Psyllid ID: psy16975


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------73
MARDHHFGVWLIEEFLIGLASGSHIKVPGVEMIPVEAFRLVPHSSGSYIVVDGEVLDYGPIQAEIFPGLIERTVTTEYLPPQNRKEERQGRRKPAVPRTNMCLEKTSPPGGNQTPRPNAYKAGALPTILTRKHAVILCSDGKNETFQGSGSQVSKRSKVSDLSSETETLKPSGPLRNEADLSWEVSVSVQQVTQTDEKVTPNLEIKQLNVQVTKVNPKSQTNATQNGDKKGLFFIPTQSCPANPKVMGSNHKVAILGAGIIGLSTALELQRRFPNCDVTVIADKFNMDTTSDGAAGLFEPSPNFMGPDLETTKEWIRYSYDHYAGLLSENCGVQVINGYNLAKSEKQCAENHYLKPVLPVYKRMSEEELAEIGPGDWKYGIYMSTLVIPNRIFLPWCMQKDGPSNLGERPSTLSVELYHYNRDSLTVVRGPLHEKVSSGPRTCAMQRAMQHDHYAGLLSENCGVQVINGYNLAKSEKQCAENHYLKPVLPVYKRMSEEELAEIGPGDWKYGIYMSTLVIPNRIFLPWCMQKNFASLVRLAGAYIIPSYGGLVTLGGTQDYGNARLGVDRFDSRAILNRTAAVRPEILAAPVEKVWVGLRPYRHHVRVERDLTGAAQYLTWYPVFKVYGITSVLFVHRFKAAGGKVIEKYISSFSELGSEYNTIFNCTGLGARTLCNDMHVIPVRGQTIRIVHNYGHGGYGVTSAPGSARCAVSVFEQSHKASYNGAPT
cccccccHHHHHHHHHHccccccccccccEEEEEEEEEEEEEcccccEEEEcccccccccEEEEEEcccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccEEEEEcccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEEccccccccEEEEccEEEEEEcccccccccccccccccEEccccccccccccccccccEEEEcccHHHHHHHHHHHHccccccEEEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEcccccHHHccccccccccccccccHHHHHHcccccccEEEEEEEEccccccccHHHHHcccccccccccccccEEEEEEEccccccccccccccccccccEEEccccccccccccccccccccEEEEEEcccccccccccccEEEEccccEEcccHHHHHHcccccccccEEEEEEEEccccccccEEEcccccccccccEEEEcccccEEEEEEEEEcccccccccHHHHHHHHHHHHHcccccccccEEEEEccccccccccccccccccccccEEEEEEEEEcccEEEEEEHHHHccccEEEEEEEcccccccccccEEEEccccccccccccccEEEEcccEEEEEcccEEcccEEEEEcccccEEEEEEEEccccccccccc
cccccHHHHHHHHHHHHHcccccccEcccEEEEEEEEEEEcccccccEEEEcccEEcccccHHEEccccEEEcccccccccccHHHHHccccccccccccccccccccccccccccccHHHccccccEEccccEEEEEcccccccEcccccccccccccccHHHHHcccccccccEEEEccccEEEEEEcEEEcccccccccHHHHcccEEEEEEccccccccccccccccEEEEccccccccccccccccEEEEEcccHHHHHHHHHHHHHccccEEEEEEcccccccHHHHcccEcccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEccEEEcccccccccccHHHHHHHcHccccHHHHHHHccccccEEEEEEEEEEccHHHHHHHHHHHHHccHHHHHHHcccEEEEEEEccHHHHcccccHHHccccccEEEEcccccccccccccccccccccHHHHcccccccccccEEEEEEcccEEEEEEcccccEEcccccccccccEEEEccccccccccEEEcccccccccEEEEEccccEEEEEcccccccccccccHHHHHHHHHHHHHHcHHHccccEEHEEccccccccccEEEEEEccccccccEEEEEEEccccccHHHHHccccccEEEEEEcccHHHHHccccEEEEccccccHHccccccEEccccEEEEEEEEcccccccEEEcccccEEEEEEcccccccccccccc
MARDHHFGVWLIEEFLIGLasgshikvpgvemipveafrlvphssgsyivvdgevldygpiqaeifpgliertvtteylppqnrkeerqgrrkpavprtnmclektsppggnqtprpnaykagalptiltRKHAVILcsdgknetfqgsgsqvskrskvsdlssetetlkpsgplrneadlswEVSVSVQQVtqtdekvtpnleikQLNVqvtkvnpksqtnatqngdkkglffiptqscpanpkvmgsnhKVAILGAGIIGLSTALELqrrfpncdvtviadkfnmdttsdgaaglfepspnfmgpdlettKEWIRYSYDHYAGllsencgvqvinGYNLAksekqcaenhylkpvlpvykrmseeelaeigpgdwkygIYMStlvipnriflpwcmqkdgpsnlgerpstlsVELYhynrdsltvvrgplhekvssgprtCAMQRAMQHDHyagllsencgvqvinGYNLAksekqcaenhylkpvlpvykrmseeelaeigpgdwkygIYMStlvipnriflpwcmQKNFASLVRLAGAyiipsygglvtlggtqdygnarlgvdrfdsraiLNRTAAVRPEILAAPVEKvwvglrpyrhhvrVERDLTGAAQYLTWYPVFKVYGITSVLFVHRFKAAGGKVIEKYISSFSELGseyntifnctglgartlcndmhvipvrgqTIRIvhnyghggygvtsapgsarCAVSVFEQshkasyngapt
MARDHHFGVWLIEEFLIGLASGSHIKVPGVEMIPVEAFRLVPHSSGSYIVVDGEVLDYGPIQAEIfpgliertvtteylppqnrkeerqgrrkpavprtnmclektsppggnqtprpnAYKAGALPTILTRKHAVILCSDGknetfqgsgsqvskrskvsdlssetetlkpsgplrneadlSWEVSVSVQQVTqtdekvtpnleikqlnvqvtkvnpksqtnatqngdkkgLFFIPTQSCPANPKVMGSNHKVAILGAGIIGLSTALELQRRFPNCDVTVIADKFNMDTTSDGAAGLFEPSPNFMGPDLETTKEWIRYSYDHYAGLLSENCGVQVINGYNLAKSEKQCAENHYLKPVLPVYKRMSEEELAEIGPGDWKYGIYMSTLVIPNRIFLPWCMQKDGPSNLGERPSTLSVELYHYNRDSLTVVRGPLHEKVSSGPRTCAMQRAMQHDHYAGLLSENCGVQVINGYNLAKSEKQCAENHYLKPVLPVYKRMSEEELAEIGPGDWKYGIYMSTLVIPNRIFLPWCMQKNFASLVRLAGAYIIPSYGGLVTLGGTQDYGNARLGVDRFDSRAILNrtaavrpeilaapvekvwvgLRPYRHHVRVERDLTGAAQYLTWYPVFKVYGITSVLFVHRFKAAGGKVIEKYISSFSELGSEYNTIFNCTGLGARTLCNDMHVIPVRGQTIRIVHNYGHGGYGVTSAPGSARCAVSVFEQshkasyngapt
MARDHHFGVWLIEEFLIGLASGSHIKVPGVEMIPVEAFRLVPHSSGSYIVVDGEVLDYGPIQAEIFPGLIERTVTTEYLPPQNRKEERQGRRKPAVPRTNMCLEKTSPPGGNQTPRPNAYKAGALPTILTRKHAVILCSDGKNETFQGSGSQVSKRSKVSDLSSETETLKPSGPLRNEADLSWEvsvsvqqvtqtDEKVTPNLEIKQLNVQVTKVNPKSQTNATQNGDKKGLFFIPTQSCPANPKVMGSNHKVAILGAGIIGLSTALELQRRFPNCDVTVIADKFNMDTTSDGAAGLFEPSPNFMGPDLETTKEWIRYSYDHYAGLLSENCGVQVINGYNLAKSEKQCAENHYLKPVLPVYKRMSEEELAEIGPGDWKYGIYMSTLVIPNRIFLPWCMQKDGPSNLGERPSTLSVELYHYNRDSLTVVRGPLHEKVSSGPRTCAMQRAMQHDHYAGLLSENCGVQVINGYNLAKSEKQCAENHYLKPVLPVYKRMSEEELAEIGPGDWKYGIYMSTLVIPNRIFLPWCMQKNFASLVRLAGAYIIPSYGGLVTLGGTQDYGNARLGVDRFDSRAILNRTAAVRPEILAAPVEKVWVGLRPYRHHVRVERDLTGAAQYLTWYPVFKVYGITSVLFVHRFKAAGGKVIEKYISSFSELGSEYNTIFNCTGLGARTLCNDMHVIPVRGQTIRIVHNYGHGGYGVTSAPGSARCAVSVFEQSHKASYNGAPT
*****HFGVWLIEEFLIGLASGSHIKVPGVEMIPVEAFRLVPHSSGSYIVVDGEVLDYGPIQAEIFPGLIERTVTTEY*******************************************AGALPTILTRKHAVILCS*******************************************************************************************GLFFIPTQSCPANPKVMGSNHKVAILGAGIIGLSTALELQRRFPNCDVTVIADKFNMDTTSDGAAGLFE***NFMGPDLETTKEWIRYSYDHYAGLLSENCGVQVINGYNLAKSEKQCAENHYLKPVLPVYKRMSEEELAEIGPGDWKYGIYMSTLVIPNRIFLPWCMQK************LSVELYHYNRDSLTVVRGPLH********TCAMQRAMQHDHYAGLLSENCGVQVINGYNLAKSEKQCAENHYLKPVLPVYKRMSEEELAEIGPGDWKYGIYMSTLVIPNRIFLPWCMQKNFASLVRLAGAYIIPSYGGLVTLGGTQDYGNARLGVDRFDSRAILNRTAAVRPEILAAPVEKVWVGLRPYRHHVRVERDLTGAAQYLTWYPVFKVYGITSVLFVHRFKAAGGKVIEKYISSFSELGSEYNTIFNCTGLGARTLCNDMHVIPVRGQTIRIVHNYGHGGYGVTSAPGSARCAVSVF*************
********VWLIEEFLIGLASGSHIKVPGVEMIPVEAFRLVPHSSGSYIVVDGEVLDYGPIQAEIFPGLIERTV**********************************************KAGALPTILTRKHAVILCSDGK**************************LKPSGPLRNEADLSWEVSVSVQQVTQTDEKVTPNLEIKQLNVQVTKVN***********DKKGLFFIPTQS************KVAILGAGIIGLSTALELQRRFPNCDVTVIADKFNMDTTSDGAAGLFEPSPNFMGPDLETTKEWIRYSYDHYAGLLSENCGVQVINGYNLAKSEKQCAENHYLKPVLPVYKRMSEEELAEIGPGDWKYGIYMSTLVIPNRIFLPWCMQKDGPSNLGERPSTLSVELYHYNRDSLTVVRGPLHEKVSSGPRTCAMQRAMQHDHYAGLLSENCGVQVINGYNLAKSEKQCAENHYLKPVLPVYKRMSEEELAEIGPGDWKYGIYMSTLVIPNRIFLPWCMQKNFASLVRLAGAYIIPSYGGLVTLGGTQDYGNARLGVDRFDSRAILNRTAAVRPEILAAPVEKVWVGLRPYRHHVRVERDLTGAAQYLTWYPVFKVYGITSVLFVHRFKAAGGKVIEKYISSFSELGSEYNTIFNCTGLGARTLCNDMHVIPVRGQTIRIVHNYGHGGYGVTSAPGSARCAVSVFEQSHKASYNG***
MARDHHFGVWLIEEFLIGLASGSHIKVPGVEMIPVEAFRLVPHSSGSYIVVDGEVLDYGPIQAEIFPGLIERTVTTEYLPP***************PRTNMCLEKTSPPGGNQTPRPNAYKAGALPTILTRKHAVILCSDGKNE***************************SGPLRNEADLSWEVSVSVQQVTQTDEKVTPNLEIKQLNVQVTKVNPKSQTNATQNGDKKGLFFIPTQSCPANPKVMGSNHKVAILGAGIIGLSTALELQRRFPNCDVTVIADKFNMDTTSDGAAGLFEPSPNFMGPDLETTKEWIRYSYDHYAGLLSENCGVQVINGYNLAKSEKQCAENHYLKPVLPVYKRMSEEELAEIGPGDWKYGIYMSTLVIPNRIFLPWCMQKDGPSNLGERPSTLSVELYHYNRDSLTVVRGPLHEKVSSGPRTCAMQRAMQHDHYAGLLSENCGVQVINGYNLAKSEKQCAENHYLKPVLPVYKRMSEEELAEIGPGDWKYGIYMSTLVIPNRIFLPWCMQKNFASLVRLAGAYIIPSYGGLVTLGGTQDYGNARLGVDRFDSRAILNRTAAVRPEILAAPVEKVWVGLRPYRHHVRVERDLTGAAQYLTWYPVFKVYGITSVLFVHRFKAAGGKVIEKYISSFSELGSEYNTIFNCTGLGARTLCNDMHVIPVRGQTIRIVHNYGHGGYGVTSAPGSARCAVSVFEQS**********
****HHFGVWLIEEFLIGLASGSHIKVPGVEMIPVEAFRLVPHSSGSYIVVDGEVLDYGPIQAEIFPGLIERTVTTEYLPPQN***************************GNQTPRPNAYKAGALPTILTRKHAVILCSD***************************TLKPSGPLRNEADLSWEVSVSVQQVTQTDEKVTPNLEIKQLNVQVTKVNPKSQTNATQNGDKKGLFFIPTQSCPANPKVMGSNHKVAILGAGIIGLSTALELQRRFPNCDVTVIADKFNMDTTSDGAAGLFEPSPNFMGPDLETTKEWIRYSYDHYAGLLSENCGVQVINGYNLAKSEKQCAENHYLKPVLPVYKRMSEEELAEIGPGDWKYGIYMSTLVIPNRIFLPWCMQKDGPSNLGERPSTLSVELYHYNRDSLTVVRGPLHEKVSSGPRTCAMQRAMQHDHYAGLLSENCGVQVINGYNLAKSEKQCAENHYLKPVLPVYKRMSEEELAEIGPGDWKYGIYMSTLVIPNRIFLPWCMQKNFASLVRLAGAYIIPSYGGLVTLGGTQDYGNARLGVDRFDSRAILNRTAAVRPEILAAPVEKVWVGLRPYRHHVRVERDLTGAAQYLTWYPVFKVYGITSVLFVHRFKAAGGKVIEKYISSFSELGSEYNTIFNCTGLGARTLCNDMHVIPVRGQTIRIVHNYGHGGYGVTSAPGSARCAVSVFEQSHK*SY*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARDHHFGVWLIEEFLIGLASGSHIKVPGVEMIPVEAFRLVPHSSGSYIVVDGEVLDYGPIQAEIFPGLIERTVTTEYLPPQNRKEERQGRRKPAVPRTNMCLEKTSPPGGNQTPRPNAYKAGALPTILTRKHAVILCSDGKNETFQGSGSQVSKRSKVSDLSSETETLKPSGPLRNEADLSWEVSVSVQQVTQTDEKVTPNLEIKQLNVQVTKVNPKSQTNATQNGDKKGLFFIPTQSCPANPKVMGSNHKVAILGAGIIGLSTALELQRRFPNCDVTVIADKFNMDTTSDGAAGLFEPSPNFMGPDLETTKEWIRYSYDHYAGLLSENCGVQVINGYNLAKSEKQCAENHYLKPVLPVYKRMSEEELAEIGPGDWKYGIYMSTLVIPNRIFLPWCMQKDGPSNLGERPSTLSVELYHYNRDSLTVVRGPLHEKVSSGPRTCAMQRAMQHDHYAGLLSENCGVQVINGYNLAKSEKQCAENHYLKPVLPVYKRMSEEELAEIGPGDWKYGIYMSTLVIPNRIFLPWCMQKNFASLVRLAGAYIIPSYGGLVTLGGTQDYGNARLGVDRFDSRAILNRTAAVRPEILAAPVEKVWVGLRPYRHHVRVERDLTGAAQYLTWYPVFKVYGITSVLFVHRFKAAGGKVIEKYISSFSELGSEYNTIFNCTGLGARTLCNDMHVIPVRGQTIRIVHNYGHGGYGVTSAPGSARCAVSVFEQSHKASYNGAPT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query728 2.2.26 [Sep-21-2011]
P31228341 D-aspartate oxidase OS=Bo yes N/A 0.199 0.425 0.307 2e-16
Q99489341 D-aspartate oxidase OS=Ho yes N/A 0.199 0.425 0.307 6e-16
Q9Z302346 D-amino-acid oxidase OS=C yes N/A 0.390 0.820 0.249 5e-15
Q922Z0341 D-aspartate oxidase OS=Mu yes N/A 0.197 0.422 0.315 1e-14
P18894345 D-amino-acid oxidase OS=M no N/A 0.390 0.823 0.251 2e-14
O35078346 D-amino-acid oxidase OS=R no N/A 0.390 0.820 0.256 2e-14
Q95XG9322 D-amino-acid oxidase 2 OS yes N/A 0.196 0.444 0.331 1e-13
A3KCL7341 D-aspartate oxidase OS=Su yes N/A 0.199 0.425 0.294 2e-13
Q9Z1M5347 D-amino-acid oxidase OS=C no N/A 0.391 0.821 0.247 3e-13
P00371347 D-amino-acid oxidase OS=S no N/A 0.391 0.821 0.247 8e-13
>sp|P31228|OXDD_BOVIN D-aspartate oxidase OS=Bos taurus GN=DDO PE=1 SV=2 Back     alignment and function desciption
 Score = 88.2 bits (217), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/153 (30%), Positives = 90/153 (58%), Gaps = 8/153 (5%)

Query: 252 KVAILGAGIIGLSTALELQRRFPNCDVTVIADKFNMDTTSDGAAGLFEPSPNFMGPDLET 311
           ++A++GAG++GLSTA+ + +  P C +TVI+DKF  +TTSD AAG+  P P +    ++ 
Sbjct: 5   RIAVVGAGVMGLSTAVCISKMVPGCSITVISDKFTPETTSDVAAGMLIP-PTYPDTPIQK 63

Query: 312 TKEWIRYSYDHYAGLL----SENCGVQVINGYNLAKSEKQCAENHYLKPVLPVYKRMSEE 367
            K+W + ++DH   ++    +E+ GV +++G+ + +S     E  Y   V+  +++M+++
Sbjct: 64  QKQWFKETFDHLFAIVNSAEAEDAGVILVSGWQIFQS-IPTEEVPYWADVVLGFRKMTKD 122

Query: 368 ELAEIGPGDWKYGIYMSTLVIPNRIFLPWCMQK 400
           EL +       +G   +TL      +LPW  ++
Sbjct: 123 ELKKF--PQHVFGHAFTTLKCEGPAYLPWLQKR 153





Bos taurus (taxid: 9913)
EC: 1EC: .EC: 4EC: .EC: 3EC: .EC: 1
>sp|Q99489|OXDD_HUMAN D-aspartate oxidase OS=Homo sapiens GN=DDO PE=2 SV=1 Back     alignment and function description
>sp|Q9Z302|OXDA_CRIGR D-amino-acid oxidase OS=Cricetulus griseus GN=DAO PE=2 SV=1 Back     alignment and function description
>sp|Q922Z0|OXDD_MOUSE D-aspartate oxidase OS=Mus musculus GN=Ddo PE=2 SV=1 Back     alignment and function description
>sp|P18894|OXDA_MOUSE D-amino-acid oxidase OS=Mus musculus GN=Dao PE=1 SV=3 Back     alignment and function description
>sp|O35078|OXDA_RAT D-amino-acid oxidase OS=Rattus norvegicus GN=Dao PE=2 SV=1 Back     alignment and function description
>sp|Q95XG9|OXDA2_CAEEL D-amino-acid oxidase 2 OS=Caenorhabditis elegans GN=Y69A2AR.5 PE=1 SV=2 Back     alignment and function description
>sp|A3KCL7|OXDD_PIG D-aspartate oxidase OS=Sus scrofa GN=DDO PE=2 SV=1 Back     alignment and function description
>sp|Q9Z1M5|OXDA_CAVPO D-amino-acid oxidase OS=Cavia porcellus GN=DAO PE=2 SV=1 Back     alignment and function description
>sp|P00371|OXDA_PIG D-amino-acid oxidase OS=Sus scrofa GN=DAO PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query728
321461793343 hypothetical protein DAPPUDRAFT_231376 [ 0.210 0.446 0.443 1e-31
58387114334 AGAP005323-PB [Anopheles gambiae str. PE 0.201 0.440 0.427 2e-30
195433084334 GK23907 [Drosophila willistoni] gi|19416 0.200 0.437 0.417 7e-30
195120786335 GI20172 [Drosophila mojavensis] gi|19390 0.200 0.435 0.430 1e-29
195026504335 GH20617 [Drosophila grimshawi] gi|193902 0.200 0.435 0.410 3e-29
195066100335 GH24186 [Drosophila grimshawi] gi|193892 0.200 0.435 0.410 3e-29
157133215334 d-amino acid oxidase [Aedes aegypti] gi| 0.201 0.440 0.407 1e-28
157119089334 d-amino acid oxidase [Aedes aegypti] gi| 0.201 0.440 0.407 1e-28
194758004335 GF11092 [Drosophila ananassae] gi|190622 0.200 0.435 0.423 1e-28
201065547352 FI02859p [Drosophila melanogaster] 0.208 0.431 0.414 1e-28
>gi|321461793|gb|EFX72821.1| hypothetical protein DAPPUDRAFT_231376 [Daphnia pulex] Back     alignment and taxonomy information
 Score =  145 bits (365), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 101/158 (63%), Gaps = 5/158 (3%)

Query: 247 MGSNHKVAILGAGIIGLSTALELQRRFPNCDVTVIADKFNMDTTSDGAAGLFEPSPNFMG 306
           M    ++ +LGAGI+G++TA  ++ +    DVT+IADKF  DT SD AAG+F PS +F G
Sbjct: 1   MEEKKQICVLGAGIVGITTAFMMKEKHTKWDVTIIADKFEQDTLSDIAAGIFRPSTSFKG 60

Query: 307 PDLETTKEWIRYSYDHYAGLL----SENCGVQVINGYNLAKSEKQCAENHYLKPVLPVYK 362
           P  E TK+W+  +Y HY  +     +   GVQ ++GY L+    +  +N +L+ +LPVY+
Sbjct: 61  PTSEITKQWLVDAYHHYKKIQITKETAEAGVQEVSGYVLSSKFPEVTKNQFLEDLLPVYR 120

Query: 363 RMSEEELAEIGPGDWKYGIYMSTLVIPNRIFLPWCMQK 400
           R +E EL +I PGDWKYG + +TLVI +R  LPW   K
Sbjct: 121 RANELEL-KICPGDWKYGAFFTTLVIESRYHLPWLRNK 157




Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|58387114|ref|XP_315337.2| AGAP005323-PB [Anopheles gambiae str. PEST] gi|158293988|ref|XP_001688634.1| AGAP005323-PA [Anopheles gambiae str. PEST] gi|55238139|gb|EAA11815.2| AGAP005323-PB [Anopheles gambiae str. PEST] gi|157015356|gb|EDO63640.1| AGAP005323-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195433084|ref|XP_002064545.1| GK23907 [Drosophila willistoni] gi|194160630|gb|EDW75531.1| GK23907 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195120786|ref|XP_002004902.1| GI20172 [Drosophila mojavensis] gi|193909970|gb|EDW08837.1| GI20172 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195026504|ref|XP_001986271.1| GH20617 [Drosophila grimshawi] gi|193902271|gb|EDW01138.1| GH20617 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195066100|ref|XP_001996777.1| GH24186 [Drosophila grimshawi] gi|193892007|gb|EDV90873.1| GH24186 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|157133215|ref|XP_001662804.1| d-amino acid oxidase [Aedes aegypti] gi|108870913|gb|EAT35138.1| AAEL012674-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|157119089|ref|XP_001659331.1| d-amino acid oxidase [Aedes aegypti] gi|108875482|gb|EAT39707.1| AAEL008512-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|194758004|ref|XP_001961252.1| GF11092 [Drosophila ananassae] gi|190622550|gb|EDV38074.1| GF11092 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|201065547|gb|ACH92183.1| FI02859p [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query728
FB|FBgn0033543335 CG12338 [Drosophila melanogast 0.199 0.432 0.42 6.7e-47
ZFIN|ZDB-GENE-080204-116339 zgc:172341 "zgc:172341" [Danio 0.210 0.451 0.333 1e-29
UNIPROTKB|P31228341 DDO "D-aspartate oxidase" [Bos 0.207 0.442 0.325 7.4e-27
UNIPROTKB|F1MP99341 DDO "D-aspartate oxidase" [Bos 0.207 0.442 0.325 9.4e-27
ZFIN|ZDB-GENE-040426-1894353 dao.3 "D-amino-acid oxidase 3" 0.192 0.396 0.329 2.9e-24
UNIPROTKB|Q99489341 DDO "D-aspartate oxidase" [Hom 0.193 0.413 0.322 3.2e-24
UNIPROTKB|F1PAL6340 DDO "Uncharacterized protein" 0.193 0.414 0.348 3.3e-24
UNIPROTKB|J9P7G3351 DDO "Uncharacterized protein" 0.193 0.401 0.348 5.5e-24
UNIPROTKB|F1RT00341 DDO "D-aspartate oxidase" [Sus 0.193 0.413 0.308 4.6e-23
UNIPROTKB|A3KCL7341 DDO "D-aspartate oxidase" [Sus 0.193 0.413 0.308 2e-22
FB|FBgn0033543 CG12338 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 326 (119.8 bits), Expect = 6.7e-47, Sum P(3) = 6.7e-47
 Identities = 63/150 (42%), Positives = 99/150 (66%)

Query:   255 ILGAGIIGLSTALELQRRFPNCDVTVIADKFNMDTTSDGAAGLFEPSPNFMGPDLETTKE 314
             +LG+GIIGL+TALELQ+ FP   V+VIAD+FN DT S  AAG+F P  +FMGP  + T++
Sbjct:     5 VLGSGIIGLTTALELQKEFPTARVSVIADRFNEDTVSYVAAGIFRPGTSFMGPTQKITQQ 64

Query:   315 WIRYSYDHYAGLLSEN----CGVQVINGYNLAKSEKQCAENHYLKPVLPVYKRMSEEELA 370
             W+  +++++  L         GV  ++GY  +++      NH+++ +LPVY+R +EEEL 
Sbjct:    65 WMTDAFNYWDELRRSKEAPLAGVCQLSGYIYSRTSPSIVRNHFIEKLLPVYRRATEEEL- 123

Query:   371 EIGPGDWKYGIYMSTLVIPNRIFLPWCMQK 400
              +  G WKYG + +T +  +R+FLP+  +K
Sbjct:   124 RLCNGGWKYGSFFTTCLTESRLFLPYATKK 153


GO:0008445 "D-aspartate oxidase activity" evidence=ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0003884 "D-amino-acid oxidase activity" evidence=IEA
ZFIN|ZDB-GENE-080204-116 zgc:172341 "zgc:172341" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P31228 DDO "D-aspartate oxidase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1MP99 DDO "D-aspartate oxidase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1894 dao.3 "D-amino-acid oxidase 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q99489 DDO "D-aspartate oxidase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PAL6 DDO "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P7G3 DDO "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RT00 DDO "D-aspartate oxidase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|A3KCL7 DDO "D-aspartate oxidase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.4.3.3LOW CONFIDENCE prediction!
3rd Layer1.4.30.691

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query728
pfam01266234 pfam01266, DAO, FAD dependent oxidoreductase 3e-12
COG0665387 COG0665, DadA, Glycine/D-amino acid oxidases (deam 2e-10
PRK11728393 PRK11728, PRK11728, hydroxyglutarate oxidase; Prov 8e-06
COG1232444 COG1232, HemY, Protoporphyrinogen oxidase [Coenzym 1e-05
PRK11883451 PRK11883, PRK11883, protoporphyrinogen oxidase; Re 6e-05
COG0654387 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox 6e-04
COG0579429 COG0579, COG0579, Predicted dehydrogenase [General 6e-04
>gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information
 Score = 66.6 bits (163), Expect = 3e-12
 Identities = 37/144 (25%), Positives = 54/144 (37%), Gaps = 14/144 (9%)

Query: 252 KVAILGAGIIGLSTALELQRRFPNCDVTVIADKFNMDTTSDGAAGLFEPSPNFMGPDLET 311
            V ++G GI+GLSTA EL RR     VT++         S   AGL    P         
Sbjct: 1   DVVVIGGGIVGLSTAYELARR--GLSVTLLERGDLASGASGRNAGLL--HPGLRKERAPL 56

Query: 312 TKEWIRYSYDHYAGLLSE---NCGVQVINGYNLAKSEKQCAENHYLKPVL----PVYKRM 364
                  S D +  L+ E   +C  +      LA+ E +      L   L       + +
Sbjct: 57  LARLALESRDLWRELIEELGIDCDFRRTGVLVLARDEAELDALRRLAAALRALGLPVELL 116

Query: 365 SEEELAEIGPG---DWKYGIYMST 385
             EEL E+ PG     + G++   
Sbjct: 117 DAEELRELEPGLSPGIRGGLFYPD 140


This family includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase EC:1.1.99.5, Sarcosine oxidase beta subunit EC:1.5.3.1, D-alanine oxidase EC:1.4.99.1, D-aspartate oxidase EC:1.4.3.1. Length = 234

>gnl|CDD|223737 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|183292 PRK11728, PRK11728, hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|224153 COG1232, HemY, Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|237009 PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|223652 COG0579, COG0579, Predicted dehydrogenase [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 728
KOG3923|consensus342 100.0
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 100.0
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 99.97
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 99.97
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 99.97
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 99.97
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 99.96
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 99.96
PRK11728393 hydroxyglutarate oxidase; Provisional 99.96
PRK11259376 solA N-methyltryptophan oxidase; Provisional 99.95
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 99.95
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 99.95
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 99.95
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 99.94
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 99.94
KOG2844|consensus 856 99.93
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 99.92
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 99.88
PLN02464627 glycerol-3-phosphate dehydrogenase 99.88
KOG2853|consensus509 99.87
COG0579429 Predicted dehydrogenase [General function predicti 99.87
TIGR03377516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 99.85
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 99.81
KOG2820|consensus399 99.8
PTZ00383497 malate:quinone oxidoreductase; Provisional 99.73
KOG2852|consensus380 99.73
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 99.72
KOG2665|consensus453 99.69
PRK13339497 malate:quinone oxidoreductase; Reviewed 99.64
PRK05257494 malate:quinone oxidoreductase; Validated 99.64
KOG3923|consensus342 99.44
KOG0042|consensus 680 99.43
KOG1116|consensus579 99.32
PLN02958481 diacylglycerol kinase/D-erythro-sphingosine kinase 98.62
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.48
PRK08274466 tricarballylate dehydrogenase; Validated 98.37
PRK06481506 fumarate reductase flavoprotein subunit; Validated 98.23
PRK06185407 hypothetical protein; Provisional 98.19
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 98.1
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 97.97
KOG1298|consensus509 97.89
PRK08401466 L-aspartate oxidase; Provisional 97.79
COG2081408 Predicted flavoproteins [General function predicti 97.77
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 97.76
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 97.7
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 97.67
PRK07121492 hypothetical protein; Validated 97.66
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.65
PRK07512513 L-aspartate oxidase; Provisional 97.64
COG1233487 Phytoene dehydrogenase and related proteins [Secon 97.63
PLN02204601 diacylglycerol kinase 97.61
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.59
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.58
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 97.53
PRK07208479 hypothetical protein; Provisional 97.52
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 97.51
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 97.51
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 97.49
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 97.49
PRK10157428 putative oxidoreductase FixC; Provisional 97.49
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 97.49
PRK09126392 hypothetical protein; Provisional 97.48
PRK10015429 oxidoreductase; Provisional 97.48
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.48
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 97.47
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 97.47
PRK08163396 salicylate hydroxylase; Provisional 97.45
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 97.45
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 97.44
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 97.43
PRK08013400 oxidoreductase; Provisional 97.43
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.43
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 97.4
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.4
PRK07045388 putative monooxygenase; Reviewed 97.4
PRK12842574 putative succinate dehydrogenase; Reviewed 97.4
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 97.4
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 97.38
PRK07804541 L-aspartate oxidase; Provisional 97.37
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.37
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 97.37
PRK07236386 hypothetical protein; Provisional 97.35
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 97.34
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.34
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 97.34
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 97.32
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 97.31
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 97.3
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 97.3
TIGR02730493 carot_isom carotene isomerase. Members of this fam 97.3
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.3
PLN02576496 protoporphyrinogen oxidase 97.3
PRK06847375 hypothetical protein; Provisional 97.28
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 97.28
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 97.28
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 97.27
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 97.27
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 97.27
PRK06834488 hypothetical protein; Provisional 97.26
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 97.26
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 97.26
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 97.26
PRK06126545 hypothetical protein; Provisional 97.26
PRK13059295 putative lipid kinase; Reviewed 97.25
PRK07233434 hypothetical protein; Provisional 97.24
KOG0029|consensus501 97.24
PRK06370463 mercuric reductase; Validated 97.23
PRK11883451 protoporphyrinogen oxidase; Reviewed 97.23
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 97.22
COG3349485 Uncharacterized conserved protein [Function unknow 97.22
PLN02985514 squalene monooxygenase 97.21
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.21
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 97.2
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 97.19
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 97.19
PRK06184502 hypothetical protein; Provisional 97.18
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.17
PRK09231582 fumarate reductase flavoprotein subunit; Validated 97.17
PLN02268435 probable polyamine oxidase 97.16
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 97.16
PRK11445351 putative oxidoreductase; Provisional 97.15
PRK12839572 hypothetical protein; Provisional 97.15
PRK08244493 hypothetical protein; Provisional 97.15
PLN02815594 L-aspartate oxidase 97.15
PRK06753373 hypothetical protein; Provisional 97.14
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 97.13
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 97.13
PRK06175433 L-aspartate oxidase; Provisional 97.13
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.13
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.13
PRK13337304 putative lipid kinase; Reviewed 97.12
PRK09077536 L-aspartate oxidase; Provisional 97.11
PLN02661357 Putative thiazole synthesis 97.1
PRK07588391 hypothetical protein; Provisional 97.09
PRK07395553 L-aspartate oxidase; Provisional 97.08
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 97.08
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 97.08
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 97.08
PRK08071510 L-aspartate oxidase; Provisional 97.07
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 97.04
PRK07538413 hypothetical protein; Provisional 97.04
PRK06116450 glutathione reductase; Validated 97.04
PRK05868372 hypothetical protein; Validated 97.01
PLN02568539 polyamine oxidase 97.01
KOG2614|consensus420 97.0
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 96.99
PTZ00367567 squalene epoxidase; Provisional 96.98
PRK07190487 hypothetical protein; Provisional 96.98
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 96.97
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 96.97
PRK13057287 putative lipid kinase; Reviewed 96.96
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 96.96
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 96.95
TIGR00147293 lipid kinase, YegS/Rv2252/BmrU family. The E. coli 96.94
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 96.93
PRK13055334 putative lipid kinase; Reviewed 96.93
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 96.92
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 96.9
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 96.9
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 96.9
PRK08132547 FAD-dependent oxidoreductase; Provisional 96.9
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 96.9
PRK00861300 putative lipid kinase; Reviewed 96.9
PRK06475400 salicylate hydroxylase; Provisional 96.89
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 96.89
PRK05976472 dihydrolipoamide dehydrogenase; Validated 96.89
PRK06996398 hypothetical protein; Provisional 96.89
PRK11914306 diacylglycerol kinase; Reviewed 96.89
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 96.87
PRK12416463 protoporphyrinogen oxidase; Provisional 96.86
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 96.86
PLN02463447 lycopene beta cyclase 96.84
PRK06292460 dihydrolipoamide dehydrogenase; Validated 96.83
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 96.83
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 96.83
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 96.81
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 96.8
KOG2960|consensus328 96.8
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 96.8
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 96.79
PLN02172461 flavin-containing monooxygenase FMO GS-OX 96.78
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 96.78
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 96.77
PRK08294 634 phenol 2-monooxygenase; Provisional 96.76
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 96.75
PRK13977576 myosin-cross-reactive antigen; Provisional 96.73
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 96.71
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 96.7
PLN02697529 lycopene epsilon cyclase 96.7
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 96.68
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 96.67
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 96.66
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 96.63
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 96.62
KOG1276|consensus491 96.61
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 96.61
PRK14694468 putative mercuric reductase; Provisional 96.61
KOG1399|consensus448 96.58
PRK08275554 putative oxidoreductase; Provisional 96.57
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 96.57
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 96.55
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 96.55
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 96.55
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 96.55
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 96.53
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 96.53
PRK02106560 choline dehydrogenase; Validated 96.5
PTZ00058561 glutathione reductase; Provisional 96.49
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 96.48
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 96.48
TIGR02053463 MerA mercuric reductase. This model represents the 96.47
PRK10262321 thioredoxin reductase; Provisional 96.45
COG2907447 Predicted NAD/FAD-binding protein [General functio 96.44
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 96.44
PRK06327475 dihydrolipoamide dehydrogenase; Validated 96.42
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 96.41
COG1231450 Monoamine oxidase [Amino acid transport and metabo 96.41
PRK12831464 putative oxidoreductase; Provisional 96.39
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 96.38
PLN02676487 polyamine oxidase 96.37
COG2303542 BetA Choline dehydrogenase and related flavoprotei 96.36
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 96.35
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 96.32
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 96.31
PRK13748561 putative mercuric reductase; Provisional 96.29
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 96.26
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 96.23
PLN02612567 phytoene desaturase 96.2
PRK12779 944 putative bifunctional glutamate synthase subunit b 96.11
PLN02328808 lysine-specific histone demethylase 1 homolog 96.08
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 96.07
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 96.02
PLN02487569 zeta-carotene desaturase 96.01
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 95.96
PRK13054300 lipid kinase; Reviewed 95.92
PLN02852491 ferredoxin-NADP+ reductase 95.9
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 95.88
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 95.86
PLN02507499 glutathione reductase 95.84
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 95.83
PTZ00052499 thioredoxin reductase; Provisional 95.82
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 95.8
TIGR00275400 flavoprotein, HI0933 family. The model when search 95.8
PRK06567 1028 putative bifunctional glutamate synthase subunit b 95.77
PRK098531019 putative selenate reductase subunit YgfK; Provisio 95.76
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 95.75
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 95.74
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 95.73
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 95.72
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 95.71
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 95.67
PLN02529 738 lysine-specific histone demethylase 1 95.64
COG3573552 Predicted oxidoreductase [General function predict 95.63
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 95.63
PRK12814652 putative NADPH-dependent glutamate synthase small 95.51
PRK14727479 putative mercuric reductase; Provisional 95.47
PTZ00153659 lipoamide dehydrogenase; Provisional 95.37
PLN02546558 glutathione reductase 95.36
PF01134392 GIDA: Glucose inhibited division protein A; InterP 95.34
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 95.33
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 95.31
PRK12770352 putative glutamate synthase subunit beta; Provisio 95.27
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 95.22
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 95.18
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 95.16
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 95.13
PLN03000 881 amine oxidase 95.07
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 95.05
KOG0685|consensus498 95.03
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 94.97
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 94.95
KOG2415|consensus621 94.82
PTZ00188506 adrenodoxin reductase; Provisional 94.75
PRK09564444 coenzyme A disulfide reductase; Reviewed 94.71
KOG4254|consensus561 94.7
PRK12771564 putative glutamate synthase (NADPH) small subunit; 94.67
PRK13512438 coenzyme A disulfide reductase; Provisional 94.57
KOG4716|consensus503 94.54
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 94.45
PRK13984604 putative oxidoreductase; Provisional 94.37
PRK07845466 flavoprotein disulfide reductase; Reviewed 94.34
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 94.24
COG1597301 LCB5 Sphingosine kinase and enzymes related to euk 94.22
PRK09897534 hypothetical protein; Provisional 94.19
PLN02976 1713 amine oxidase 94.09
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 94.08
PTZ00318424 NADH dehydrogenase-like protein; Provisional 93.99
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 93.94
PLN02785587 Protein HOTHEAD 93.85
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 93.68
TIGR03702293 lip_kinase_YegS lipid kinase YegS. Members of this 93.66
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 93.57
KOG1238|consensus623 93.3
PRK06249313 2-dehydropantoate 2-reductase; Provisional 93.23
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.21
KOG1800|consensus468 93.13
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 93.07
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 92.92
PRK07846451 mycothione reductase; Reviewed 92.86
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 92.81
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.63
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 92.52
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 92.25
KOG2404|consensus477 92.02
PRK05708305 2-dehydropantoate 2-reductase; Provisional 91.82
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.76
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 91.75
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 91.48
PRK08229341 2-dehydropantoate 2-reductase; Provisional 91.45
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.44
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.21
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 90.73
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 90.5
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 90.39
COG0569225 TrkA K+ transport systems, NAD-binding component [ 90.37
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.35
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 90.27
PRK12921305 2-dehydropantoate 2-reductase; Provisional 90.13
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 89.98
COG4529474 Uncharacterized protein conserved in bacteria [Fun 89.9
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 89.63
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 89.58
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 89.57
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 89.49
PRK12361547 hypothetical protein; Provisional 89.46
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.45
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 89.38
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 89.26
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 89.08
KOG2755|consensus334 88.66
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 88.65
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 88.6
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 88.54
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 88.28
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 88.19
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 87.74
PRK14989 847 nitrite reductase subunit NirD; Provisional 87.74
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 87.7
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 87.54
PRK05976472 dihydrolipoamide dehydrogenase; Validated 87.44
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 87.37
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 87.2
PRK08268507 3-hydroxy-acyl-CoA dehydrogenase; Validated 87.09
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 87.04
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 86.75
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 86.4
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 86.34
PRK07417279 arogenate dehydrogenase; Reviewed 86.31
KOG1335|consensus506 86.31
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 86.2
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 86.18
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 86.15
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 86.14
cd01483143 E1_enzyme_family Superfamily of activating enzymes 86.12
PRK11730715 fadB multifunctional fatty acid oxidation complex 86.08
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 86.05
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 85.99
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 85.91
PRK07846451 mycothione reductase; Reviewed 85.83
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 85.71
PRK15116268 sulfur acceptor protein CsdL; Provisional 85.51
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 85.5
TIGR02053463 MerA mercuric reductase. This model represents the 85.48
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 85.3
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 85.28
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 85.18
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 85.06
KOG3855|consensus481 85.01
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 84.93
PRK06719157 precorrin-2 dehydrogenase; Validated 84.9
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 84.86
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 84.77
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 84.72
PRK06370463 mercuric reductase; Validated 84.71
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 84.67
PRK06718202 precorrin-2 dehydrogenase; Reviewed 84.66
PLN02353473 probable UDP-glucose 6-dehydrogenase 84.39
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 84.21
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 84.12
PRK11154708 fadJ multifunctional fatty acid oxidation complex 84.11
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 84.07
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 84.01
PTZ00082321 L-lactate dehydrogenase; Provisional 83.97
PRK13512438 coenzyme A disulfide reductase; Provisional 83.95
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 83.94
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 83.85
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 83.82
KOG1371|consensus343 83.65
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 83.49
TIGR02440699 FadJ fatty oxidation complex, alpha subunit FadJ. 83.26
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 83.21
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 83.17
PRK04148134 hypothetical protein; Provisional 82.99
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 82.96
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 82.92
PRK06292460 dihydrolipoamide dehydrogenase; Validated 82.86
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 82.66
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 82.41
KOG2304|consensus298 82.29
PRK06223307 malate dehydrogenase; Reviewed 82.26
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 82.26
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 81.89
PRK08328231 hypothetical protein; Provisional 81.89
PTZ00052499 thioredoxin reductase; Provisional 81.65
KOG0399|consensus2142 81.58
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 80.89
PRK06327475 dihydrolipoamide dehydrogenase; Validated 80.76
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 80.64
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 80.56
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 80.53
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 80.49
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 80.43
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 80.39
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 80.37
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 80.28
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 80.26
PTZ00058561 glutathione reductase; Provisional 80.16
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 80.15
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 80.11
PRK07845466 flavoprotein disulfide reductase; Reviewed 80.02
>KOG3923|consensus Back     alignment and domain information
Probab=100.00  E-value=6.5e-48  Score=394.89  Aligned_cols=326  Identities=33%  Similarity=0.552  Sum_probs=273.2

Q ss_pred             cceEEEeecceechhhHHHhhh-----hCCCCcEEEeecccccccCCCCccccccCCCCCCCCCchhhhhhhhhcccccc
Q psy16975        250 NHKVAILGAGIIGLSTALELQR-----RFPNCDVTVIADKFNMDTTSDGAAGLFEPSPNFMGPDLETTKEWIRYSYDHYA  324 (728)
Q Consensus       250 ~~dVvVIGAGIiGLStA~~La~-----~~~G~~VtVIEk~~~g~gAS~~agGii~p~~~l~~~~~~~~~~~~~~s~~~~~  324 (728)
                      .++|+|||+||+|||||+.|.+     ..+-.+|+|++..+....+|..++|+|+|..+. ++......+|++.+++.|.
T Consensus         3 ~~~iaViGaGVIGlsTA~~i~~~~~~~~ip~~~vtv~~Drf~e~T~s~~~AGl~~p~~~~-~~~~~~~~~w~k~tf~~l~   81 (342)
T KOG3923|consen    3 TPRIAVIGAGVIGLSTALCILELYHSVLIPVAKVTVISDRFTEDTTSDVAAGLFRPDLSD-GTPQEINRQWGKDTFNYLA   81 (342)
T ss_pred             CccEEEEcCCeechhHHHHHHHhhhhccCCcceEEEecCCCccccccccccceeecccCC-CCcHHHHHHHHHHHHHHHH
Confidence            4589999999999999988887     235679999999999999999999999995432 3345568899999999998


Q ss_pred             cccc----cccccEEEcccccccchhhhhhcccccccchhccccCHHHHhhcCCCCcceeEeEEeeeecCccceeccccc
Q psy16975        325 GLLS----ENCGVQVINGYNLAKSEKQCAENHYLKPVLPVYKRMSEEELAEIGPGDWKYGIYMSTLVIPNRIFLPWCMQK  400 (728)
Q Consensus       325 ~l~~----~~~Gv~~~~G~~~a~~~~~~~~~~~~~~~g~~~~~L~~~el~~~~P~~~~~G~~~~~g~idp~~ll~~L~~~  400 (728)
                      .++.    ++.|+.+.+|+.+.+++.-.+..+.|.+...+++.|+++|+. ++|.....|++|.+...++..|++||.+.
T Consensus        82 ~l~rs~~a~~aGV~l~sg~~ls~~e~~~~~~~~w~diV~~fr~l~e~EL~-~f~~~~~~G~~~Tt~~sE~~~ylpyl~k~  160 (342)
T KOG3923|consen   82 HLARSEEAGEAGVCLVSGHILSDSESLDDQQRSWGDIVYGFRDLTERELL-GFPDYSTYGIHFTTYLSEGPKYLPYLKKR  160 (342)
T ss_pred             HHhccccccccceEEeeeeeeccCCCchhhhhhHHhhhhhhhcCCHHHhc-CCCCccccceeEEEeeccchhhhHHHHHH
Confidence            8876    578888999998877532223457889999999999999998 68854578999999999999999999999


Q ss_pred             CCCCCCCCCCceeeEEEEEeeCceeEEEecccccc-ccCCcchhHHHHhhhccccccccccccccEEEcccccccchhhh
Q psy16975        401 DGPSNLGERPSTLSVELYHYNRDSLTVVRGPLHEK-VSSGPRTCAMQRAMQHDHYAGLLSENCGVQVINGYNLAKSEKQC  479 (728)
Q Consensus       401 a~~~~~G~~~~~l~v~I~e~t~~~V~~~~g~~v~~-l~~~~~v~~v~t~~~~g~ada~~VVnAa~~viaG~~~~~S~~L~  479 (728)
                      +.  .+|                      ++|+++ ++      ++++.. ...+|  +|||||     |+   |++.|+
T Consensus       161 l~--e~G----------------------vef~~r~v~------~l~E~~-~~~~D--VivNCt-----GL---~a~~L~  199 (342)
T KOG3923|consen  161 LT--ENG----------------------VEFVQRRVE------SLEEVA-RPEYD--VIVNCT-----GL---GAGKLA  199 (342)
T ss_pred             HH--hcC----------------------cEEEEeeec------cHHHhc-cCCCc--EEEECC-----cc---cccccc
Confidence            99  888                      333333 33      444441 23678  999999     99   999999


Q ss_pred             hhcccccccchhccccCHHHHhhcCCCCcceeEeEEeeeecCccccchhcccchHHHHH-hhc-eeeeecCCceEEeccc
Q psy16975        480 AENHYLKPVLPVYKRMSEEELAEIGPGDWKYGIYMSTLVIPNRIFLPWCMQKNFASLVR-LAG-AYIIPSYGGLVTLGGT  557 (728)
Q Consensus       480 ~~~gi~lpv~PvRGQl~~~el~~~~p~~w~~G~~~~Tlvve~~~~~P~l~~~~~~~~i~-~~~-~YiiP~~dG~vviGgt  557 (728)
                      ++..    ++|+|||                       ++  .+.+||+.+     ++. +.. .|++|..+. |++||+
T Consensus       200 gDd~----~yPiRGq-----------------------Vl--~V~ApWvkh-----f~~~D~~~ty~iP~~~~-V~lGg~  244 (342)
T KOG3923|consen  200 GDDD----LYPIRGQ-----------------------VL--KVDAPWVKH-----FIYRDFSRTYIIPGTES-VTLGGT  244 (342)
T ss_pred             CCcc----eeeccce-----------------------EE--EeeCCceeE-----EEEecCCccEEecCCce-EEEccc
Confidence            8864    7999999                       44  678999988     333 444 589987765 999999


Q ss_pred             cccCcccccccccchhhhhhcccccccccccccceeeeeecccccceeeeeeccccccceeeeeeeeEEeceeEEEEEee
Q psy16975        558 QDYGNARLGVDRFDSRAILNRTAAVRPEILAAPVEKVWVGLRPYRHHVRVERDLTGAAQYLTWYPVFKVYGITSVLFVHR  637 (728)
Q Consensus       558 ~e~~~~d~~~~~~~~~~ll~~~~~l~P~L~~~~I~~~waGlRP~tpd~Rie~e~~~~~~~~~~l~~~~~~G~~~~g~~~~  637 (728)
                      .++++|+.+++.++...|++++.++.|+|..++|++.|+|+||.|+.+|+|.|.+..                       
T Consensus       245 ~Q~g~w~~ei~~~D~~dIl~rc~aL~P~l~~a~ii~E~vGlRP~Rk~vRlE~e~~~~-----------------------  301 (342)
T KOG3923|consen  245 KQEGNWNLEITDEDRRDILERCCALEPSLRHAEIIREWVGLRPGRKQVRLEAELRTR-----------------------  301 (342)
T ss_pred             cccCcccCcCChhhHHHHHHHHHHhCcccccceehhhhhcccCCCCceeeeeeeecC-----------------------
Confidence            999999999999999999999999999999999999999999999999999975421                       


Q ss_pred             ecccCccchhhhhhhhhcccccccceeeccccccccccCcceEEeecCceEEEEeecccCccccccCCCCceeeeeeeec
Q psy16975        638 FKAAGGKVIEKYISSFSELGSEYNTIFNCTGLGARTLCNDMHVIPVRGQTIRIVHNYGHGGYGVTSAPGSARCAVSVFEQ  717 (728)
Q Consensus       638 ~~~~g~~~~~~~~~~~~~~~~~~~~~~nc~g~~~~~~~~d~~~~~~~g~~~~v~h~yGhgg~G~t~s~g~A~~~~~l~~~  717 (728)
                                                                    .|+...|||||||||.|||++||||.+++.|+..
T Consensus       302 ----------------------------------------------~~k~~~VVHnYGHgG~G~Tl~wGtAlea~~Lv~~  335 (342)
T KOG3923|consen  302 ----------------------------------------------GGKRLTVVHNYGHGGNGFTLGWGTALEAAKLVLD  335 (342)
T ss_pred             ----------------------------------------------CCccceeEeeccCCCCceecccchHHHHHHHHHH
Confidence                                                          2566779999999999999999999999999988


Q ss_pred             ccccc
Q psy16975        718 SHKAS  722 (728)
Q Consensus       718 ~~~~~  722 (728)
                      .++++
T Consensus       336 ~l~~~  340 (342)
T KOG3923|consen  336 ALGAS  340 (342)
T ss_pred             Hhhhc
Confidence            87654



>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG2844|consensus Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>KOG2853|consensus Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>KOG2852|consensus Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>KOG2665|consensus Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>KOG3923|consensus Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>KOG1116|consensus Back     alignment and domain information
>PLN02958 diacylglycerol kinase/D-erythro-sphingosine kinase Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>KOG1298|consensus Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02204 diacylglycerol kinase Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK13059 putative lipid kinase; Reviewed Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK13337 putative lipid kinase; Reviewed Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>KOG2614|consensus Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK13057 putative lipid kinase; Reviewed Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR00147 lipid kinase, YegS/Rv2252/BmrU family Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK13055 putative lipid kinase; Reviewed Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK00861 putative lipid kinase; Reviewed Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK11914 diacylglycerol kinase; Reviewed Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>KOG2960|consensus Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>KOG1276|consensus Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK13054 lipid kinase; Reviewed Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>KOG0685|consensus Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>KOG4254|consensus Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>COG1597 LCB5 Sphingosine kinase and enzymes related to eukaryotic diacylglycerol kinase [Lipid metabolism / General function prediction only] Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>TIGR03702 lip_kinase_YegS lipid kinase YegS Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>KOG1238|consensus Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG1800|consensus Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12361 hypothetical protein; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>KOG2755|consensus Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>KOG3855|consensus Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>KOG1371|consensus Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>KOG2304|consensus Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>KOG0399|consensus Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query728
1kif_A347 D-Amino Acid Oxidase From Pig Kidney Length = 347 5e-14
1an9_A340 D-Amino Acid Oxidase Complex With O-Aminobenzoate L 7e-14
3g3e_A351 Crystal Structure Of Human D-Amino Acid Oxidase In 1e-12
2du8_A347 Crystal Structure Of Human D-Amino Acid Oxidase Len 1e-12
>pdb|1KIF|A Chain A, D-Amino Acid Oxidase From Pig Kidney Length = 347 Back     alignment and structure

Iteration: 1

Score = 76.6 bits (187), Expect = 5e-14, Method: Compositional matrix adjust. Identities = 91/367 (24%), Positives = 152/367 (41%), Gaps = 82/367 (22%) Query: 252 KVAILGAGIIGLSTALELQRRFPNC----DVTVIADKFNMDTTSDGAAGLFEPSPNFMGP 307 +V ++GAG+IGLSTAL + R+ + DV V AD+F TT+D AAGL++P + P Sbjct: 2 RVVVIGAGVIGLSTALCIHERYHSVLQPLDVKVYADRFTPFTTTDVAAGLWQPYTS--EP 59 Query: 308 DLETTKEW----IRYSYDHYAGLLSENCGVQVINGYNLAKSEKQCAENHYLKPVLPVYKR 363 W Y H + N G+ ++GYNL ++ + Y K ++ +++ Sbjct: 60 SNPQEANWNQQTFNYLLSHIGSPNAANMGLTPVSGYNLF---REAVPDPYWKDMVLGFRK 116 Query: 364 MSEEELAEIGPGDWKYGIYMSTLVIPNRIFLPWCMQKDGPSNLGERPSTLSVELYHYNRD 423 ++ EL ++ P D++YG + ++L++ R +L W L ER + V+ + + Sbjct: 117 LTPREL-DMFP-DYRYGWFNTSLILEGRKYLQW---------LTERLTERGVKFFLRKVE 165 Query: 424 SLTVVRGPLHEKVSSGPRTCAMQRAMQHDHYAGLLSENCGVQVINGYNLAKSEKQCAENH 483 S E+V+ G + +AG+L + +Q G + K + +N Sbjct: 166 SF--------EEVARGGADVIINCT---GVWAGVLQPDPLLQPGRG-QIIKVDAPWLKNF 213 Query: 484 YLKPVLPVYKRMSEEELAEIGPGDWKYGIYMSTLVIPNRIFLPWCMQKNFASLVRLAGAY 543 + D + GIY S +IP +Q Sbjct: 214 IIT-------------------HDLERGIYNSPYIIPG-------LQA------------ 235 Query: 544 IIPSYGGLVTLGGTQDYGNARLGVDRFDSRAILNRTAAVRPEILAAPVEKVWVGLRPYRH 603 VTLGGT GN + D I + P + A + + G RP R Sbjct: 236 --------VTLGGTFQVGNWNEINNIQDHNTIWEGCCRLEPTLKDAKIVGEYTGFRPVRP 287 Query: 604 HVRVERD 610 VR+ER+ Sbjct: 288 QVRLERE 294
>pdb|1AN9|A Chain A, D-Amino Acid Oxidase Complex With O-Aminobenzoate Length = 340 Back     alignment and structure
>pdb|3G3E|A Chain A, Crystal Structure Of Human D-Amino Acid Oxidase In Complex With Hydroxyquinolin-2(1h) Length = 351 Back     alignment and structure
>pdb|2DU8|A Chain A, Crystal Structure Of Human D-Amino Acid Oxidase Length = 347 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query728
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 8e-27
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 5e-14
1c0p_A 363 D-amino acid oxidase; alpha-beta-alpha motif, flav 4e-08
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 5e-25
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 2e-10
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 3e-08
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 2e-06
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 2e-06
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 1e-05
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 2e-05
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 2e-05
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 3e-05
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 4e-05
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 6e-05
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 9e-05
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 1e-04
1fcd_A401 Flavocytochrome C sulfide dehydrogenase (flavin- b 1e-04
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 4e-04
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 4e-04
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 4e-04
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 5e-04
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 6e-04
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 6e-04
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 8e-04
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 8e-04
3dme_A369 Conserved exported protein; structural genomics, P 9e-04
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Length = 363 Back     alignment and structure
 Score =  111 bits (279), Expect = 8e-27
 Identities = 32/158 (20%), Positives = 61/158 (38%), Gaps = 11/158 (6%)

Query: 246 VMGSNHKVAILGAGIIGLSTALELQRRFPNCDVTVIADKFNMDTTSDGAAGLFEP---SP 302
           +M S  +V +LG+G+IGLS+AL L R+     V ++A     D +S   A  +     +P
Sbjct: 2   MMHSQKRVVVLGSGVIGLSSALILARK--GYSVHILARDLPEDVSSQTFASPWAGANWTP 59

Query: 303 NFMGPDLETTKEWIRYSYDHYAGLLSENCGVQVINGYNLAKSEKQCAENHYLKPVLPVYK 362
                D     +W   ++  +  L+        + G       +     H+ K + P Y+
Sbjct: 60  FMTLTDGPRQAKWEESTFKKWVELVPT-GHAMWLKGTRRFAQNEDGLLGHWYKDITPNYR 118

Query: 363 RMSEEELAEIGPGDWKYGIYMSTLVIPNRIFLPWCMQK 400
            +   E           G+   TL +    +  +  ++
Sbjct: 119 PLPSSECP-----PGAIGVTYDTLSVHAPKYCQYLARE 151


>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Length = 363 Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Length = 363 Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Length = 351 Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Length = 351 Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Length = 382 Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Length = 382 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Length = 477 Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Length = 475 Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Length = 438 Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Length = 437 Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Length = 397 Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Length = 381 Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424 Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Length = 398 Back     alignment and structure
>1fcd_A Flavocytochrome C sulfide dehydrogenase (flavin- binding subunit); electron transport(flavocytochrome); HET: FAD HEM; 2.53A {Allochromatium vinosum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 401 Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470 Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Length = 397 Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Length = 407 Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Length = 410 Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Length = 372 Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Length = 389 Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489 Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Length = 369 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query728
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 100.0
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 99.98
3dme_A369 Conserved exported protein; structural genomics, P 99.97
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 99.97
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 99.97
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.97
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.96
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 99.96
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 99.96
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 99.96
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 99.95
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 99.95
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 99.94
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 99.93
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 99.92
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 99.92
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 99.92
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 99.92
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 99.89
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 98.86
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.8
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.57
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 98.51
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 98.44
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 98.28
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.23
2gqf_A401 Hypothetical protein HI0933; structural genomics, 98.23
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.22
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.16
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 98.13
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 97.9
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 97.81
4fk1_A304 Putative thioredoxin reductase; structural genomic 97.81
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 97.8
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 97.77
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 97.76
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 97.76
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 97.74
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 97.72
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 97.71
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 97.7
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 97.69
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 97.69
3atr_A453 Conserved archaeal protein; saturating double bond 97.68
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 97.68
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 97.67
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 97.66
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 97.66
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 97.61
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 97.61
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 97.58
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 97.57
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 97.56
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 97.55
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 97.53
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 97.52
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 97.51
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 97.51
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 97.5
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 97.48
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 97.48
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 97.48
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 97.47
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 97.47
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 97.47
4hb9_A412 Similarities with probable monooxygenase; flavin, 97.46
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 97.45
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 97.45
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 97.45
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 97.45
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 97.45
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 97.44
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 97.44
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 97.44
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 97.43
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 97.43
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 97.4
2cul_A232 Glucose-inhibited division protein A-related PROT 97.4
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.37
4dna_A463 Probable glutathione reductase; structural genomic 97.36
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 97.36
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 97.35
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 97.35
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.34
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.33
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 97.33
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 97.32
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 97.32
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 97.32
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 97.32
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 97.31
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 97.27
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 97.27
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 97.24
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 97.24
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 97.21
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.21
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.2
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 97.19
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.19
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 97.19
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 97.19
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 97.18
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.18
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 97.17
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 97.15
3r9u_A315 Thioredoxin reductase; structural genomics, center 97.15
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.13
2ywl_A180 Thioredoxin reductase related protein; uncharacter 97.13
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 97.13
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 97.13
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 97.12
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 97.12
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 97.09
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.08
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 97.08
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 97.08
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 97.08
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 97.07
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 97.07
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 97.06
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.05
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.04
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.04
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 97.02
2qv7_A337 Diacylglycerol kinase DGKB; alpha-beta domain 1, b 97.0
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 97.0
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 96.99
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 96.99
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 96.95
2bry_A497 NEDD9 interacting protein with calponin homology a 96.91
1ojt_A482 Surface protein; redox-active center, glycolysis, 96.9
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 96.89
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 96.89
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 96.89
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 96.89
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 96.88
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 96.87
4gut_A776 Lysine-specific histone demethylase 1B; histone de 96.84
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 96.81
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 96.8
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 96.79
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 96.79
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 96.78
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 96.77
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 96.75
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 96.75
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 96.74
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 96.74
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 96.72
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 96.71
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 96.71
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 96.69
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 96.68
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 96.67
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 96.65
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 96.64
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 96.63
3s40_A304 Diacylglycerol kinase; structural genomics, the ce 96.62
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 96.61
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 96.61
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 96.61
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 96.59
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 96.59
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 96.59
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 96.58
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 96.55
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 96.55
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 96.51
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 96.51
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 96.49
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 96.47
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 96.44
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 96.43
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 96.43
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 96.42
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 96.39
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 96.38
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 96.37
1fec_A490 Trypanothione reductase; redox-active center, oxid 96.37
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 96.33
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 96.31
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 96.28
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 96.27
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 96.27
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 96.2
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 96.2
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 96.2
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 96.1
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 96.1
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 96.03
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 96.01
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 95.98
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 95.97
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 95.97
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 95.96
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 95.94
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 95.9
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 95.87
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 95.87
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 95.87
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 95.85
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 95.72
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 95.65
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 95.57
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 95.56
2bon_A332 Lipid kinase; DAG kinase, transferase; 1.90A {Esch 95.51
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 95.47
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 95.42
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 95.29
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 95.29
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 95.18
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 95.09
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 94.71
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 94.48
1lss_A140 TRK system potassium uptake protein TRKA homolog; 93.65
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 93.3
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 93.29
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 93.28
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 93.19
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 93.05
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 93.03
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 92.91
1id1_A153 Putative potassium channel protein; RCK domain, E. 92.59
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 92.49
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 92.36
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 92.08
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 92.08
3c85_A183 Putative glutathione-regulated potassium-efflux S 91.94
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 91.87
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 91.63
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 91.26
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 91.2
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 91.13
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 91.04
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 90.84
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 90.83
3tl2_A315 Malate dehydrogenase; center for structural genomi 90.82
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 90.81
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 90.74
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 90.74
3qha_A296 Putative oxidoreductase; seattle structural genomi 90.71
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 90.7
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 90.6
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 90.37
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 90.34
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 90.32
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 90.25
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 90.23
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 90.14
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 89.99
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 89.98
3g3e_A 351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 89.96
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 89.86
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 89.81
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 89.6
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 89.59
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 89.55
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 89.48
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 89.47
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 89.38
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 89.19
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 89.04
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 88.9
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 88.83
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 88.81
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 88.75
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 88.66
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 88.64
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 88.63
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 88.61
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 88.61
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 88.45
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 88.31
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 88.19
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 88.12
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 87.99
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 87.93
4g65_A461 TRK system potassium uptake protein TRKA; structur 87.93
4ezb_A317 Uncharacterized conserved protein; structural geno 87.93
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 87.81
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 87.67
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 87.62
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 87.57
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 87.38
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 87.35
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 87.32
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 87.21
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 87.2
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 86.99
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 86.98
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 86.83
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 86.81
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 86.8
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 86.35
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 86.34
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 86.22
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 86.2
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 86.2
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 86.1
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 85.93
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 85.9
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 85.88
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 85.81
3l6d_A306 Putative oxidoreductase; structural genomics, prot 85.72
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 85.54
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 85.44
3ius_A286 Uncharacterized conserved protein; APC63810, silic 85.44
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 85.4
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 85.38
1vpd_A299 Tartronate semialdehyde reductase; structural geno 85.35
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 85.18
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 85.06
1ojt_A482 Surface protein; redox-active center, glycolysis, 85.0
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 84.94
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 84.9
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 84.83
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 84.82
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 84.81
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 84.75
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 84.72
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 84.72
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 84.65
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 84.56
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 84.5
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 84.48
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 84.45
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 84.28
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 84.23
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 84.23
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 84.03
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 83.97
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 83.78
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 83.76
1c0p_A 363 D-amino acid oxidase; alpha-beta-alpha motif, flav 83.75
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 83.72
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 83.72
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 83.69
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 83.6
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 83.58
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 83.45
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 83.43
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 83.36
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 83.29
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 83.21
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 83.19
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 83.19
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 83.12
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 83.06
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 83.04
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 83.01
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 83.01
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 82.92
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 82.76
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 82.75
3zwc_A742 Peroxisomal bifunctional enzyme; beta oxidation pa 82.73
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 82.6
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 82.57
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 82.38
1pgj_A478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 82.26
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 82.24
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 82.23
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 82.22
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 82.19
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 82.12
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 82.04
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 82.01
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 81.98
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 81.95
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 81.9
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 81.89
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 81.8
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 81.6
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 81.59
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 81.55
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 81.46
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 81.42
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 81.37
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 81.37
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 81.34
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 81.22
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 81.12
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 81.12
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 81.1
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 80.9
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 80.89
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 80.85
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 80.81
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 80.8
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 80.78
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 80.66
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 80.65
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 80.55
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 80.54
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 80.51
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 80.37
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 80.25
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 80.12
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 80.08
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 80.04
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 80.03
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
Probab=100.00  E-value=6.8e-37  Score=330.49  Aligned_cols=327  Identities=27%  Similarity=0.451  Sum_probs=246.9

Q ss_pred             ceEEEeecceechhhHHHhhhhCCC------CcEEEeecccccccCCCCccccccCCCCCCCCCchhhhhhhhhcccccc
Q psy16975        251 HKVAILGAGIIGLSTALELQRRFPN------CDVTVIADKFNMDTTSDGAAGLFEPSPNFMGPDLETTKEWIRYSYDHYA  324 (728)
Q Consensus       251 ~dVvVIGAGIiGLStA~~La~~~~G------~~VtVIEk~~~g~gAS~~agGii~p~~~l~~~~~~~~~~~~~~s~~~~~  324 (728)
                      +||+|||||++||++||+|++  +|      ++|+|||++.++.++|++++|++.+.  ..........+|+..+++.|.
T Consensus         1 mdVvIIGgGi~Gls~A~~La~--~G~~~~p~~~V~vlE~~~~~~~aS~~~~g~~~~~--~~~~~~~~~~~~~~~~~~~~~   76 (351)
T 3g3e_A            1 MRVVVIGAGVIGLSTALCIHE--RYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPY--LSDPNNPQEADWSQQTFDYLL   76 (351)
T ss_dssp             CEEEEECCSHHHHHHHHHHHH--HHTTTSSSCEEEEEESSCGGGSGGGTCCCBCCCC--SSCCSCTHHHHHHHHHHHHHH
T ss_pred             CcEEEECCCHHHHHHHHHHHH--hccccCCCceEEEEECCCCCCCccccCcceeecc--cCCCchHHHHHHHHHHHHHHH
Confidence            389999999999999999999  66      89999999998899999999999983  222234467788999999998


Q ss_pred             ccccc----ccccEEEcccccccchhhhhhcccccccchhccccCHHHHhhcCCCCcceeEeEEeeeecCccceeccccc
Q psy16975        325 GLLSE----NCGVQVINGYNLAKSEKQCAENHYLKPVLPVYKRMSEEELAEIGPGDWKYGIYMSTLVIPNRIFLPWCMQK  400 (728)
Q Consensus       325 ~l~~~----~~Gv~~~~G~~~a~~~~~~~~~~~~~~~g~~~~~L~~~el~~~~P~~~~~G~~~~~g~idp~~ll~~L~~~  400 (728)
                      ++...    .+++....|+.++.++++   ..++.+.+.++++++++|+. .+| ....|++++++++||..++.+|++.
T Consensus        77 ~~~~~~~~~~~~~~~~~g~~~~~~~~~---~~~~~~~~~~~~~l~~~e~~-~~p-~~~~~~~~~~~~v~p~~~~~~l~~~  151 (351)
T 3g3e_A           77 SHVHSPNAENLGLFLISGYNLFHEAIP---DPSWKDTVLGFRKLTPRELD-MFP-DYGYGWFHTSLILEGKNYLQWLTER  151 (351)
T ss_dssp             TTTTSTTHHHHTEEEEEEEEEESSCCC---CCGGGGTSEEEEECCHHHHT-TCT-TCCEEEEEEEEEECHHHHHHHHHHH
T ss_pred             HHhhccCCCCccEEEEEEEEEecCCcc---ccCHHHhCCCceECCHHHhc-cCC-CCceEEEecceEEcHHHHHHHHHHH
Confidence            87752    234445667766544332   34566678889999999994 588 5778888889999999999999999


Q ss_pred             CCCCCCCCCCceeeEEEEEeeCceeEEEeccccccccCCcchhHHHHhhhccccccccccccccEEEcccccccchhhhh
Q psy16975        401 DGPSNLGERPSTLSVELYHYNRDSLTVVRGPLHEKVSSGPRTCAMQRAMQHDHYAGLLSENCGVQVINGYNLAKSEKQCA  480 (728)
Q Consensus       401 a~~~~~G~~~~~l~v~I~e~t~~~V~~~~g~~v~~l~~~~~v~~v~t~~~~g~ada~~VVnAa~~viaG~~~~~S~~L~~  480 (728)
                      ++  ++|       ++|++ +++          .         +++.. ....++  .||+|+     |+   |+..|++
T Consensus       152 ~~--~~G-------v~i~~-~~V----------~---------~i~~~-~~~~a~--~VV~A~-----G~---~s~~l~~  191 (351)
T 3g3e_A          152 LT--ERG-------VKFFQ-RKV----------E---------SFEEV-AREGAD--VIVNCT-----GV---WAGALQR  191 (351)
T ss_dssp             HH--HTT-------CEEEE-CCC----------C---------CHHHH-HHTTCS--EEEECC-----GG---GGGGTSC
T ss_pred             HH--HCC-------CEEEE-EEe----------C---------CHHHh-hcCCCC--EEEECC-----Cc---ChHhhcC
Confidence            98  888       66666 541          1         12211 012456  999999     99   9998875


Q ss_pred             hcccccccchhccccCHHHHhhcCCCCcceeEeEEeeeecCccccchhcccchHHHHHhhceeeeecCCceEEecccccc
Q psy16975        481 ENHYLKPVLPVYKRMSEEELAEIGPGDWKYGIYMSTLVIPNRIFLPWCMQKNFASLVRLAGAYIIPSYGGLVTLGGTQDY  560 (728)
Q Consensus       481 ~~gi~lpv~PvRGQl~~~el~~~~p~~w~~G~~~~Tlvve~~~~~P~l~~~~~~~~i~~~~~YiiP~~dG~vviGgt~e~  560 (728)
                      +    .++.|+|||++.++..                    ....+.+...  +....+...|++|+.+ ++++|++.+.
T Consensus       192 ~----~~l~p~rg~~~~~~~~--------------------~~~~~~~~~~--~~~~~~~~~y~~p~~~-~~~iGg~~~~  244 (351)
T 3g3e_A          192 D----PLLQPGRGQIMKVDAP--------------------WMKHFILTHD--PERGIYNSPYIIPGTQ-TVTLGGIFQL  244 (351)
T ss_dssp             C----TTCEEEEEEEEEEECT--------------------TCCSEEEECC--TTTCTTCSCEEEECSS-CEEEECCCEE
T ss_pred             C----CceeecCCcEEEEeCC--------------------CcceEEEecc--ccCCCCceeEEEeCCC-cEEEeeeeec
Confidence            3    6789999996421110                    0000110000  0000134689999988 7999999998


Q ss_pred             CcccccccccchhhhhhcccccccccccccceeeeeecccccceeeeeeccccccceeeeeeeeEEeceeEEEEEeeecc
Q psy16975        561 GNARLGVDRFDSRAILNRTAAVRPEILAAPVEKVWVGLRPYRHHVRVERDLTGAAQYLTWYPVFKVYGITSVLFVHRFKA  640 (728)
Q Consensus       561 ~~~d~~~~~~~~~~ll~~~~~l~P~L~~~~I~~~waGlRP~tpd~Rie~e~~~~~~~~~~l~~~~~~G~~~~g~~~~~~~  640 (728)
                      .+++..++++..+.+++.+.+++|.|.+.++.+.|+|+||+|+|.+++.+.++..                         
T Consensus       245 ~~~~~~~~~~~~~~l~~~~~~~~P~l~~~~i~~~w~G~r~~t~D~p~~~~~ig~~-------------------------  299 (351)
T 3g3e_A          245 GNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIRLEREQLRTG-------------------------  299 (351)
T ss_dssp             TCCCCSCCHHHHHHHHHHHHHHCGGGGGCEEEEEEEEEEEECSSCEEEEEEECCS-------------------------
T ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCCccCCcEeeeeEeeCCCCCCccceeeeccCC-------------------------
Confidence            8888888999999999999999999999999999999999999966654333210                         


Q ss_pred             cCccchhhhhhhhhcccccccceeeccccccccccCcceEEeecCceEEEEeecccCccccccCCCCceeeeeeeecccc
Q psy16975        641 AGGKVIEKYISSFSELGSEYNTIFNCTGLGARTLCNDMHVIPVRGQTIRIVHNYGHGGYGVTSAPGSARCAVSVFEQSHK  720 (728)
Q Consensus       641 ~g~~~~~~~~~~~~~~~~~~~~~~nc~g~~~~~~~~d~~~~~~~g~~~~v~h~yGhgg~G~t~s~g~A~~~~~l~~~~~~  720 (728)
                                                                  ...-.||+++||+|+|+++||++|+.+++++.+.++
T Consensus       300 --------------------------------------------~~~~~~~~~~G~~g~G~~~ap~~g~~la~li~~~~~  335 (351)
T 3g3e_A          300 --------------------------------------------PSNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILE  335 (351)
T ss_dssp             --------------------------------------------SSCEEEEEEECCTTCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             --------------------------------------------CCCCeEEEEeCCCcchHhhhHHHHHHHHHHHHHHHH
Confidence                                                        012348999999999999999999999999999877


Q ss_pred             cc
Q psy16975        721 AS  722 (728)
Q Consensus       721 ~~  722 (728)
                      +.
T Consensus       336 ~~  337 (351)
T 3g3e_A          336 EK  337 (351)
T ss_dssp             HT
T ss_pred             hc
Confidence            53



>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2qv7_A Diacylglycerol kinase DGKB; alpha-beta domain 1, beta sandwich domain 2, protein-ADP COM transferase; HET: ADP; 2.30A {Staphylococcus aureus} SCOP: e.52.1.2 PDB: 2qvl_A Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3s40_A Diacylglycerol kinase; structural genomics, the center for structural genomics of infectious diseases, csgid, transfer; 2.10A {Bacillus anthracis} PDB: 3t5p_A Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2bon_A Lipid kinase; DAG kinase, transferase; 1.90A {Escherichia coli} SCOP: e.52.1.2 PDB: 2jgr_A 2p1r_A Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 728
d1kifa1246 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N 3e-18
d1kifa1246 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N 3e-16
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 2e-15
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 8e-12
d1ryia288 d.16.1.3 (A:219-306) Glycine oxidase ThiO {Bacillu 4e-09
d1c0pa295 d.16.1.3 (A:1194-1288) D-aminoacid oxidase {Rhodot 8e-08
d1kifa293 d.16.1.3 (A:195-287) D-aminoacid oxidase {Pig (Sus 2e-07
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 8e-06
d2qv7a1312 e.52.1.2 (A:1-312) Diacylglycerol kinase DgkB {Sta 2e-05
d1pj5a2305 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox 3e-05
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 4e-05
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 4e-05
d2iida1370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 6e-05
d1k0ia1292 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr 8e-05
d2ivda1347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 1e-04
d1fcda1186 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf 2e-04
d1nhpa1198 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter 4e-04
d1seza1373 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox 6e-04
d1kf6a2311 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es 7e-04
d2gv8a1335 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox 7e-04
d2dw4a2449 c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist 9e-04
d2v5za1383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 0.001
d2bi7a1314 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mu 0.001
d1cjca2230 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase 0.002
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 0.004
d1m6ia1213 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing f 0.004
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 0.004
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 246 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Nucleotide-binding domain
superfamily: Nucleotide-binding domain
family: D-aminoacid oxidase, N-terminal domain
domain: D-aminoacid oxidase, N-terminal domain
species: Pig (Sus scrofa) [TaxId: 9823]
 Score = 82.6 bits (203), Expect = 3e-18
 Identities = 28/92 (30%), Positives = 42/92 (45%), Gaps = 8/92 (8%)

Query: 634 FVHRFKAAGGKVIEKYISSFSELGSE-YNTIFNCTGLGARTLCNDMHVIPVRGQTIR--- 689
              R    G K   + + SF E+     + I NCTG+ A  L  D   + +  + +R   
Sbjct: 148 LTERLTERGVKFFLRKVESFEEVARGGADVIINCTGVWAGVLQPDPLQVRLEREQLRFGS 207

Query: 690 ----IVHNYGHGGYGVTSAPGSARCAVSVFEQ 717
               ++HNYGHGGYG+T   G A     +F +
Sbjct: 208 SNTEVIHNYGHGGYGLTIHWGCALEVAKLFGK 239


>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 246 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure
>d1ryia2 d.16.1.3 (A:219-306) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 88 Back     information, alignment and structure
>d1c0pa2 d.16.1.3 (A:1194-1288) D-aminoacid oxidase {Rhodotorula gracilis [TaxId: 5286]} Length = 95 Back     information, alignment and structure
>d1kifa2 d.16.1.3 (A:195-287) D-aminoacid oxidase {Pig (Sus scrofa) [TaxId: 9823]} Length = 93 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d2qv7a1 e.52.1.2 (A:1-312) Diacylglycerol kinase DgkB {Staphylococcus aureus [TaxId: 1280]} Length = 312 Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Length = 314 Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 230 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 213 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query728
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 99.93
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.9
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 99.9
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.86
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.81
d1ryia288 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.39
d1kifa293 D-aminoacid oxidase {Pig (Sus scrofa) [TaxId: 9823 99.32
d1c0pa295 D-aminoacid oxidase {Rhodotorula gracilis [TaxId: 99.27
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 98.93
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 98.79
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 98.75
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 98.6
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.56
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 98.45
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 98.21
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 98.19
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.15
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.07
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.06
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.01
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 98.01
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 97.97
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 97.94
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 97.87
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 97.87
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 97.86
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 97.84
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 97.78
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 97.78
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 97.77
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 97.76
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 97.75
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.74
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 97.72
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 97.72
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 97.66
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 97.65
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.64
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.62
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 97.6
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.57
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 97.56
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 97.55
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 97.53
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 97.5
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 97.49
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.46
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 97.46
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.45
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.39
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 97.37
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 97.37
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.37
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 97.34
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 97.32
d2qv7a1312 Diacylglycerol kinase DgkB {Staphylococcus aureus 97.28
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 97.22
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.22
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 97.2
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 97.2
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 97.02
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 96.96
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 96.87
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 96.84
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 96.81
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 96.81
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 96.77
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 96.77
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.58
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 96.53
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 96.37
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.34
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 96.22
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 96.22
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 96.19
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 96.17
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 96.12
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 96.11
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 95.89
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.87
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 95.84
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.77
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 95.76
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 95.69
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 95.66
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 95.66
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 95.64
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.59
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 95.55
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 95.38
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 95.2
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 95.15
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 95.12
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 95.09
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 94.98
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 94.95
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 94.92
d2bona1295 Lipid kinase YegS {Escherichia coli [TaxId: 562]} 94.92
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 94.48
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 94.42
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 94.01
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 93.72
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 93.62
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 93.61
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 93.07
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 92.84
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 92.82
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 92.78
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 92.6
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 92.29
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 92.26
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 92.02
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 91.67
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 91.59
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 90.57
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 90.57
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 90.48
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 90.05
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 89.71
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 89.68
d1pj5a3119 N,N-dimethylglycine oxidase {Arthrobacter globifor 89.32
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 88.88
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 88.8
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 88.31
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 88.1
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 87.6
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 86.97
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 86.84
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 86.52
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 86.43
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 86.42
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 86.33
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 85.91
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 85.72
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 85.12
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 84.82
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 84.61
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 84.45
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 83.59
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 83.47
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 83.26
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 83.03
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 82.34
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 82.34
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 82.11
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 82.09
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 82.03
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 81.79
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Nucleotide-binding domain
superfamily: Nucleotide-binding domain
family: D-aminoacid oxidase, N-terminal domain
domain: D-aminoacid oxidase, N-terminal domain
species: Pig (Sus scrofa) [TaxId: 9823]
Probab=99.93  E-value=8.1e-28  Score=241.40  Aligned_cols=190  Identities=26%  Similarity=0.494  Sum_probs=128.0

Q ss_pred             eEEEeecceechhhHHHhhhhCCCCcEE------EeecccccccCCCCccccccCCCCCCCCCchhhhhhhhhccccccc
Q psy16975        252 KVAILGAGIIGLSTALELQRRFPNCDVT------VIADKFNMDTTSDGAAGLFEPSPNFMGPDLETTKEWIRYSYDHYAG  325 (728)
Q Consensus       252 dVvVIGAGIiGLStA~~La~~~~G~~Vt------VIEk~~~g~gAS~~agGii~p~~~l~~~~~~~~~~~~~~s~~~~~~  325 (728)
                      +|+||||||+||||||+|++  +|++|+      +++++..+.++|..++|+|.|..  ..+.......|+...+..+..
T Consensus         2 kV~VIGaGi~GlstA~~L~~--~G~~v~v~e~~~i~~~~~~~~~ts~~a~g~~~p~~--~~~~~~~~~~~~~~~~~~~~~   77 (246)
T d1kifa1           2 RVVVIGAGVIGLSTALCIHE--RYHSVLQPLDVKVYADRFTPFTTTDVAAGLWQPYT--SEPSNPQEANWNQQTFNYLLS   77 (246)
T ss_dssp             EEEEECCSHHHHHHHHHHHH--HHTTTSSSCEEEEEESCCTTSSSGGGSCCBCCCCS--SCCSSTHHHHHHHHHHHHHHT
T ss_pred             EEEEECchHHHHHHHHHHHH--CCCCceEEeeeeecccCCCCCChhHhhhceecccc--cccccHHHHHHHHHHHHHhhh
Confidence            69999999999999999999  787655      45555566788889999999853  223333456677766666555


Q ss_pred             ccc----cccccEEEcccccccchhhhhhcccccccchhccccCHHHHhhcCCCCcceeEeEEeeeecCccceecccccC
Q psy16975        326 LLS----ENCGVQVINGYNLAKSEKQCAENHYLKPVLPVYKRMSEEELAEIGPGDWKYGIYMSTLVIPNRIFLPWCMQKD  401 (728)
Q Consensus       326 l~~----~~~Gv~~~~G~~~a~~~~~~~~~~~~~~~g~~~~~L~~~el~~~~P~~~~~G~~~~~g~idp~~ll~~L~~~a  401 (728)
                      ...    ...++....++.++.+..+   ..+++....+++.++..+... .| ....++.+.++++||..|+.+|.+.+
T Consensus        78 ~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~l~~~~~~~-~~-~~~~~~~~~~~~id~~~~~~~L~~~~  152 (246)
T d1kifa1          78 HIGSPNAANMGLTPVSGYNLFREAVP---DPYWKDMVLGFRKLTPRELDM-FP-DYRYGWFNTSLILEGRKYLQWLTERL  152 (246)
T ss_dssp             TTTSTTTTTTTEEEEEEEEEESSCCC---CCTTTTTSEEEEECCHHHHTT-ST-TCCEEEEEEEEEECHHHHHHHHHHHH
T ss_pred             hhccccCCceeEEEcccEEEecCchh---hhhHHhhccchhhhccccccC-Cc-ccceEEEccceEEcHHHHHHHHHHHH
Confidence            433    2345555556655554332   344555666677787776544 22 24455666689999999999999999


Q ss_pred             CCCCCCCCCceeeEEEEEeeCceeEEEeccccccccCCcchhHHHHhhhccccccccccccccEEEcccccccchhhhhh
Q psy16975        402 GPSNLGERPSTLSVELYHYNRDSLTVVRGPLHEKVSSGPRTCAMQRAMQHDHYAGLLSENCGVQVINGYNLAKSEKQCAE  481 (728)
Q Consensus       402 ~~~~~G~~~~~l~v~I~e~t~~~V~~~~g~~v~~l~~~~~v~~v~t~~~~g~ada~~VVnAa~~viaG~~~~~S~~L~~~  481 (728)
                      .  ++|       ++|+          ..+    ++      ++++. ....+|  .|||||     |+   |+.+|.++
T Consensus       153 ~--~~G-------~~~~----------~~~----v~------~l~~~-~~~~~d--~vVnct-----G~---~a~~l~~d  192 (246)
T d1kifa1         153 T--ERG-------VKFF----------LRK----VE------SFEEV-ARGGAD--VIINCT-----GV---WAGVLQPD  192 (246)
T ss_dssp             H--HTT-------CEEE----------ECC----CC------CHHHH-HHTTCS--EEEECC-----GG---GHHHHSCC
T ss_pred             H--HCC-------CEEE----------EeE----eC------CHHHh-ccCCCC--EEEECC-----cc---cccccCCC
Confidence            9  888       3322          222    22      23333 123467  999999     99   99988775


Q ss_pred             cccccccchhccc
Q psy16975        482 NHYLKPVLPVYKR  494 (728)
Q Consensus       482 ~gi~lpv~PvRGQ  494 (728)
                      .    +++|+|||
T Consensus       193 ~----~~~~~r~~  201 (246)
T d1kifa1         193 P----LQVRLERE  201 (246)
T ss_dssp             T----TSCEEEEE
T ss_pred             C----CeeccceE
Confidence            4    35777777



>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1ryia2 d.16.1.3 (A:219-306) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1kifa2 d.16.1.3 (A:195-287) D-aminoacid oxidase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1c0pa2 d.16.1.3 (A:1194-1288) D-aminoacid oxidase {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qv7a1 e.52.1.2 (A:1-312) Diacylglycerol kinase DgkB {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bona1 e.52.1.2 (A:5-299) Lipid kinase YegS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pj5a3 d.16.1.5 (A:220-338) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure