000536 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis Back     alignment and domain information
>KOG4218|consensus Back     alignment and domain information
>KOG4217|consensus Back     alignment and domain information
>KOG4216|consensus Back     alignment and domain information
>KOG4846|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query113
3cjw_A244 Crystal Structure Of The Human Coup-Tfii Ligand Bin 3e-08
2q60_A258 Crystal Structure Of The Ligand Binding Domain Of P 3e-07
1xiu_A230 Crystal Structure Of The Agonist-Bound Ligand-Bindi 9e-06
1z5x_U262 Hemipteran Ecdysone Receptor Ligand-Binding Domain 2e-05
3eyb_A219 Structural And Functional Insights Into The Ligand 2e-05
2gl8_A241 Human Retinoic Acid Receptor Rxr-Gamma Ligand-Bindi 2e-05
1lbd_A282 Ligand-Binding Domain Of The Human Nuclear Receptor 3e-05
3dzu_A467 Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Comp 3e-05
3e94_A244 Crystal Structure Of Rxralpha Ligand Binding Domain 3e-05
1dkf_A233 Crystal Structure Of A Heterodimeric Complex Of Rar 3e-05
1rdt_A242 Crystal Structure Of A New Rexinoid Bound To The Rx 3e-05
1fm6_A238 The 2.1 Angstrom Resolution Crystal Structure Of Th 3e-05
3uvv_B244 Crystal Structure Of The Ligand Binding Domains Of 3e-05
1mv9_A240 Crystal Structure Of The Human Rxr Alpha Ligand Bin 4e-05
1fby_A239 Crystal Structure Of The Human Rxr Alpha Ligand Bin 4e-05
3a9e_A240 Crystal Structure Of A Mixed Agonist-Bound Rar-Alph 4e-05
1xdk_A238 Crystal Structure Of The RarbetaRXRALPHA LIGAND BIN 4e-05
3pcu_A230 Crystal Structure Of Human Retinoic X Receptor Alph 4e-05
3oap_A231 Crystal Structure Of Human Retinoid X Receptor Alph 4e-05
1xv9_A236 Crystal Structure Of CarRXR HETERODIMER BOUND WITH 4e-05
1xls_A232 Crystal Structure Of The Mouse CarRXR LBD HETERODIM 4e-05
2nxx_A235 Crystal Structure Of The Ligand-Binding Domains Of 4e-05
3h0a_A228 Crystal Structure Of Peroxisome Proliferator-Activa 4e-05
1uhl_A236 Crystal Structure Of The Lxralfa-Rxrbeta Lbd Hetero 4e-04
1h9u_A224 The Structure Of The Human Retinoid-X-Receptor Beta 7e-04
>pdb|3CJW|A Chain A, Crystal Structure Of The Human Coup-Tfii Ligand Binding Domain Length = 244 Back     alignment and structure 
Iteration: 1

 Score = 53.5 bits (127), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 43/65 (66%), Gaps = 1/65 (1%)
Query: 44  AIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFFRNIIGHNTTIKK 103
           ++Q  +Q  L +Y+ + YP+QPTRF K+ L LP L+++ S V+E+LFF  ++G  T I+ 
Sbjct: 166 SLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVG-KTPIET 224
Query: 104 TIWHM 108
            I  M
Sbjct: 225 LIRDM 229
>pdb|2Q60|A Chain A, Crystal Structure Of The Ligand Binding Domain Of Polyandrocarpa Misakiensis Rxr In Tetramer In Absence Of Ligand Length = 258 Back     alignment and structure
>pdb|1XIU|A Chain A, Crystal Structure Of The Agonist-Bound Ligand-Binding Domain Of Biomphalaria Glabrata Rxr Length = 230 Back     alignment and structure
>pdb|1Z5X|U Chain U, Hemipteran Ecdysone Receptor Ligand-Binding Domain Complexed With Ponasterone A Length = 262 Back     alignment and structure
>pdb|3EYB|A Chain A, Structural And Functional Insights Into The Ligand Binding Domain Of A Non-Duplicated Rxr From The Invertebrate Chordate Amphioxus Length = 219 Back     alignment and structure
>pdb|2GL8|A Chain A, Human Retinoic Acid Receptor Rxr-Gamma Ligand-Binding Domain Length = 241 Back     alignment and structure
>pdb|1LBD|A Chain A, Ligand-Binding Domain Of The Human Nuclear Receptor Rxr-Alpha Length = 282 Back     alignment and structure
>pdb|3DZU|A Chain A, Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Complex On Dna Bound With Bvt.13, 9-Cis Retinoic Acid And Ncoa2 Peptide Length = 467 Back     alignment and structure
>pdb|3E94|A Chain A, Crystal Structure Of Rxralpha Ligand Binding Domain In Complex With Tributyltin And A Coactivator Fragment Length = 244 Back     alignment and structure
>pdb|1DKF|A Chain A, Crystal Structure Of A Heterodimeric Complex Of Rar And Rxr Ligand-Binding Domains Length = 233 Back     alignment and structure
>pdb|1RDT|A Chain A, Crystal Structure Of A New Rexinoid Bound To The Rxralpha Ligand Binding Doamin In The RxralphaPPARGAMMA HETERODIMER Length = 242 Back     alignment and structure
>pdb|1FM6|A Chain A, The 2.1 Angstrom Resolution Crystal Structure Of The Heterodimer Of The Human Rxralpha And Ppargamma Ligand Binding Domains Respectively Bound With 9-Cis Retinoic Acid And Rosiglitazone And Co-Activator Peptides. Length = 238 Back     alignment and structure
>pdb|3UVV|B Chain B, Crystal Structure Of The Ligand Binding Domains Of The Thyroid Receptor:retinoid X Receptor Complexed With 3,3',5 Triiodo-L- Thyronine And 9-Cis Retinoic Acid Length = 244 Back     alignment and structure
>pdb|1MV9|A Chain A, Crystal Structure Of The Human Rxr Alpha Ligand Binding Domain Bound To The Eicosanoid Dha (Docosa Hexaenoic Acid) And A Coactivator Peptide Length = 240 Back     alignment and structure
>pdb|1FBY|A Chain A, Crystal Structure Of The Human Rxr Alpha Ligand Binding Domain Bound To 9-Cis Retinoic Acid Length = 239 Back     alignment and structure
>pdb|3A9E|A Chain A, Crystal Structure Of A Mixed Agonist-Bound Rar-Alpha And Antagonist- Bound Rxr-Alpha Heterodimer Ligand Binding Domains Length = 240 Back     alignment and structure
>pdb|1XDK|A Chain A, Crystal Structure Of The RarbetaRXRALPHA LIGAND BINDING Domain Heterodimer In Complex With 9-Cis Retinoic Acid And A Fragment Of The Trap220 Coactivator Length = 238 Back     alignment and structure
>pdb|3PCU|A Chain A, Crystal Structure Of Human Retinoic X Receptor Alpha Ligand-Binding Domain Complexed With Lx0278 And Src1 Peptide Length = 230 Back     alignment and structure
>pdb|3OAP|A Chain A, Crystal Structure Of Human Retinoid X Receptor Alpha-Ligand Binding Domain Complex With 9-Cis Retinoic Acid And The Coactivator Peptide Grip-1 Length = 231 Back     alignment and structure
>pdb|1XV9|A Chain A, Crystal Structure Of CarRXR HETERODIMER BOUND WITH SRC1 Peptide, Fatty Acid, And 5b-Pregnane-3,20-Dione. Length = 236 Back     alignment and structure
>pdb|1XLS|A Chain A, Crystal Structure Of The Mouse CarRXR LBD HETERODIMER Bound To Tcpobop And 9cra And A Tif2 Peptide Containg The Third Lxxll Motifs Length = 232 Back     alignment and structure
>pdb|2NXX|A Chain A, Crystal Structure Of The Ligand-Binding Domains Of The T.Castaneum (Coleoptera) Heterodimer Ecrusp Bound To Ponasterone A Length = 235 Back     alignment and structure
>pdb|3H0A|A Chain A, Crystal Structure Of Peroxisome Proliferator-Activated Receptor Gamma (Pparg) And Retinoic Acid Receptor Alpha (Rxra) In Complex With 9-Cis Retinoic Acid, Co-Activator Peptide, And A Partial Agonist Length = 228 Back     alignment and structure
>pdb|1UHL|A Chain A, Crystal Structure Of The Lxralfa-Rxrbeta Lbd Heterodimer Length = 236 Back     alignment and structure
>pdb|1H9U|A Chain A, The Structure Of The Human Retinoid-X-Receptor Beta Ligand Binding Domain In Complex With The Specific Synthetic Agonist Lg100268 Length = 224 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query113
3p0u_A249 Nuclear receptor subfamily 2 group C member 2; lig 3e-12
3f5c_B268 Nuclear receptor subfamily 0 group B member 1; tra 9e-12
1g2n_A264 Ultraspiracle protein; antiparallel alpha-helical 1e-11
2nxx_A235 Ultraspiracle (USP, NR2B4); hormone receptor, APO 1e-11
3cjw_A244 COUP transcription factor 2; COUP-TFII, nuclear re 3e-11
3tx7_B352 Nuclear receptor subfamily 5 group A member 2; LRH 3e-11
2iz2_A243 FTZ-F1 alpha, nuclear hormone receptor FTZ-F1; nuc 4e-11
1ymt_A246 Steroidogenic factor 1; SF-1, ligand-binding domai 7e-11
3plz_A257 FTZ-F1 related protein; alpha helical sandwhich, f 8e-11
1pzl_A237 Hepatocyte nuclear factor 4-alpha; transcription; 1e-10
1hg4_A279 Ultraspiracle; nuclear hormone receptor, transcrip 3e-10
2p1t_A240 Retinoic acid receptor RXR-alpha; protein-ligand c 9e-10
1lbd_A282 RXR_LBD, retinoid X receptor; transcription factor 2e-09
2e2r_A244 Estrogen-related receptor gamma; ERR gamma, BPA, n 1e-08
3ltx_A243 Estrogen receptor; constitutive, nuclear receptor, 1e-07
3dzy_D419 Peroxisome proliferator-activated receptor gamma; 2e-07
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 8e-07
3k6p_A248 Steroid hormone receptor ERR1; estrogen related re 3e-06
1l2j_A271 Estrogen receptor beta; nuclear receptor, transcri 4e-06
1xpc_A248 Estrogen receptor; nuclear receptor, transcription 5e-06
3u9q_A269 Peroxisome proliferator-activated receptor gamma; 5e-06
3oll_A240 Estrogen receptor beta; steroid binding, phosphory 7e-06
3cqv_A199 Nuclear receptor subfamily 1 group D member 2; rev 8e-06
3ipq_A283 Oxysterols receptor LXR-alpha; LXR homodimer, LXR 9e-06
3n00_A245 REV-ERBA-alpha; reverba ncorid1, anti-parallel B-s 1e-05
1ovl_A271 Orphan nuclear receptor NURR1 (MSe 414, 496, 511); 1e-05
1yye_A268 ER-beta, estrogen receptor beta; ER-beta, nuclear 1e-05
3kmr_A266 Retinoic acid receptor alpha; nuclear receptor tra 1e-05
1yje_A264 Orphan nuclear receptor NR4A1; NGFI-B, NUR77, liga 1e-05
1fcy_A236 RAR-gamma-1, retinoic acid receptor gamma-1; isoty 2e-05
1osh_A232 BIle acid receptor; nuclear receptor, ligand bindi 3e-05
2ocf_A298 Estrogen receptor; estrogen receptor, LBD, monobod 3e-05
2hc4_A302 Vitamin D receptor; alpha helical sandwich, gene r 4e-05
1xdk_B303 RAR-beta, retinoic acid receptor, beta; nuclear re 6e-05
1pdu_A244 DHR38, nuclear hormone receptor HR38; nuclear rece 1e-04
3ilz_A267 Thyroid hormone receptor, alpha isoform 1 variant; 2e-04
3vhv_A260 Mineralocorticoid receptor; nuclear receptor, tran 2e-04
3mnp_A261 Glucocorticoid receptor; protein-ligand complex, s 2e-04
3vhu_A294 Mineralocorticoid receptor; nuclear receptor, tran 5e-04
1t7r_A269 Androgen receptor; nuclear receptor, transcription 5e-04
2p54_A267 PPAR-alpha, peroxisome proliferator-activated rece 8e-04
>3p0u_A Nuclear receptor subfamily 2 group C member 2; ligand binding domain, orphan nuclear receptor, testicular R 4, signaling protein; 3.00A {Homo sapiens} Length = 249 Back     alignment and structure
 Score = 59.6 bits (144), Expect = 3e-12
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 1/68 (1%)

Query: 44  AIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFFRNIIGHNTTIKK 103
             Q   Q+ L  Y+   Y     R  +I + LP L+ + S + EELFF  +IG N +I  
Sbjct: 169 KFQEAAQMELQDYVQATYSEDTYRLARILVRLPALRLMSSNITEELFFTGLIG-NVSIDS 227

Query: 104 TIWHMYKN 111
            I ++ K 
Sbjct: 228 IIPYILKM 235
>3f5c_B Nuclear receptor subfamily 0 group B member 1; transcriptional corepressor, regulatory complex, DNA-binding, lipid-binding, metal-binding; 3.00A {Mus musculus} Length = 268 Back     alignment and structure
>1g2n_A Ultraspiracle protein; antiparallel alpha-helical sandwich, structural proteomics in europe, spine, structural genomics, gene regulation; HET: EPH; 1.65A {Heliothis virescens} SCOP: a.123.1.1 PDB: 2r40_A* 1r20_A* 1r1k_A* 3ixp_A* Length = 264 Back     alignment and structure
>2nxx_A Ultraspiracle (USP, NR2B4); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Length = 235 Back     alignment and structure
>3cjw_A COUP transcription factor 2; COUP-TFII, nuclear receptor, ligand binding domain, orphan receptor, three-layered helical sandwich, DNA-binding; 1.48A {Homo sapiens} Length = 244 Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 Back     alignment and structure
>1ymt_A Steroidogenic factor 1; SF-1, ligand-binding domain, ligand, phosphatidyl glycerol, CO-repressor peptide, transcription; HET: DR9; 1.20A {Mus musculus} PDB: 3f7d_A* 1yp0_A* 1yow_A* 1zdt_A* Length = 246 Back     alignment and structure
>3plz_A FTZ-F1 related protein; alpha helical sandwhich, family five, TRAN factor, transcription-receptor-agonist comple; HET: 470; 1.75A {Homo sapiens} PDB: 1yok_A* 1yuc_A* 4dor_A* 1zdu_A* 4dos_A* 1zh7_A 1pk5_A 3f5c_A Length = 257 Back     alignment and structure
>1pzl_A Hepatocyte nuclear factor 4-alpha; transcription; HET: MYR; 2.10A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fs1_A* 1m7w_A* 1lv2_A* Length = 237 Back     alignment and structure
>1hg4_A Ultraspiracle; nuclear hormone receptor, transcription factor, ligand binding; HET: LPP; 2.4A {Drosophila melanogaster} SCOP: a.123.1.1 Length = 279 Back     alignment and structure
>2p1t_A Retinoic acid receptor RXR-alpha; protein-ligand complex, hormone receptor; HET: 3TN; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 1mvc_A* 1mzn_A* 1mv9_A* 2p1u_A* 2p1v_A* 2zxz_A* 2zy0_A* 3fug_A* 3nsp_A 3nsq_A* 3r29_A 3r2a_A* 3r5m_A* 3e94_A* 3kwy_A* 1fby_A* 3uvv_B* 3fc6_A* 1rdt_A* 3fal_A* ... Length = 240 Back     alignment and structure
>1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A Length = 282 Back     alignment and structure
>2e2r_A Estrogen-related receptor gamma; ERR gamma, BPA, nuclear receptor, transcription; HET: 2OH; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 2zas_A* 2zbs_A 2zkc_A* 2p7g_A* 1vjb_A* 1tfc_A 2p7a_A* 2p7z_A* 2gpu_A* 1kv6_A 2gp7_A 2gpp_A* 2gpo_A* 2gpv_A* 1s9q_A* 1s9p_A* 2ewp_A* Length = 244 Back     alignment and structure
>3ltx_A Estrogen receptor; constitutive, nuclear receptor, DNA-binding, metal-binding, nucleus, transcription, transcription regulation, zinc-finger; 2.60A {Crassostrea gigas} Length = 243 Back     alignment and structure
>3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A Length = 419 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3k6p_A Steroid hormone receptor ERR1; estrogen related receptor alpha, DNA-binding, isopeptide BON binding, nucleus, phosphoprotein, transcription; HET: 5FB; 2.00A {Homo sapiens} PDB: 1xb7_A 2pjl_A* 3d24_A Length = 248 Back     alignment and structure
>1l2j_A Estrogen receptor beta; nuclear receptor, transcription factor, antagonist transcription receptor; HET: ETC; 2.95A {Homo sapiens} SCOP: a.123.1.1 Length = 271 Back     alignment and structure
>1xpc_A Estrogen receptor; nuclear receptor, transcription factor, ER-alpha, antagonist hormone-growth factor receptor complex; HET: AIT; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1sj0_A* 1xp1_A* 1xp9_A* 1xp6_A* 1yim_A* 1yin_A* 3ert_A* 1r5k_A* 3erd_A* 1l2i_A* 2iok_A* 1a52_A* 2ouz_A* 1ere_A* 1err_A* 2qxs_A* 3q95_A* 3q97_A* 2b1z_A* 1zky_A* ... Length = 248 Back     alignment and structure
>3u9q_A Peroxisome proliferator-activated receptor gamma; nuclear receptor, adipogenesis, RXRA, nucleus, transcription; HET: DKA; 1.52A {Homo sapiens} PDB: 1i7i_A* 3ty0_A* 1zeo_A* 2p4y_A* 3et3_A* 3et0_A* 2hwq_A* 2ath_A* 2f4b_A* 2g0g_A* 2g0h_A* 2gtk_A* 2fvj_A* 2hwr_A* 2prg_A* 2q8s_A* 3fej_A* 3g9e_A* 3gbk_A* 3ia6_A* ... Length = 269 Back     alignment and structure
>3oll_A Estrogen receptor beta; steroid binding, phosphorylation, hormone receptor-activator; HET: PTR EST; 1.50A {Homo sapiens} PDB: 1u3s_A* 1u3q_A* 1x78_A* 1x7b_A* 1x7j_A* 1x76_A* 2yjd_A* 3ols_A* 3omo_A* 3omp_A* 3omq_A* 1u3r_A* 1u9e_A* 1qkm_A* 2giu_A* 1nde_A* 2jj3_A* 2i0g_A* 2qtu_A* 2z4b_A* ... Length = 240 Back     alignment and structure
>3cqv_A Nuclear receptor subfamily 1 group D member 2; reverb beta, heme, NR1D2, DNA-binding, metal-binding, nucleus, repressor, transcription; HET: HEM; 1.90A {Homo sapiens} PDB: 2v7c_A 2v0v_A Length = 199 Back     alignment and structure
>3ipq_A Oxysterols receptor LXR-alpha; LXR homodimer, LXR signaling, alternative DNA-binding, metal-binding, nucleus, polymorphism, receptor transcription; HET: 965; 2.00A {Homo sapiens} PDB: 3ips_A* 3ipu_A* 3fc6_B* 3fal_B* 1uhl_B* 2acl_B* 1upv_A* 1upw_A* 1p8d_A* 1pq9_A* 1pq6_A* 1pqc_A* 3kfc_A* 4dk7_A* 4dk8_A* 3l0e_A* Length = 283 Back     alignment and structure
>3n00_A REV-ERBA-alpha; reverba ncorid1, anti-parallel B-sheet, transcription regula; 2.60A {Homo sapiens} Length = 245 Back     alignment and structure
>1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 Length = 271 Back     alignment and structure
>1yye_A ER-beta, estrogen receptor beta; ER-beta, nuclear receptor, transcription factor, agonist; HET: 196; 2.03A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yy4_A* Length = 268 Back     alignment and structure
>3kmr_A Retinoic acid receptor alpha; nuclear receptor transcription factor ligand binding domain, binding, metal-binding, nucleus, phosphoprotein; HET: EQN; 1.80A {Homo sapiens} PDB: 3kmz_B* 3a9e_B* 4dm6_A* 1xap_A* 4dm8_A* 2lbd_A* 3lbd_A* 4lbd_A* Length = 266 Back     alignment and structure
>1yje_A Orphan nuclear receptor NR4A1; NGFI-B, NUR77, ligand-binding domain, novel coregulator interface, cell-specific; 2.40A {Rattus norvegicus} PDB: 2qw4_A Length = 264 Back     alignment and structure
>1fcy_A RAR-gamma-1, retinoic acid receptor gamma-1; isotype selectivity, retinoid ligand complexes, drug design, antiparallel alpha-helical sandwich fold; HET: 564 LMU; 1.30A {Homo sapiens} SCOP: a.123.1.1 PDB: 1fcz_A* 1fcx_A* 1fd0_A* 1exa_A* 1exx_A* 1dkf_B* Length = 236 Back     alignment and structure
>1osh_A BIle acid receptor; nuclear receptor, ligand binding domain, transcription; HET: FEX; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 3l1b_A* 3bej_A* 3fli_A* 3hc5_A* 3rvf_A* 3dct_A* 3dcu_A* 3ruu_A* 3rut_A* 3olf_A* 3okh_A* 3fxv_A* 3oki_A* 3omk_A* 3omm_A* 3oof_A* 3ook_A* 3hc6_A* 3p89_A* 3p88_A* ... Length = 232 Back     alignment and structure
>2ocf_A Estrogen receptor; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 298 Back     alignment and structure
>2hc4_A Vitamin D receptor; alpha helical sandwich, gene regulation; HET: VDX; 2.20A {Danio rerio} PDB: 2hbh_A* 2hcd_A* 3dr1_A* 3o1d_A* 3o1e_A* Length = 302 Back     alignment and structure
>1xdk_B RAR-beta, retinoic acid receptor, beta; nuclear receptor, coactivator, ligand, hormone/growth factor receptor complex; HET: REA; 2.90A {Mus musculus} SCOP: a.123.1.1 Length = 303 Back     alignment and structure
>1pdu_A DHR38, nuclear hormone receptor HR38; nuclear receptor, ligand-binding domain, hormone/growth factor receptor complex; 2.30A {Drosophila melanogaster} SCOP: a.123.1.1 Length = 244 Back     alignment and structure
>3ilz_A Thyroid hormone receptor, alpha isoform 1 variant; nuclear receptor, signaling protein; HET: B72; 1.85A {Homo sapiens} PDB: 3jzb_A* 3hzf_A* 2h79_A* 2h77_A* 1nav_A* 3uvv_A* 1xzx_X* 1y0x_X* 1nq1_A* 3jzc_A* 1nuo_A* 3imy_A* 1nq0_A* 1bsx_A* 1r6g_A* 1nq2_A* 3gws_X* 1n46_A* 2h6w_X* 2j4a_A* ... Length = 267 Back     alignment and structure
>3vhv_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, non-steroidal antagonist; HET: LD1 LD2; 1.35A {Homo sapiens} PDB: 2aax_A* 2aa6_A* 2ab2_A* 2aa2_A* 2aa5_A* 2aa7_A* 2a3i_A* 1y9r_A* 1ya3_A* 2oax_A* 2abi_A* 2q1h_A* 2q1v_A* 2q3y_A* 3ry9_A* Length = 260 Back     alignment and structure
>3mnp_A Glucocorticoid receptor; protein-ligand complex, steroid nuclear receptor, mouse GR, hormone receptor; HET: DEX; 1.50A {Mus musculus} PDB: 3mno_A* 3mne_A* 1m2z_A* 3k22_A* 3cld_A* 3k23_A* 3e7c_A* 1nhz_A* 1p93_A* 3bqd_A* 3h52_A* 3gn8_A* 4e2j_A* Length = 261 Back     alignment and structure
>3vhu_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, antagonist, spironolactone; HET: SNL; 2.11A {Homo sapiens} Length = 294 Back     alignment and structure
>1t7r_A Androgen receptor; nuclear receptor, transcription factor, ligand binding domain, AF-2, androgen, testosterone, DHT, alpha-helical sandwich; HET: DHT; 1.40A {Pan troglodytes} SCOP: a.123.1.1 PDB: 1t73_A* 1t76_A* 1t74_A* 1t79_A* 1t7m_A* 1t7f_A* 1t7t_A* 2am9_A* 2ama_A* 2amb_A* 2pnu_A* 1e3g_A* 2q7i_A* 1xj7_A* 2q7j_A* 3g0w_A* 2ihq_A* 2nw4_A* 1i37_A* 2q7k_A* ... Length = 269 Back     alignment and structure
>2p54_A PPAR-alpha, peroxisome proliferator-activated receptor alpha; PPAR alpha GW735 SRC1 agonist HDLC, transcription; HET: 735; 1.79A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fei_A* 1i7g_A* 3kdu_A* 3kdt_A* 2rew_A* 1kkq_A* 3g8i_A* 3et1_A* 2znn_A* 3sp6_A* 1k7l_A* 2npa_A* 2xyj_A* 2xyw_A* 2xyx_A* 2q5g_A* 3gwx_A* 3dy6_A* 1gwx_A* 3peq_A* ... Length = 267 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query113
3f5c_B268 Nuclear receptor subfamily 0 group B member 1; tra 99.96
3p0u_A249 Nuclear receptor subfamily 2 group C member 2; lig 99.96
1fcy_A236 RAR-gamma-1, retinoic acid receptor gamma-1; isoty 99.96
3plz_A257 FTZ-F1 related protein; alpha helical sandwhich, f 99.96
3k6p_A248 Steroid hormone receptor ERR1; estrogen related re 99.96
3ltx_A243 Estrogen receptor; constitutive, nuclear receptor, 99.96
3vi8_A273 Peroxisome proliferator-activated receptor alpha; 99.96
2iz2_A243 FTZ-F1 alpha, nuclear hormone receptor FTZ-F1; nuc 99.95
3kmr_A266 Retinoic acid receptor alpha; nuclear receptor tra 99.95
2e2r_A244 Estrogen-related receptor gamma; ERR gamma, BPA, n 99.95
3v3e_B257 Nuclear receptor subfamily 4 group A member 1; orp 99.95
3cjw_A244 COUP transcription factor 2; COUP-TFII, nuclear re 99.95
2nxx_A235 Ultraspiracle (USP, NR2B4); hormone receptor, APO 99.95
1ymt_A246 Steroidogenic factor 1; SF-1, ligand-binding domai 99.95
1g2n_A264 Ultraspiracle protein; antiparallel alpha-helical 99.95
3ilz_A267 Thyroid hormone receptor, alpha isoform 1 variant; 99.95
1hg4_A279 Ultraspiracle; nuclear hormone receptor, transcrip 99.95
3tx7_B352 Nuclear receptor subfamily 5 group A member 2; LRH 99.95
3u9q_A269 Peroxisome proliferator-activated receptor gamma; 99.95
1xdk_B303 RAR-beta, retinoic acid receptor, beta; nuclear re 99.95
1osh_A232 BIle acid receptor; nuclear receptor, ligand bindi 99.95
3dzy_D419 Peroxisome proliferator-activated receptor gamma; 99.94
3b0t_A254 Vitamin D3 receptor; nuclear receptor, transcripti 99.94
2p1t_A240 Retinoic acid receptor RXR-alpha; protein-ligand c 99.94
3oll_A240 Estrogen receptor beta; steroid binding, phosphory 99.94
2hc4_A302 Vitamin D receptor; alpha helical sandwich, gene r 99.94
3ipq_A283 Oxysterols receptor LXR-alpha; LXR homodimer, LXR 99.94
1lbd_A282 RXR_LBD, retinoid X receptor; transcription factor 99.94
1nq7_A244 Nuclear receptor ROR-beta; ligand-binding domain, 99.94
1xvp_B246 Orphan nuclear receptor NR1I3; CAR, RXR, citco, SR 99.94
1pdu_A244 DHR38, nuclear hormone receptor HR38; nuclear rece 99.94
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 99.94
1nrl_A316 Orphan nuclear receptor PXR; PXR, xenobiotic, SRC- 99.94
2o4j_A292 Vitamin D3 receptor; nuclear receptor-ligand compl 99.93
1n83_A270 Nuclear receptor ROR-alpha; three-layered alpha he 99.93
1xpc_A248 Estrogen receptor; nuclear receptor, transcription 99.93
2r40_D266 Ecdysone receptor, 20-hydroxy-ecdysone receptor; n 99.93
1yye_A268 ER-beta, estrogen receptor beta; ER-beta, nuclear 99.93
1l2j_A271 Estrogen receptor beta; nuclear receptor, transcri 99.93
2ocf_A298 Estrogen receptor; estrogen receptor, LBD, monobod 99.93
3up3_A243 Acedaf-12; ligand binding domain, nematode, steroi 99.92
2nxx_E248 Ecdysone receptor (ECR, NRH1); hormone receptor, A 99.92
3l0l_A248 Nuclear receptor ROR-gamma; nuclear receptor, rorg 99.92
1ovl_A271 Orphan nuclear receptor NURR1 (MSe 414, 496, 511); 99.92
1pzl_A237 Hepatocyte nuclear factor 4-alpha; transcription; 99.92
3cqv_A199 Nuclear receptor subfamily 1 group D member 2; rev 99.92
3vhv_A260 Mineralocorticoid receptor; nuclear receptor, tran 99.91
1z5x_E310 Ecdysone receptor ligand binding domain; ponastero 99.91
3n00_A245 REV-ERBA-alpha; reverba ncorid1, anti-parallel B-s 99.91
1t7r_A269 Androgen receptor; nuclear receptor, transcription 99.9
3vhu_A294 Mineralocorticoid receptor; nuclear receptor, tran 99.9
1sqn_A261 PR, progesterone receptor; nuclear receptor, stero 99.9
3gyt_A244 Nuclear hormone receptor of the steroid/thyroid ho 99.9
3mnp_A261 Glucocorticoid receptor; protein-ligand complex, s 99.9
>3f5c_B Nuclear receptor subfamily 0 group B member 1; transcriptional corepressor, regulatory complex, DNA-binding, lipid-binding, metal-binding; 3.00A {Mus musculus} Back     alignment and structure
Probab=99.96  E-value=4.7e-30  Score=189.24  Aligned_cols=106  Identities=25%  Similarity=0.240  Sum_probs=103.6

Q ss_pred             hHHhhccccCCHHHHHHHHHHHhhcCCCCCcccCCCChhHHHHHHHHHHHHHHHHHHhhCCCcchHHHHHHHhchhhhcC
Q psy16764          2 FQTELTMLRIVTEENSNLEIRNAYTSRRGSRVRFKTGSKFTAAIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSI   81 (113)
Q Consensus         2 f~~~l~~L~ld~~E~~~Lkai~l~~~~~g~~~~~l~~~~~Ve~lqe~~~~aL~~~~~~~~p~~~~Rf~kLLl~Lp~Lr~l   81 (113)
                      |..+|++|++|++||+|||||++|+||+    +|+.+..+|+++|++++.+|.+|+..+||++|.||++||++||+||++
T Consensus       162 ~~~~l~~L~ld~~E~~lLkAivL~npd~----~gL~~~~~ve~lq~~~~~aL~~y~~~~~p~~~~Rf~~LL~~Lp~LR~i  237 (268)
T 3f5c_B          162 FFFKCWSLNIDTKEYAYLKGTVLFNPDL----PGLQCVKYIEGLQWRTQQILTEHIRMMQREYQIRSAELNSALFLLRFI  237 (268)
T ss_dssp             HHHHHHHTTCCHHHHHHHHHHHHSCTTS----TTCSCHHHHHHHHHHHHHHHHHHHHHHSSCSSHHHHHHHHHHHHHTTS
T ss_pred             HHHHHHHhCCCHHHHHHHHHHHHhcCCC----CCCchHHHHHHHHHHHHHHHHHHHHHHCCChHHHHHHHHHHHHHHHHH
Confidence            7889999999999999999999999998    799999999999999999999999999999999999999999999999


Q ss_pred             ChhhhhhhhcccccCCCCcHHHHHHHHHhCC
Q psy16764         82 PSLVLEELFFRNIIGHNTTIKKTIWHMYKNA  112 (113)
Q Consensus        82 ~~~~~e~L~f~~~~g~~~~i~~Ll~eml~~~  112 (113)
                      ++.++|++||.+.+| +++|++||.||+++|
T Consensus       238 ~~~~~e~l~~~k~~g-~~~i~~Ll~Eml~a~  267 (268)
T 3f5c_B          238 NSDVVTELFFRPIIG-AVSMDDMMLEMLCAK  267 (268)
T ss_dssp             CSSHHHHHHTHHHHC-SCCHHHHHHHHTTSC
T ss_pred             HHHHHHHHhhhhhcC-CCCchHHHHHHHhCc
Confidence            999999999999999 999999999999987
>3p0u_A Nuclear receptor subfamily 2 group C member 2; ligand binding domain, orphan nuclear receptor, testicular R 4, signaling protein; 3.00A {Homo sapiens} Back     alignment and structure
>1fcy_A RAR-gamma-1, retinoic acid receptor gamma-1; isotype selectivity, retinoid ligand complexes, drug design, antiparallel alpha-helical sandwich fold; HET: 564 LMU; 1.30A {Homo sapiens} SCOP: a.123.1.1 PDB: 1fcz_A* 1fcx_A* 1fd0_A* 1exa_A* 1exx_A* 1dkf_B* Back     alignment and structure
>3plz_A FTZ-F1 related protein; alpha helical sandwhich, family five, TRAN factor, transcription-receptor-agonist comple; HET: 470; 1.75A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yok_A* 1yuc_A* 4dor_A* 1zdu_A* 4dos_A* 1zh7_A 1pk5_A 3f5c_A Back     alignment and structure
>3k6p_A Steroid hormone receptor ERR1; estrogen related receptor alpha, DNA-binding, isopeptide BON binding, nucleus, phosphoprotein, transcription; HET: 5FB; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xb7_A 2pjl_A* 3d24_A Back     alignment and structure
>3ltx_A Estrogen receptor; constitutive, nuclear receptor, DNA-binding, metal-binding, nucleus, transcription, transcription regulation, zinc-finger; 2.60A {Crassostrea gigas} Back     alignment and structure
>3vi8_A Peroxisome proliferator-activated receptor alpha; nuclear receptor, protein-ligand complex, PPAR, transcriptio; HET: 13M; 1.75A {Homo sapiens} PDB: 2znn_A* 3et1_A* 3kdu_A* 3kdt_A* 2rew_A* 1i7g_A* 3g8i_A* 1kkq_A* 1k7l_A* 3sp6_A* 2npa_A* 2p54_A* 3fei_A* 3tkm_A* 2znq_A* 2znp_A* 3sp9_A* 3gwx_A* 3dy6_A* 1gwx_A* ... Back     alignment and structure
>3kmr_A Retinoic acid receptor alpha; nuclear receptor transcription factor ligand binding domain, binding, metal-binding, nucleus, phosphoprotein; HET: EQN; 1.80A {Homo sapiens} PDB: 3kmz_B* 3a9e_B* 4dm6_A* 1xap_A* 4dm8_A* 2lbd_A* 3lbd_A* 4lbd_A* Back     alignment and structure
>2e2r_A Estrogen-related receptor gamma; ERR gamma, BPA, nuclear receptor, transcription; HET: 2OH; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 2zas_A* 2zbs_A 2zkc_A* 2p7g_A* 1vjb_A* 1tfc_A 2p7a_A* 2p7z_A* 2gpu_A* 1kv6_A 2gp7_A 2gpp_A* 2gpo_A* 2gpv_A* 1s9q_A* 1s9p_A* 2ewp_A* Back     alignment and structure
>3v3e_B Nuclear receptor subfamily 4 group A member 1; orphan nuclear receptor, transcription; 2.06A {Homo sapiens} PDB: 3v3q_A* 2qw4_A 1yje_A Back     alignment and structure
>3cjw_A COUP transcription factor 2; COUP-TFII, nuclear receptor, ligand binding domain, orphan receptor, three-layered helical sandwich, DNA-binding; 1.48A {Homo sapiens} Back     alignment and structure
>2nxx_A Ultraspiracle (USP, NR2B4); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Back     alignment and structure
>1ymt_A Steroidogenic factor 1; SF-1, ligand-binding domain, ligand, phosphatidyl glycerol, CO-repressor peptide, transcription; HET: DR9; 1.20A {Mus musculus} PDB: 3f7d_A* 1yp0_A* 1yow_A* 1zdt_A* Back     alignment and structure
>1g2n_A Ultraspiracle protein; antiparallel alpha-helical sandwich, structural proteomics in europe, spine, structural genomics, gene regulation; HET: EPH; 1.65A {Heliothis virescens} SCOP: a.123.1.1 PDB: 2r40_A* 1r20_A* 1r1k_A* 3ixp_A* Back     alignment and structure
>3ilz_A Thyroid hormone receptor, alpha isoform 1 variant; nuclear receptor, signaling protein; HET: B72; 1.85A {Homo sapiens} SCOP: a.123.1.1 PDB: 3jzb_A* 3hzf_A* 2h79_A* 2h77_A* 1nav_A* 3uvv_A* 1xzx_X* 1y0x_X* 1nq1_A* 3jzc_A* 1nuo_A* 3imy_A* 1nq0_A* 1bsx_A* 1r6g_A* 1nq2_A* 3gws_X* 1n46_A* 2h6w_X* 2j4a_A* ... Back     alignment and structure
>1hg4_A Ultraspiracle; nuclear hormone receptor, transcription factor, ligand binding; HET: LPP; 2.4A {Drosophila melanogaster} SCOP: a.123.1.1 Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Back     alignment and structure
>3u9q_A Peroxisome proliferator-activated receptor gamma; nuclear receptor, adipogenesis, RXRA, nucleus, transcription; HET: DKA; 1.52A {Homo sapiens} SCOP: a.123.1.1 PDB: 1i7i_A* 3ty0_A* 1zeo_A* 2p4y_A* 3et3_A* 3et0_A* 2hwq_A* 2ath_A* 2f4b_A* 2g0g_A* 2g0h_A* 2gtk_A* 2fvj_A* 2hwr_A* 2prg_A* 2q8s_A* 3fej_A* 3g9e_A* 3gbk_A* 3ia6_A* ... Back     alignment and structure
>1xdk_B RAR-beta, retinoic acid receptor, beta; nuclear receptor, coactivator, ligand, hormone/growth factor receptor complex; HET: REA; 2.90A {Mus musculus} SCOP: a.123.1.1 Back     alignment and structure
>1osh_A BIle acid receptor; nuclear receptor, ligand binding domain, transcription; HET: FEX; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 3l1b_A* 3bej_A* 3fli_A* 3hc5_A* 3rvf_A* 3dct_A* 3dcu_A* 3ruu_A* 3rut_A* 3olf_A* 3okh_A* 3fxv_A* 3oki_A* 3omk_A* 3omm_A* 3oof_A* 3ook_A* 3hc6_A* 3p89_A* 3p88_A* ... Back     alignment and structure
>3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A Back     alignment and structure
>3b0t_A Vitamin D3 receptor; nuclear receptor, transcription, gene regulation; HET: MCZ; 1.30A {Homo sapiens} PDB: 3a40_X* 1s0z_A* 1s19_A* 2ham_A* 2har_A* 2has_A* 1txi_A* 2hb8_A* 2hb7_A* 3a3z_X* 3a78_A* 3auq_A* 3aur_A* 3ax8_A* 3cs4_A* 3cs6_A* 1ie9_A* 1db1_A* 1ie8_A* 3kpz_A* ... Back     alignment and structure
>2p1t_A Retinoic acid receptor RXR-alpha; protein-ligand complex, hormone receptor; HET: 3TN; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 1mvc_A* 1mzn_A* 1mv9_A* 2p1u_A* 2p1v_A* 2zxz_A* 2zy0_A* 3fug_A* 3nsp_A 3nsq_A* 3r29_A 3r2a_A* 3r5m_A* 3e94_A* 3kwy_A* 1fby_A* 3uvv_B* 3fc6_A* 1rdt_A* 3fal_A* ... Back     alignment and structure
>3oll_A Estrogen receptor beta; steroid binding, phosphorylation, hormone receptor-activator; HET: PTR EST; 1.50A {Homo sapiens} SCOP: a.123.1.1 PDB: 1u3s_A* 1u3q_A* 1x78_A* 1x7b_A* 1x7j_A* 1x76_A* 2yjd_A* 3ols_A* 3omo_A* 3omp_A* 3omq_A* 1u3r_A* 1u9e_A* 1qkm_A* 2giu_A* 1nde_A* 2jj3_A* 2i0g_A* 2qtu_A* 2z4b_A* ... Back     alignment and structure
>2hc4_A Vitamin D receptor; alpha helical sandwich, gene regulation; HET: VDX; 2.20A {Danio rerio} PDB: 2hbh_A* 2hcd_A* 3dr1_A* 3o1d_A* 3o1e_A* Back     alignment and structure
>3ipq_A Oxysterols receptor LXR-alpha; LXR homodimer, LXR signaling, alternative DNA-binding, metal-binding, nucleus, polymorphism, receptor transcription; HET: 965; 2.00A {Homo sapiens} PDB: 3ips_A* 3ipu_A* 3fc6_B* 3fal_B* 1uhl_B* 2acl_B* 1upv_A* 1upw_A* 1p8d_A* 1pq9_A* 1pq6_A* 1pqc_A* 3kfc_A* 4dk7_A* 4dk8_A* 3l0e_A* Back     alignment and structure
>1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A Back     alignment and structure
>1nq7_A Nuclear receptor ROR-beta; ligand-binding domain, retinoids, retinoic acid, synthetic ligand, antagonist, transcription; HET: ARL; 1.50A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1k4w_A* 1n4h_A* Back     alignment and structure
>1xvp_B Orphan nuclear receptor NR1I3; CAR, RXR, citco, SRC1, DNA binding protein; HET: F15 CID; 2.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xv9_B* 1xnx_A* 1xls_E* Back     alignment and structure
>1pdu_A DHR38, nuclear hormone receptor HR38; nuclear receptor, ligand-binding domain, hormone/growth factor receptor complex; 2.30A {Drosophila melanogaster} SCOP: a.123.1.1 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Back     alignment and structure
>1nrl_A Orphan nuclear receptor PXR; PXR, xenobiotic, SRC-1, ligand binding domain, transcription; HET: SRL; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1ilh_A* 1ilg_A* 1m13_A* 2qnv_A* 3r8d_A* 3ctb_A 3ctc_A 3hvl_A* 1skx_A* 2o9i_A* Back     alignment and structure
>2o4j_A Vitamin D3 receptor; nuclear receptor-ligand complex, hormone/growth factor receptor complex; HET: VD4; 1.74A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1rk3_A* 1rjk_A* 1rkh_A* 1rkg_A* 2o4r_A* Back     alignment and structure
>1n83_A Nuclear receptor ROR-alpha; three-layered alpha helical sandwich, transcription regulation, nuclear protein, DNA binding, lipid binding protein; HET: CLR; 1.63A {Homo sapiens} SCOP: a.123.1.1 PDB: 1s0x_A* Back     alignment and structure
>1xpc_A Estrogen receptor; nuclear receptor, transcription factor, ER-alpha, antagonist hormone-growth factor receptor complex; HET: AIT; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1sj0_A* 1xp1_A* 1xp9_A* 1xp6_A* 1yim_A* 1yin_A* 3ert_A* 1r5k_A* 3erd_A* 1l2i_A* 2iok_A* 1a52_A* 2ouz_A* 1ere_A* 1err_A* 2qxs_A* 3q95_A* 3q97_A* 2b1z_A* 1zky_A* ... Back     alignment and structure
>2r40_D Ecdysone receptor, 20-hydroxy-ecdysone receptor; nuclear receptor ligand-binding domain, anti-parallel alpha- sandwich, ecdysone receptor, ECR, gene regulation; HET: FLC 20E EPH; 2.40A {Heliothis virescens} SCOP: a.123.1.1 PDB: 1r1k_D* 3ixp_D* 1r20_D* Back     alignment and structure
>1yye_A ER-beta, estrogen receptor beta; ER-beta, nuclear receptor, transcription factor, agonist; HET: 196; 2.03A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yy4_A* Back     alignment and structure
>1l2j_A Estrogen receptor beta; nuclear receptor, transcription factor, antagonist transcription receptor; HET: ETC; 2.95A {Homo sapiens} SCOP: a.123.1.1 Back     alignment and structure
>2ocf_A Estrogen receptor; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>3up3_A Acedaf-12; ligand binding domain, nematode, steroid binding protein- transcription complex; HET: XCA; 1.25A {Ancylostoma ceylanicum} PDB: 3up0_A* Back     alignment and structure
>2nxx_E Ecdysone receptor (ECR, NRH1); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Back     alignment and structure
>3l0l_A Nuclear receptor ROR-gamma; nuclear receptor, rorgamma, alternative splicing, DNA-bindin binding, nucleus, receptor, zinc-finger, acetylation, activator; HET: HC3; 1.74A {Homo sapiens} SCOP: a.123.1.0 PDB: 3b0w_A* 3kyt_A* 3l0j_A* Back     alignment and structure
>1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 Back     alignment and structure
>1pzl_A Hepatocyte nuclear factor 4-alpha; transcription; HET: MYR; 2.10A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fs1_A* 1m7w_A* 1lv2_A* Back     alignment and structure
>3cqv_A Nuclear receptor subfamily 1 group D member 2; reverb beta, heme, NR1D2, DNA-binding, metal-binding, nucleus, repressor, transcription; HET: HEM; 1.90A {Homo sapiens} PDB: 2v7c_A 2v0v_A Back     alignment and structure
>3vhv_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, non-steroidal antagonist; HET: LD1 LD2; 1.35A {Homo sapiens} SCOP: a.123.1.1 PDB: 2aax_A* 2aa6_A* 2ab2_A* 2aa2_A* 2aa5_A* 2aa7_A* 2a3i_A* 1y9r_A* 1ya3_A* 2oax_A* 2abi_A* 2q1h_A* 2q1v_A* 2q3y_A* 3ry9_A* 4fne_A* 4fn9_A* Back     alignment and structure
>1z5x_E Ecdysone receptor ligand binding domain; ponasterone A, nuclear receptor, ECR, USP, hormone/growth factor receptor complex; HET: P1A; 3.07A {Bemisia tabaci} Back     alignment and structure
>3n00_A REV-ERBA-alpha; reverba ncorid1, anti-parallel B-sheet, transcription regula; 2.60A {Homo sapiens} Back     alignment and structure
>1t7r_A Androgen receptor; nuclear receptor, transcription factor, ligand binding domain, AF-2, androgen, testosterone, DHT, alpha-helical sandwich; HET: DHT; 1.40A {Pan troglodytes} SCOP: a.123.1.1 PDB: 1t73_A* 1t76_A* 1t74_A* 1t79_A* 1t7m_A* 1t7f_A* 1t7t_A* 2am9_A* 2ama_A* 2amb_A* 2pnu_A* 1e3g_A* 2q7i_A* 1xj7_A* 2q7j_A* 3g0w_A* 2ihq_A* 2nw4_A* 1i37_A* 2q7k_A* ... Back     alignment and structure
>3vhu_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, antagonist, spironolactone; HET: SNL; 2.11A {Homo sapiens} Back     alignment and structure
>1sqn_A PR, progesterone receptor; nuclear receptor, steroid receptor, norethindrone, birth control, hormone/growth factor receptior complex; HET: NDR; 1.45A {Homo sapiens} SCOP: a.123.1.1 PDB: 3g8o_A* 3g8n_A* 3d90_A* 1e3k_A* 1sr7_A* 1zuc_B* 3zr7_A* 2w8y_A* 3zra_A* 3zrb_A* 4a2j_A* 4apu_A* 1a28_A* 2ovh_A* 2ovm_A* 3hq5_A* 3kba_A* Back     alignment and structure
>3gyt_A Nuclear hormone receptor of the steroid/thyroid hormone receptors superfamily; nuclear receptor, ligand binding domain, dafachronic acid, nematode, DNA-binding, metal-binding, nucleus, receptor; HET: DL4; 2.40A {Strongyloides stercoralis} PDB: 3gyu_A* Back     alignment and structure
>3mnp_A Glucocorticoid receptor; protein-ligand complex, steroid nuclear receptor, mouse GR, hormone receptor; HET: DEX; 1.50A {Mus musculus} SCOP: a.123.1.1 PDB: 3mno_A* 3mne_A* 1m2z_A* 3k22_A* 3cld_A* 3k23_A* 3e7c_A* 1nhz_A* 1p93_A* 3bqd_A* 3h52_A* 3gn8_A* 4e2j_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 113
d1g2na_256 a.123.1.1 (A:) Ultraspiracle protein, usp {Helioth 3e-11
d1hg4a_265 a.123.1.1 (A:) Ultraspiracle protein, usp {Drosoph 7e-10
d2p1ta1230 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (R 1e-09
d1pk5a_242 a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH- 2e-09
d1pzla_233 a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha { 2e-08
d1fcya_236 a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-g 3e-08
d2e2ra1223 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 3e-08
d2fvja1271 a.123.1.1 (A:207-477) Peroxisome proliferator acti 3e-07
d1xpca_245 a.123.1.1 (A:) Estrogen receptor alpha {Human (Hom 4e-07
d1pq9a_239 a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human 5e-07
d1osha_231 a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo 5e-07
d2p54a1267 a.123.1.1 (A:202-468) Peroxisome proliferator acti 7e-07
d1n46a_251 a.123.1.1 (A:) Thyroid hormone receptor beta (TR-b 1e-06
d1ovla_236 a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Huma 4e-06
d1pdua_230 a.123.1.1 (A:) Nuclear hormone receptor HR38 {Frui 4e-06
d2qw4a1233 a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 5e-06
d2b50b1265 a.123.1.1 (B:211-475) Peroxisome proliferator-acti 5e-06
d2j7ya1236 a.123.1.1 (A:217-452) Estrogen receptor beta {Rat 6e-06
d3d24a1227 a.123.1.1 (A:194-420) Steroid hormone receptor ERR 7e-06
d1sqna_251 a.123.1.1 (A:) Progesterone receptor {Human (Homo 5e-05
d1nrla_292 a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Ho 2e-04
d1n83a_251 a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha { 2e-04
d1nq7a_244 a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {R 4e-04
d1t7ra_250 a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan 4e-04
d1xvpb_246 a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) 6e-04
d2r40d1243 a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid m 0.002
d1ie9a_255 a.123.1.1 (A:) Vitamin D nuclear receptor {Human ( 0.002
d1nhza_247 a.123.1.1 (A:) Glucocorticoid receptor {Human (Hom 0.002
>d1g2na_ a.123.1.1 (A:) Ultraspiracle protein, usp {Heliothis virescens [TaxId: 7102]} Length = 256 Back     information, alignment and structure

class: All alpha proteins
fold: Nuclear receptor ligand-binding domain
superfamily: Nuclear receptor ligand-binding domain
family: Nuclear receptor ligand-binding domain
domain: Ultraspiracle protein, usp
species: Heliothis virescens [TaxId: 7102]

 Score = 55.9 bits (134), Expect = 3e-11
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 1/67 (1%)

Query: 45  IQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFFRNIIGHNTTIKKT 104
           ++    + L++Y      S+  RF  + L LP L+SI     E LFF +++  +T+I   
Sbjct: 189 LREKMFLCLDEYCRRSRSSEEGRFAALLLRLPALRSISLKSFEHLFFFHLVA-DTSIAGY 247

Query: 105 IWHMYKN 111
           I    +N
Sbjct: 248 IRDALRN 254
>d1hg4a_ a.123.1.1 (A:) Ultraspiracle protein, usp {Drosophila melanogaster [TaxId: 7227]} Length = 265 Back     information, alignment and structure
>d2p1ta1 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]} Length = 230 Back     information, alignment and structure
>d1pk5a_ a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d1pzla_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 233 Back     information, alignment and structure
>d1fcya_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure
>d2e2ra1 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d2fvja1 a.123.1.1 (A:207-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1xpca_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d1pq9a_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]} Length = 239 Back     information, alignment and structure
>d1osha_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]} Length = 231 Back     information, alignment and structure
>d2p54a1 a.123.1.1 (A:202-468) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 267 Back     information, alignment and structure
>d1n46a_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1ovla_ a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure
>d1pdua_ a.123.1.1 (A:) Nuclear hormone receptor HR38 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 230 Back     information, alignment and structure
>d2qw4a1 a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]} Length = 233 Back     information, alignment and structure
>d2b50b1 a.123.1.1 (B:211-475) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]} Length = 265 Back     information, alignment and structure
>d2j7ya1 a.123.1.1 (A:217-452) Estrogen receptor beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 Back     information, alignment and structure
>d3d24a1 a.123.1.1 (A:194-420) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 227 Back     information, alignment and structure
>d1sqna_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1nrla_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1n83a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1nq7a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 244 Back     information, alignment and structure
>d1t7ra_ a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan troglodytes) [TaxId: 9598]} Length = 250 Back     information, alignment and structure
>d1xvpb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens) [TaxId: 9606]} Length = 246 Back     information, alignment and structure
>d2r40d1 a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid moth (Heliothis virescens) [TaxId: 7102]} Length = 243 Back     information, alignment and structure
>d1ie9a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 255 Back     information, alignment and structure
>d1nhza_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 247 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query113
d1g2na_256 Ultraspiracle protein, usp {Heliothis virescens [T 99.97
d1hg4a_265 Ultraspiracle protein, usp {Drosophila melanogaste 99.96
d1pk5a_242 Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus 99.96
d2e2ra1223 Orphan nuclear receptor ERR3 {Human (Homo sapiens) 99.96
d1fcya_236 Retinoic acid receptor gamma (RAR-gamma) {Human (H 99.95
d1pzla_233 Hepatocyte nuclear factor 4-alpha {Human (Homo sap 99.95
d1osha_231 Bile acid receptor FXR {Human (Homo sapiens) [TaxI 99.95
d1pq9a_239 Oxysterols receptor LXR-beta {Human (Homo sapiens) 99.95
d3d24a1227 Steroid hormone receptor ERR1 {Human (Homo sapiens 99.95
d1n46a_251 Thyroid hormone receptor beta (TR-beta) {Human (Ho 99.94
d2p1ta1230 Retinoid-X receptor alpha (RXR-alpha) {Human (Homo 99.94
d1ovla_236 Orphan nuclear receptor NURR1 {Human (Homo sapiens 99.94
d1xvpb_246 Orphan nuclear receptor NR1I3 (CAR) {Human (Homo s 99.94
d2fvja1271 Peroxisome proliferator activated receptor gamma, 99.94
d2p54a1267 Peroxisome proliferator activated receptor alpha, 99.93
d2qw4a1233 Orphan nuclear receptor NR4A1 {Human (Homo sapiens 99.93
d1pdua_230 Nuclear hormone receptor HR38 {Fruit fly (Drosophi 99.93
d1xpca_245 Estrogen receptor alpha {Human (Homo sapiens) [Tax 99.93
d2b50b1265 Peroxisome proliferator-activated receptor delta, 99.93
d1ie9a_255 Vitamin D nuclear receptor {Human (Homo sapiens) [ 99.93
d2j7ya1236 Estrogen receptor beta {Rat (Rattus norvegicus) [T 99.92
d1nrla_292 Pregnane x receptor, PXR {Human (Homo sapiens) [Ta 99.92
d2r40d1243 Ecdysone receptor {Noctuid moth (Heliothis viresce 99.92
d1n83a_251 Orphan nuclear receptor ROR-alpha {Human (Homo sap 99.91
d1nq7a_244 Orphan nuclear receptor ROR-beta {Rat (Rattus norv 99.91
d1t7ra_250 Androgen receptor {Chimpanzee (Pan troglodytes) [T 99.91
d1nhza_247 Glucocorticoid receptor {Human (Homo sapiens) [Tax 99.9
d1xnxa_232 Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus mu 99.89
d1sqna_251 Progesterone receptor {Human (Homo sapiens) [TaxId 99.89
>d1g2na_ a.123.1.1 (A:) Ultraspiracle protein, usp {Heliothis virescens [TaxId: 7102]} Back     information, alignment and structure
class: All alpha proteins
fold: Nuclear receptor ligand-binding domain
superfamily: Nuclear receptor ligand-binding domain
family: Nuclear receptor ligand-binding domain
domain: Ultraspiracle protein, usp
species: Heliothis virescens [TaxId: 7102]

Probab=99.97  E-value=3e-31  Score=192.15  Aligned_cols=106  Identities=22%  Similarity=0.309  Sum_probs=102.8

Q ss_pred             hHHhhccccCCHHHHHHHHHHHhhcCCCCCcccCCCChhHHHHHHHHHHHHHHHHHHhhCCCcchHHHHHHHhchhhhcC
Q psy16764          2 FQTELTMLRIVTEENSNLEIRNAYTSRRGSRVRFKTGSKFTAAIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSI   81 (113)
Q Consensus         2 f~~~l~~L~ld~~E~~~Lkai~l~~~~~g~~~~~l~~~~~Ve~lqe~~~~aL~~~~~~~~p~~~~Rf~kLLl~Lp~Lr~l   81 (113)
                      |..+|++|++|.+||+|||||++|+||+    +|+.+..+|+++|++++.+|++|+..+||++|.||++||++||+||++
T Consensus       150 l~~~~~~L~ld~~E~~~LkaIvLfnpd~----~gL~~~~~Ie~lqe~~~~aL~~y~~~~~p~~~~Rf~~LLl~Lp~LR~l  225 (256)
T d1g2na_         150 LSLKMRTLRVDQAEYVALKAIILLNPDV----KGLKNRQEVEVLREKMFLCLDEYCRRSRSSEEGRFAALLLRLPALRSI  225 (256)
T ss_dssp             THHHHHHTTCCHHHHHHHHHHHHSCTTC----TTCSCHHHHHHHHHHHHHHHHHHHHHHSTTCTTHHHHHHTHHHHHHHH
T ss_pred             HHHHHHHcCCCHHHHHHHHHHHHhcCcc----CCcccHHHHHHHHHHHHHHHHHHHHhcCCChhhHHHHHHHHHHHHHHH
Confidence            5678999999999999999999999998    799999999999999999999999999999999999999999999999


Q ss_pred             ChhhhhhhhcccccCCCCcHHHHHHHHHhCC
Q psy16764         82 PSLVLEELFFRNIIGHNTTIKKTIWHMYKNA  112 (113)
Q Consensus        82 ~~~~~e~L~f~~~~g~~~~i~~Ll~eml~~~  112 (113)
                      +++++|++||.+++| +++|++++.|||++.
T Consensus       226 ~~~~~e~lff~~l~g-~~~i~~ll~eml~~~  255 (256)
T d1g2na_         226 SLKSFEHLFFFHLVA-DTSIAGYIRDALRNH  255 (256)
T ss_dssp             HHHHHHHHHHTTCBC-TTTHHHHHHHHHTCC
T ss_pred             HHHHHHHHhcccccC-CCChHHHHHHHHhcc
Confidence            999999999999999 999999999999864
>d1hg4a_ a.123.1.1 (A:) Ultraspiracle protein, usp {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1pk5a_ a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2e2ra1 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcya_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzla_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osha_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pq9a_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d24a1 a.123.1.1 (A:194-420) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n46a_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p1ta1 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ovla_ a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvpb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fvja1 a.123.1.1 (A:207-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p54a1 a.123.1.1 (A:202-468) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qw4a1 a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pdua_ a.123.1.1 (A:) Nuclear hormone receptor HR38 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xpca_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b50b1 a.123.1.1 (B:211-475) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ie9a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ya1 a.123.1.1 (A:217-452) Estrogen receptor beta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nrla_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r40d1 a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid moth (Heliothis virescens) [TaxId: 7102]} Back     information, alignment and structure
>d1n83a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nq7a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t7ra_ a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan troglodytes) [TaxId: 9598]} Back     information, alignment and structure
>d1nhza_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnxa_ a.123.1.1 (A:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sqna_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure