Psyllid ID: psy16994
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 932 | ||||||
| 328786241 | 1358 | PREDICTED: hypothetical protein LOC55171 | 0.628 | 0.431 | 0.299 | 2e-57 | |
| 383850798 | 1498 | PREDICTED: uncharacterized protein LOC10 | 0.633 | 0.393 | 0.306 | 7e-55 | |
| 340710761 | 1506 | PREDICTED: hypothetical protein LOC10065 | 0.572 | 0.354 | 0.317 | 1e-54 | |
| 350409973 | 1505 | PREDICTED: hypothetical protein LOC10074 | 0.575 | 0.356 | 0.311 | 1e-52 | |
| 307197892 | 1403 | Kinesin-like protein KIF20A [Harpegnatho | 0.640 | 0.425 | 0.281 | 3e-52 | |
| 322798360 | 1228 | hypothetical protein SINV_04881 [Solenop | 0.620 | 0.470 | 0.291 | 7e-52 | |
| 242024707 | 1161 | rabkinesin-6, putative [Pediculus humanu | 0.680 | 0.546 | 0.279 | 1e-49 | |
| 345497647 | 1375 | PREDICTED: hypothetical protein LOC10011 | 0.639 | 0.433 | 0.302 | 3e-49 | |
| 328725064 | 957 | PREDICTED: kinesin-like protein KIF20A-l | 0.672 | 0.655 | 0.278 | 6e-49 | |
| 332030759 | 1468 | Kinesin-like protein KIF20A [Acromyrmex | 0.669 | 0.425 | 0.288 | 4e-48 |
| >gi|328786241|ref|XP_624103.3| PREDICTED: hypothetical protein LOC551711 [Apis mellifera] | Back alignment and taxonomy information |
|---|
Score = 230 bits (587), Expect = 2e-57, Method: Compositional matrix adjust.
Identities = 205/684 (29%), Positives = 351/684 (51%), Gaps = 98/684 (14%)
Query: 4 EGTIEQPGIIPRTLNILFNSLGPYLDKSDVLFRPTYASNVSMLSKEDRVQAFDVKKQILN 63
+GT PGIIPR L +F+++ P KS ++P +V +L +R Q ++K ++L
Sbjct: 189 QGTTTSPGIIPRCLEFVFSNITP---KSTPFYKPVNHCDVVILDPLERAQELEIKTKLLT 245
Query: 64 --SFDQSYAGSTFENVLEVLDQKSIMFKPMKDMKCSITDTCNLYRFSNIYGPHTTQAELF 121
S D+ +T++ + ++L ++S P + +C Y + AE++
Sbjct: 246 FASVDKYQYINTYKEMQKLLQEES----PNRPSQC----------IDAHYSIWVSFAEIY 291
Query: 122 QNIVHNMLERYLNGEDALLFSFGTTNSGKTFTIQDLTYVNVHSCEEAYRVLRFGKSHLSV 181
IV+++L + L T + G+ F I+ L V VHS EAY+VL G+ +L V
Sbjct: 292 NEIVYDLLSNECQKKRTPL-KLATDSQGRAF-IKGLKAVCVHSGSEAYQVLMAGQYNLKV 349
Query: 182 APTELNHRSSRSHCVFSIKLVKV----DPGSEELIMMSSFDICDLAGAERQKRAHTSGDR 237
A T LN RSSRSHC+F+IKL+K DP S E+ S+F CDLAG+ER K+ GDR
Sbjct: 350 AATALNARSSRSHCIFTIKLLKYYVENDPTSVEV---STFAFCDLAGSERLKKTLNIGDR 406
Query: 238 LREARTINSSLHVLARCFNVLRENNGLKADKKKLIPFRDSKLTQIFQRSLSGLSSTVKMI 297
L+EA+ IN+SL VL RC + E K + + PFR+SKLT++FQ++LSG V +I
Sbjct: 407 LKEAQNINTSLLVLGRCLKSIHEGQLSKQKIEHIGPFRESKLTRLFQKALSGKEHIV-LI 465
Query: 298 VNVNASPAYAEETVQVLKISSVARDLLTVAKPRHLPPPPRKKTRFSIMAARNL----DWR 353
VN+N P ET VL S++A+ ++ + H + K+RFS + +++ DW
Sbjct: 466 VNINPIPNLYIETQNVLNFSAIAKKIVIEKEKVH-----KNKSRFSQIVTQSIKTVTDWD 520
Query: 354 ESDIVFQERASGEMTDYFQGSHDDPYETIRLLEARLAEFEGFD---------KKEF---- 400
+++ +E +Q + DD + + FE +D KKE
Sbjct: 521 ATELESEE---------WQNTVDD------ISTSDYVRFEKYDELMSENERLKKEISVLK 565
Query: 401 ------EYQIREEYREVQEDFRKMFEEQQTDWENNVKKLREQHEEDLERQRK----FYKT 450
+ QIR+ E+ + + M ++ + +W+N++K + +Q E+ L+ K FYK
Sbjct: 566 SSALTRDLQIRQ---EMADTYTSMMKKLEIEWKNHIKDVEQQQEDVLQWSVKQVEEFYKQ 622
Query: 451 QIETLMTLVKNQQA--EDDSEDETLNESAIEAQH---KLKIQNLKQELSELEAKYKSLSE 505
+++ L + + + ++S+D + N +E ++ K K+ +LK ++ EL+ ++L
Sbjct: 623 KLDQLSCRKRRRSSLGINNSDDYSRNIEELEIKNSHLKSKVVSLKIDMKELKETNQTLMV 682
Query: 506 EHEDMSGKLKELTREN----RDLVTKNKELEGKVAQLSRRVEEMERGAQTENKPEEVKYL 561
E + +L LT+E+ ++L+ ++ + +EE++ +Q K E+VK L
Sbjct: 683 EKNNAIFELA-LTKEDLKNIKNLLNAAQQDICSDEDTNYYIEELK--SQLFAKQEQVKKL 739
Query: 562 KSLLDEAKEEFKEQTTEIEQLRSEVEKLSEERRLLTVRSAELEYELEQRDYLIAVKTDGA 621
K L+EAKE++ TTE+ + E+++ EE +LE L + ++ K
Sbjct: 740 KVFLNEAKEDYISITTEMREKEYEIKEQKEELFEKQETIDDLEANLTHINMCLSEKIKII 799
Query: 622 EELQEKLDY-------MENKFQEE 638
++L+EKLD ENK QE+
Sbjct: 800 DQLEEKLDNQNKKIVDYENKMQEQ 823
|
Source: Apis mellifera Species: Apis mellifera Genus: Apis Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|383850798|ref|XP_003700961.1| PREDICTED: uncharacterized protein LOC100880447 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|340710761|ref|XP_003393954.1| PREDICTED: hypothetical protein LOC100650916 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350409973|ref|XP_003488905.1| PREDICTED: hypothetical protein LOC100749477 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|307197892|gb|EFN78991.1| Kinesin-like protein KIF20A [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|322798360|gb|EFZ20088.1| hypothetical protein SINV_04881 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|242024707|ref|XP_002432768.1| rabkinesin-6, putative [Pediculus humanus corporis] gi|212518253|gb|EEB20030.1| rabkinesin-6, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|345497647|ref|XP_001600225.2| PREDICTED: hypothetical protein LOC100115522 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|328725064|ref|XP_001944759.2| PREDICTED: kinesin-like protein KIF20A-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|332030759|gb|EGI70435.1| Kinesin-like protein KIF20A [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 932 | ||||||
| UNIPROTKB|F1N8T6 | 617 | LOC430761 "Uncharacterized pro | 0.389 | 0.588 | 0.306 | 7e-53 | |
| UNIPROTKB|F1N8T5 | 786 | LOC430761 "Uncharacterized pro | 0.475 | 0.563 | 0.296 | 5.1e-45 | |
| UNIPROTKB|F1SCX7 | 1828 | KIF20B "Uncharacterized protei | 0.854 | 0.435 | 0.242 | 4.8e-44 | |
| UNIPROTKB|F1NLI8 | 881 | KIF20A "Uncharacterized protei | 0.471 | 0.498 | 0.286 | 6.6e-43 | |
| UNIPROTKB|F1RH90 | 890 | KIF20A "Uncharacterized protei | 0.449 | 0.470 | 0.266 | 1e-42 | |
| UNIPROTKB|B4DL79 | 872 | KIF20A "Kinesin-like protein K | 0.409 | 0.438 | 0.276 | 5.8e-41 | |
| UNIPROTKB|Q29RT6 | 888 | KIF20A "Kinesin-like protein K | 0.436 | 0.458 | 0.278 | 6.7e-41 | |
| UNIPROTKB|O95235 | 890 | KIF20A "Kinesin-like protein K | 0.409 | 0.429 | 0.276 | 1.1e-40 | |
| UNIPROTKB|G3MX17 | 1712 | G3MX17 "Uncharacterized protei | 0.871 | 0.474 | 0.244 | 3.7e-40 | |
| UNIPROTKB|E2QUT0 | 1819 | KIF20B "Uncharacterized protei | 0.855 | 0.438 | 0.234 | 3.6e-39 |
| UNIPROTKB|F1N8T6 LOC430761 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 449 (163.1 bits), Expect = 7.0e-53, Sum P(2) = 7.0e-53
Identities = 117/382 (30%), Positives = 196/382 (51%)
Query: 119 ELFQNIVHNMLE--RYLNGEDALLFSFGTTNSGKTFTIQDLTYVNVHSCEEAYRVLRFGK 176
E++ V+++L L + + G ++ I+DL ++N+ S EE ++L+ G
Sbjct: 250 EIYNEYVYDLLSVLSTLKNQRRRVLRICEDQGGNSY-IKDLKWINIQSTEEGCKILKIGN 308
Query: 177 SHLSVAPTELNHRSSRSHCVFSIKL-VKVDPGSEELIMMSSFDICDLAGAERQKRAHTSG 235
+ S A T +N +SSRSH +FSI+L + D ++ +S CDLAG+ER + G
Sbjct: 309 KNRSFACTRMNEQSSRSHSIFSIRLLILTDEHQPHVLGVSELTFCDLAGSERCNKTQAFG 368
Query: 236 DRLREARTINSSLHVLARCFNVLRENNGLKADKKKLIPFRDSKLTQIFQRSLSGLSSTVK 295
DRL+EA IN+SLH+L +C L++N K K IPFR+SKLT++FQ G
Sbjct: 369 DRLKEAGNINNSLHILGKCIAALKQNQNPKM-KPSYIPFRESKLTRLFQPFFCGKGKAC- 426
Query: 296 MIVNVNASPAYAEETVQVLKISSVARDLLTVAXXXXXXXXXXXXXXFSIMAARNLDWRES 355
MIVN+N + +ET+ V+K S++A+ + F + + + D+ +S
Sbjct: 427 MIVNINQHASTYDETLHVMKFSAIAKQVRAHLISLVIQTVLPKSLGFDVNTSVD-DFPDS 485
Query: 356 DIVFQERASGEMTDYFQGSHDDPYETIRLLEARLAEFEGFDKKEFEYQIREEYREVQEDF 415
+ F E E D SH+D +T L+ +L E K E IR E E F
Sbjct: 486 NETFAE----EEVDITILSHEDLLKTAENLKEKLVA-ERQSKLLLEVNIRREMAEAM--F 538
Query: 416 RKMFEEQQTDWENNVKKLREQHEEDLERQRKFYKTQIETLMTLVKNQQAEDDSEDETLNE 475
R++ E ++ W N ++ +++ +EE LE + + YK I+ + +Q ++ + E LNE
Sbjct: 539 RQLLETEEA-WSNRLEDMKDSYEEKLESKFELYKEAIKKHAYMCAMEQKQE--KVEKLNE 595
Query: 476 SAIEAQHKLKIQNLKQELSELE 497
+ +EA + + +E S L+
Sbjct: 596 TVLEANEGYR--KMAEENSRLK 615
|
|
| UNIPROTKB|F1N8T5 LOC430761 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SCX7 KIF20B "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NLI8 KIF20A "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RH90 KIF20A "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4DL79 KIF20A "Kinesin-like protein KIF20A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q29RT6 KIF20A "Kinesin-like protein KIF20A" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O95235 KIF20A "Kinesin-like protein KIF20A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3MX17 G3MX17 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QUT0 KIF20B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 932 | |||
| cd00106 | 328 | cd00106, KISc, Kinesin motor domain | 6e-47 | |
| cd01368 | 345 | cd01368, KISc_KIF23_like, Kinesin motor domain, KI | 5e-45 | |
| pfam00225 | 326 | pfam00225, Kinesin, Kinesin motor domain | 5e-44 | |
| smart00129 | 335 | smart00129, KISc, Kinesin motor, catalytic domain | 6e-43 | |
| cd01366 | 329 | cd01366, KISc_C_terminal, Kinesin motor domain, KI | 9e-35 | |
| cd01365 | 356 | cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K | 3e-30 | |
| cd01370 | 338 | cd01370, KISc_KIP3_like, Kinesin motor domain, KIP | 4e-30 | |
| cd01372 | 341 | cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik | 3e-29 | |
| cd01364 | 352 | cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC | 8e-29 | |
| cd01371 | 333 | cd01371, KISc_KIF3, Kinesin motor domain, kinesins | 2e-27 | |
| cd01369 | 325 | cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine | 4e-27 | |
| cd01374 | 321 | cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E | 8e-27 | |
| cd01375 | 334 | cd01375, KISc_KIF9_like, Kinesin motor domain, KIF | 2e-24 | |
| cd01373 | 337 | cd01373, KISc_KLP2_like, Kinesin motor domain, KLP | 5e-24 | |
| cd01363 | 186 | cd01363, Motor_domain, Myosin and Kinesin motor do | 8e-24 | |
| cd01376 | 319 | cd01376, KISc_KID_like, Kinesin motor domain, KIF2 | 1e-22 | |
| COG5059 | 568 | COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | 1e-21 | |
| cd01367 | 322 | cd01367, KISc_KIF2_like, Kinesin motor domain, KIF | 5e-20 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-18 | |
| PLN03188 | 1320 | PLN03188, PLN03188, kinesin-12 family protein; Pro | 1e-14 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 4e-14 | |
| cd01368 | 345 | cd01368, KISc_KIF23_like, Kinesin motor domain, KI | 7e-14 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-13 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-13 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 4e-13 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 7e-13 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-12 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-12 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 5e-12 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-12 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 6e-12 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 4e-11 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-11 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-10 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-10 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-10 | |
| cd00106 | 328 | cd00106, KISc, Kinesin motor domain | 2e-10 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 2e-10 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-10 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 5e-10 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 6e-10 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 8e-10 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 9e-10 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 1e-09 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 9e-09 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 5e-08 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 8e-08 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 9e-08 | |
| pfam00225 | 326 | pfam00225, Kinesin, Kinesin motor domain | 2e-07 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-07 | |
| pfam07888 | 546 | pfam07888, CALCOCO1, Calcium binding and coiled-co | 2e-07 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 3e-07 | |
| TIGR00606 | 1311 | TIGR00606, rad50, rad50 | 4e-07 | |
| PRK05771 | 646 | PRK05771, PRK05771, V-type ATP synthase subunit I; | 4e-07 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 5e-07 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 5e-07 | |
| cd01376 | 319 | cd01376, KISc_KID_like, Kinesin motor domain, KIF2 | 2e-06 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-06 | |
| pfam05557 | 722 | pfam05557, MAD, Mitotic checkpoint protein | 2e-06 | |
| COG1579 | 239 | COG1579, COG1579, Zn-ribbon protein, possibly nucl | 2e-06 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 3e-06 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 3e-06 | |
| cd01364 | 352 | cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC | 5e-06 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 5e-06 | |
| TIGR00606 | 1311 | TIGR00606, rad50, rad50 | 6e-06 | |
| pfam10174 | 774 | pfam10174, Cast, RIM-binding protein of the cytoma | 6e-06 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 7e-06 | |
| PHA02562 | 562 | PHA02562, 46, endonuclease subunit; Provisional | 7e-06 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 7e-06 | |
| cd01370 | 338 | cd01370, KISc_KIP3_like, Kinesin motor domain, KIP | 1e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 1e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-05 | |
| pfam05667 | 536 | pfam05667, DUF812, Protein of unknown function (DU | 2e-05 | |
| smart00129 | 335 | smart00129, KISc, Kinesin motor, catalytic domain | 3e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 3e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 3e-05 | |
| TIGR00618 | 1042 | TIGR00618, sbcc, exonuclease SbcC | 3e-05 | |
| COG5185 | 622 | COG5185, HEC1, Protein involved in chromosome segr | 3e-05 | |
| cd01372 | 341 | cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik | 4e-05 | |
| TIGR00606 | 1311 | TIGR00606, rad50, rad50 | 4e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 6e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 6e-05 | |
| PLN03229 | 762 | PLN03229, PLN03229, acetyl-coenzyme A carboxylase | 6e-05 | |
| COG5059 | 568 | COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | 9e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-04 | |
| cd01369 | 325 | cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine | 2e-04 | |
| pfam07888 | 546 | pfam07888, CALCOCO1, Calcium binding and coiled-co | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| COG4717 | 984 | COG4717, COG4717, Uncharacterized conserved protei | 2e-04 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 2e-04 | |
| COG2433 | 652 | COG2433, COG2433, Uncharacterized conserved protei | 2e-04 | |
| TIGR03185 | 650 | TIGR03185, DNA_S_dndD, DNA sulfur modification pro | 3e-04 | |
| cd01371 | 333 | cd01371, KISc_KIF3, Kinesin motor domain, kinesins | 4e-04 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 4e-04 | |
| TIGR03185 | 650 | TIGR03185, DNA_S_dndD, DNA sulfur modification pro | 4e-04 | |
| COG5022 | 1463 | COG5022, COG5022, Myosin heavy chain [Cytoskeleton | 4e-04 | |
| PRK01156 | 895 | PRK01156, PRK01156, chromosome segregation protein | 4e-04 | |
| PRK01156 | 895 | PRK01156, PRK01156, chromosome segregation protein | 4e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 5e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 5e-04 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 5e-04 | |
| pfam00038 | 312 | pfam00038, Filament, Intermediate filament protein | 5e-04 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 5e-04 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 5e-04 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 7e-04 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 8e-04 | |
| pfam07227 | 446 | pfam07227, DUF1423, Protein of unknown function (D | 8e-04 | |
| cd01373 | 337 | cd01373, KISc_KLP2_like, Kinesin motor domain, KLP | 0.001 | |
| pfam10174 | 774 | pfam10174, Cast, RIM-binding protein of the cytoma | 0.001 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.001 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 0.001 | |
| pfam09789 | 319 | pfam09789, DUF2353, Uncharacterized coiled-coil pr | 0.001 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 0.001 | |
| cd01368 | 345 | cd01368, KISc_KIF23_like, Kinesin motor domain, KI | 0.002 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.002 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.002 | |
| pfam05557 | 722 | pfam05557, MAD, Mitotic checkpoint protein | 0.002 | |
| pfam10174 | 774 | pfam10174, Cast, RIM-binding protein of the cytoma | 0.002 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 0.002 | |
| pfam13514 | 1118 | pfam13514, AAA_27, AAA domain | 0.002 | |
| pfam09726 | 680 | pfam09726, Macoilin, Transmembrane protein | 0.002 | |
| pfam04156 | 186 | pfam04156, IncA, IncA protein | 0.002 | |
| COG4717 | 984 | COG4717, COG4717, Uncharacterized conserved protei | 0.003 | |
| TIGR01843 | 423 | TIGR01843, type_I_hlyD, type I secretion membrane | 0.003 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 0.004 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 0.004 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 0.004 |
| >gnl|CDD|238054 cd00106, KISc, Kinesin motor domain | Back alignment and domain information |
|---|
Score = 170 bits (434), Expect = 6e-47
Identities = 67/176 (38%), Positives = 99/176 (56%), Gaps = 7/176 (3%)
Query: 147 NSGKTFTIQDLTYVNVHSCEEAYRVLRFGKSHLSVAPTELNHRSSRSHCVFSIKLVKVD- 205
+ ++ LT V V S E+A +L+ G + + A T +N RSSRSH +F+I + + +
Sbjct: 159 DPKGGVYVKGLTEVEVGSAEDALSLLQKGLKNRTTASTAMNERSSRSHAIFTIHVEQRNT 218
Query: 206 PGSEELIMMSSFDICDLAGAERQKRAHTSGDRLREARTINSSLHVLARCFNVLRENNGLK 265
I S ++ DLAG+ER K+ GDRL+EA+ IN SL L + L
Sbjct: 219 TNDGRSIKSSKLNLVDLAGSERAKKTGAEGDRLKEAKNINKSLSALGNVISALSSGQ--- 275
Query: 266 ADKKKLIPFRDSKLTQIFQRSLSGLSSTVKMIVNVNASPAYAEETVQVLKISSVAR 321
KKK IP+RDSKLT++ Q SL G S T+ MI N++ S +ET+ L+ +S A+
Sbjct: 276 --KKKHIPYRDSKLTRLLQDSLGGNSKTL-MIANISPSSENYDETLSTLRFASRAK 328
|
This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type), in some its is found in the middle (M-type), or C-terminal (C-type). N-type and M-type kinesins are (+) end-directed motors, while C-type kinesins are (-) end-directed motors, i.e. they transport cargo towards the (-) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 Angstroms along the microtubule. Meanwhile, ATP hydrolysis takes place, and when the second head domain binds to the microtubule, the first domain again replaces ADP with ATP, triggering a conformational change that pulls the first domain forward. Length = 328 |
| >gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|238054 cd00106, KISc, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|116500 pfam07888, CALCOCO1, Calcium binding and coiled-coil domain (CALCOCO1) like | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129694 TIGR00606, rad50, rad50 | Back alignment and domain information |
|---|
| >gnl|CDD|235600 PRK05771, PRK05771, V-type ATP synthase subunit I; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218636 pfam05557, MAD, Mitotic checkpoint protein | Back alignment and domain information |
|---|
| >gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129694 TIGR00606, rad50, rad50 | Back alignment and domain information |
|---|
| >gnl|CDD|220614 pfam10174, Cast, RIM-binding protein of the cytomatrix active zone | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|222878 PHA02562, 46, endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|218681 pfam05667, DUF812, Protein of unknown function (DUF812) | Back alignment and domain information |
|---|
| >gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC | Back alignment and domain information |
|---|
| >gnl|CDD|227512 COG5185, HEC1, Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|129694 TIGR00606, rad50, rad50 | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|178768 PLN03229, PLN03229, acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|116500 pfam07888, CALCOCO1, Calcium binding and coiled-coil domain (CALCOCO1) like | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227061 COG4717, COG4717, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|234141 TIGR03185, DNA_S_dndD, DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|234141 TIGR03185, DNA_S_dndD, DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|200948 pfam00038, Filament, Intermediate filament protein | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|219342 pfam07227, DUF1423, Protein of unknown function (DUF1423) | Back alignment and domain information |
|---|
| >gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|220614 pfam10174, Cast, RIM-binding protein of the cytomatrix active zone | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220404 pfam09789, DUF2353, Uncharacterized coiled-coil protein (DUF2353) | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|218636 pfam05557, MAD, Mitotic checkpoint protein | Back alignment and domain information |
|---|
| >gnl|CDD|220614 pfam10174, Cast, RIM-binding protein of the cytomatrix active zone | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205692 pfam13514, AAA_27, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|220365 pfam09726, Macoilin, Transmembrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|217933 pfam04156, IncA, IncA protein | Back alignment and domain information |
|---|
| >gnl|CDD|227061 COG4717, COG4717, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|130902 TIGR01843, type_I_hlyD, type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 932 | |||
| KOG0243|consensus | 1041 | 100.0 | ||
| KOG4280|consensus | 574 | 100.0 | ||
| KOG0247|consensus | 809 | 100.0 | ||
| KOG0245|consensus | 1221 | 100.0 | ||
| KOG0240|consensus | 607 | 100.0 | ||
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 100.0 | |
| cd01368 | 345 | KISc_KIF23_like Kinesin motor domain, KIF23-like s | 100.0 | |
| cd01370 | 338 | KISc_KIP3_like Kinesin motor domain, KIP3-like sub | 100.0 | |
| cd01373 | 337 | KISc_KLP2_like Kinesin motor domain, KLP2-like sub | 100.0 | |
| KOG0241|consensus | 1714 | 100.0 | ||
| cd01365 | 356 | KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p | 100.0 | |
| cd01367 | 322 | KISc_KIF2_like Kinesin motor domain, KIF2-like gro | 100.0 | |
| KOG0242|consensus | 675 | 100.0 | ||
| cd01364 | 352 | KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind | 100.0 | |
| cd01371 | 333 | KISc_KIF3 Kinesin motor domain, kinesins II or KIF | 100.0 | |
| cd01369 | 325 | KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy | 100.0 | |
| cd01376 | 319 | KISc_KID_like Kinesin motor domain, KIF22/Kid-like | 100.0 | |
| KOG0246|consensus | 676 | 100.0 | ||
| cd01374 | 321 | KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like | 100.0 | |
| cd01372 | 341 | KISc_KIF4 Kinesin motor domain, KIF4-like subfamil | 100.0 | |
| KOG0239|consensus | 670 | 100.0 | ||
| cd01375 | 334 | KISc_KIF9_like Kinesin motor domain, KIF9-like sub | 100.0 | |
| KOG0244|consensus | 913 | 100.0 | ||
| cd01366 | 329 | KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ | 100.0 | |
| smart00129 | 335 | KISc Kinesin motor, catalytic domain. ATPase. Micr | 100.0 | |
| cd00106 | 328 | KISc Kinesin motor domain. This catalytic (head) d | 100.0 | |
| PF00225 | 335 | Kinesin: Kinesin motor domain; InterPro: IPR001752 | 100.0 | |
| COG5059 | 568 | KIP1 Kinesin-like protein [Cytoskeleton] | 100.0 | |
| cd01363 | 186 | Motor_domain Myosin and Kinesin motor domain. Thes | 100.0 | |
| KOG0933|consensus | 1174 | 99.69 | ||
| KOG0161|consensus | 1930 | 99.67 | ||
| KOG0161|consensus | 1930 | 99.64 | ||
| PRK02224 | 880 | chromosome segregation protein; Provisional | 99.58 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 99.58 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 99.55 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 99.49 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 99.47 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 99.45 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 99.45 | |
| KOG0996|consensus | 1293 | 99.44 | ||
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 99.41 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 99.41 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 99.4 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 99.38 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 99.37 | |
| KOG0250|consensus | 1074 | 99.37 | ||
| KOG0250|consensus | 1074 | 99.37 | ||
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 99.36 | |
| KOG4674|consensus | 1822 | 99.36 | ||
| KOG0996|consensus | 1293 | 99.35 | ||
| KOG4674|consensus | 1822 | 99.35 | ||
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 99.35 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 99.35 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 99.3 | |
| KOG0964|consensus | 1200 | 99.3 | ||
| KOG0964|consensus | 1200 | 99.21 | ||
| KOG0976|consensus | 1265 | 99.19 | ||
| KOG4643|consensus | 1195 | 99.17 | ||
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 99.16 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 99.16 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 99.11 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 99.09 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 99.09 | |
| KOG0933|consensus | 1174 | 99.08 | ||
| KOG0976|consensus | 1265 | 99.07 | ||
| KOG0971|consensus | 1243 | 99.06 | ||
| KOG4643|consensus | 1195 | 99.03 | ||
| KOG0971|consensus | 1243 | 99.02 | ||
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 98.9 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 98.89 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 98.88 | |
| KOG0977|consensus | 546 | 98.87 | ||
| KOG0994|consensus | 1758 | 98.86 | ||
| KOG4673|consensus | 961 | 98.85 | ||
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 98.83 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 98.82 | |
| KOG0612|consensus | 1317 | 98.81 | ||
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 98.81 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 98.8 | |
| KOG0612|consensus | 1317 | 98.78 | ||
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 98.78 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 98.73 | |
| KOG0995|consensus | 581 | 98.71 | ||
| KOG0247|consensus | 809 | 98.7 | ||
| KOG0994|consensus | 1758 | 98.68 | ||
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 98.67 | |
| KOG0995|consensus | 581 | 98.66 | ||
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 98.62 | |
| KOG1029|consensus | 1118 | 98.6 | ||
| KOG4673|consensus | 961 | 98.6 | ||
| KOG1029|consensus | 1118 | 98.48 | ||
| KOG0018|consensus | 1141 | 98.46 | ||
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 98.42 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 98.41 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 98.41 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 98.37 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 98.36 | |
| KOG0946|consensus | 970 | 98.36 | ||
| KOG0018|consensus | 1141 | 98.34 | ||
| KOG0963|consensus | 629 | 98.33 | ||
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 98.32 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 98.3 | |
| KOG0946|consensus | 970 | 98.28 | ||
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 98.18 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 98.09 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 98.03 | |
| KOG4593|consensus | 716 | 98.01 | ||
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 97.99 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 97.97 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 97.86 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 97.86 | |
| KOG0978|consensus | 698 | 97.84 | ||
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 97.83 | |
| KOG0980|consensus | 980 | 97.83 | ||
| KOG0980|consensus | 980 | 97.8 | ||
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 97.78 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 97.7 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 97.68 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 97.62 | |
| KOG0962|consensus | 1294 | 97.58 | ||
| KOG0978|consensus | 698 | 97.55 | ||
| KOG0963|consensus | 629 | 97.49 | ||
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 97.46 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 97.37 | |
| PF13514 | 1111 | AAA_27: AAA domain | 97.35 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 97.29 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 97.22 | |
| KOG1853|consensus | 333 | 97.2 | ||
| KOG0962|consensus | 1294 | 97.2 | ||
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 97.17 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 97.16 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 97.09 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 97.04 | |
| TIGR00618 | 1042 | sbcc exonuclease SbcC. This family is based on the | 96.94 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 96.89 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 96.85 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 96.83 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 96.81 | |
| COG5059 | 568 | KIP1 Kinesin-like protein [Cytoskeleton] | 96.68 | |
| KOG1899|consensus | 861 | 96.55 | ||
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 96.33 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 96.3 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 96.25 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 96.22 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 96.1 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 96.08 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 95.95 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 95.94 | |
| KOG0979|consensus | 1072 | 95.88 | ||
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 95.83 | |
| PF13514 | 1111 | AAA_27: AAA domain | 95.8 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 95.64 | |
| KOG2129|consensus | 552 | 95.62 | ||
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 95.48 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 95.46 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 95.33 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 95.32 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 95.19 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 95.17 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 95.11 | |
| TIGR00618 | 1042 | sbcc exonuclease SbcC. This family is based on the | 94.86 | |
| KOG0982|consensus | 502 | 94.75 | ||
| KOG4809|consensus | 654 | 94.39 | ||
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 94.34 | |
| KOG1850|consensus | 391 | 94.26 | ||
| KOG4360|consensus | 596 | 94.02 | ||
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 93.97 | |
| KOG0804|consensus | 493 | 93.82 | ||
| KOG0979|consensus | 1072 | 93.8 | ||
| KOG0804|consensus | 493 | 93.78 | ||
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 93.69 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 93.62 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 93.25 | |
| KOG0992|consensus | 613 | 93.11 | ||
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 92.96 | |
| KOG2129|consensus | 552 | 92.85 | ||
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 92.84 | |
| PRK12377 | 248 | putative replication protein; Provisional | 92.83 | |
| KOG4677|consensus | 554 | 92.62 | ||
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 92.3 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 92.13 | |
| PF13166 | 712 | AAA_13: AAA domain | 92.03 | |
| PF13166 | 712 | AAA_13: AAA domain | 91.89 | |
| KOG1850|consensus | 391 | 91.24 | ||
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 91.23 | |
| PRK06620 | 214 | hypothetical protein; Validated | 91.11 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 90.89 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 90.77 | |
| smart00242 | 677 | MYSc Myosin. Large ATPases. ATPase; molecular moto | 90.38 | |
| PF06637 | 442 | PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 Th | 90.35 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 90.32 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 90.19 | |
| PRK08116 | 268 | hypothetical protein; Validated | 90.16 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 89.9 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 89.72 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 89.7 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 89.56 | |
| COG4717 | 984 | Uncharacterized conserved protein [Function unknow | 89.4 | |
| PF10212 | 518 | TTKRSYEDQ: Predicted coiled-coil domain-containing | 89.28 | |
| KOG0982|consensus | 502 | 88.85 | ||
| PRK05642 | 234 | DNA replication initiation factor; Validated | 88.79 | |
| KOG2991|consensus | 330 | 88.76 | ||
| PRK09087 | 226 | hypothetical protein; Validated | 88.56 | |
| PLN02939 | 977 | transferase, transferring glycosyl groups | 88.47 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 87.72 | |
| PLN02939 | 977 | transferase, transferring glycosyl groups | 87.4 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 87.38 | |
| PRK06526 | 254 | transposase; Provisional | 87.34 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 87.3 | |
| cd01378 | 674 | MYSc_type_I Myosin motor domain, type I myosins. M | 87.04 | |
| KOG3859|consensus | 406 | 87.02 | ||
| PRK08181 | 269 | transposase; Validated | 86.76 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 86.75 | |
| cd00124 | 679 | MYSc Myosin motor domain. This catalytic (head) do | 86.62 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 86.32 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 86.18 | |
| KOG4677|consensus | 554 | 86.14 | ||
| cd01381 | 671 | MYSc_type_VII Myosin motor domain, type VII myosin | 85.92 | |
| PF08826 | 61 | DMPK_coil: DMPK coiled coil domain like; InterPro: | 85.8 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 85.73 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 85.36 | |
| cd01379 | 653 | MYSc_type_III Myosin motor domain, type III myosin | 85.24 | |
| KOG4460|consensus | 741 | 85.2 | ||
| cd01384 | 674 | MYSc_type_XI Myosin motor domain, plant-specific t | 84.78 | |
| KOG2991|consensus | 330 | 84.71 | ||
| PF15450 | 531 | DUF4631: Domain of unknown function (DUF4631) | 84.68 | |
| PRK08727 | 233 | hypothetical protein; Validated | 84.56 | |
| cd01377 | 693 | MYSc_type_II Myosin motor domain, type II myosins. | 84.47 | |
| PF04912 | 388 | Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit | 84.25 | |
| cd01380 | 691 | MYSc_type_V Myosin motor domain, type V myosins. M | 84.12 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 83.92 | |
| KOG0243|consensus | 1041 | 83.89 | ||
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 83.77 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 83.74 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 83.27 | |
| smart00053 | 240 | DYNc Dynamin, GTPase. Large GTPases that mediate v | 83.17 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 83.17 | |
| KOG1514|consensus | 767 | 82.88 | ||
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 82.82 | |
| cd01385 | 692 | MYSc_type_IX Myosin motor domain, type IX myosins. | 82.66 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 82.18 | |
| cd01382 | 717 | MYSc_type_VI Myosin motor domain, type VI myosins. | 81.17 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 81.15 | |
| cd01387 | 677 | MYSc_type_XV Myosin motor domain, type XV myosins. | 81.09 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 80.77 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 80.19 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 80.15 | |
| COG3096 | 1480 | MukB Uncharacterized protein involved in chromosom | 80.08 | |
| COG5008 | 375 | PilU Tfp pilus assembly protein, ATPase PilU [Cell | 80.02 |
| >KOG0243|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.9e-65 Score=580.27 Aligned_cols=259 Identities=29% Similarity=0.477 Sum_probs=236.7
Q ss_pred ccccCCCcccccCCCCceEEEeC-CCeEEEcCCCCccccCCCCCcceecceecCCCCChHHHHHHHHHHHHHHhcCCCCc
Q psy16994 60 QILNSFDQSYAGSTFENVLEVLD-QKSIMFKPMKDMKCSITDTCNLYRFSNIYGPHTTQAELFQNIVHNMLERYLNGEDA 138 (932)
Q Consensus 60 ~rvRp~~~~e~~~~~~~~~~~~~-~~~v~~~~~~~~~~~~~~~~~~f~fd~v~~~~~~q~~v~~~~~~~~v~~~~~g~~~ 138 (932)
+||||++..|.......+|.+.+ +.-|++...- . ...-.+.|+||.||||.+.|.+||+.+|.|+|..|+.||||
T Consensus 55 vRcRp~n~~E~~~~s~~VVs~~~~~kEV~v~~~~--~--sk~~~k~ftFDkVFGpes~Q~d~Y~~~v~p~i~eVl~GyNC 130 (1041)
T KOG0243|consen 55 VRCRPRNDRERKSKSSVVVSCDGIRKEVAVRQTI--A--SKQIDKTFTFDKVFGPESQQEDLYDQAVSPIIKEVLEGYNC 130 (1041)
T ss_pred EEeCCCCchhhhcCCCeEEecCCCcceEEEeccc--c--cccccceeecceeeCcchhHHHHHHHHHHHHHHHHhccCCc
Confidence 39999999997766667777777 4446665431 0 11124589999999999999999999999999999999999
Q ss_pred eeeecccccCCCcEEEec--------------------------------------------------------------
Q psy16994 139 LLFSFGTTNSGKTFTIQD-------------------------------------------------------------- 156 (932)
Q Consensus 139 ~i~~~G~tgsGKt~t~~G-------------------------------------------------------------- 156 (932)
|||||||||+||||||.|
T Consensus 131 TIFAYGQTGTGKTyTMeG~~~~~~g~l~~~aGIIPRal~~IFd~Le~~~~EYsvKVSfLELYNEEl~DLLa~~~~~~~~~ 210 (1041)
T KOG0243|consen 131 TIFAYGQTGTGKTYTMEGGERKKNGELPSEAGIIPRALRQIFDTLEAQGAEYSVKVSFLELYNEELTDLLASEDTSDKKL 210 (1041)
T ss_pred eEEEecCCCCCceeeeecCcccccCCCCccCCcchHHHHHHHHHHHhcCCeEEEEEEehhhhhHHHHHhcCCcccccccc
Confidence 999999999999999999
Q ss_pred -------------------ceEEEecCHHHHHHHHHhhhhccccccccCccCCCCCccEEEEEEEEe--CCCCCcceeEE
Q psy16994 157 -------------------LTYVNVHSCEEAYRVLRFGKSHLSVAPTELNHRSSRSHCVFSIKLVKV--DPGSEELIMMS 215 (932)
Q Consensus 157 -------------------l~~~~v~s~~~~~~~l~~g~~~r~~~~t~~n~~ssrsh~i~~i~v~~~--~~~~~~~~~~s 215 (932)
+.+++|+++.|++.+|..|...|++++|.+|..|||||+||+|+|+.. .++|......|
T Consensus 211 ~~k~~~~~~~~kggV~vkGlEEi~V~~A~ei~klLekGs~kRrtAaTl~N~~SSRSHsIFsItvhike~t~~geelvK~G 290 (1041)
T KOG0243|consen 211 RIKDDSTIVDGKGGVIVKGLEEIIVTNADEIYKLLEKGSKKRRTAATLMNDQSSRSHSIFSITVHIKENTPEGEELVKIG 290 (1041)
T ss_pred ccccCCcccCCcCcEEEecceeeeecchhHHHHHHHhhhhHhHHHHHHhhhhccccceEEEEEEEEecCCCcchhhHhhc
Confidence 889999999999999999999999999999999999999999999887 44556778999
Q ss_pred EEEEEeCCCCccccccccchhhhHHHHHHHHHHHHHHHHHHHHHhccCCCCCCCCCccCCCCchHHhhhhhcCCCCCeeE
Q psy16994 216 SFDICDLAGAERQKRAHTSGDRLREARTINSSLHVLARCFNVLRENNGLKADKKKLIPFRDSKLTQIFQRSLSGLSSTVK 295 (932)
Q Consensus 216 ~l~~vDLagse~~~~~~~~~~~~~e~~~in~sl~~l~~~i~~l~~~~~~~~~~~~~vp~r~s~LT~ll~~~l~g~~~~~~ 295 (932)
+|+||||||||...++|+.+.|.+|+|.||+||.+||+||.||+++. .|||||+|||||||+|+|||.. +||
T Consensus 291 KLNLVDLAGSENI~RSGA~~~RArEAG~INqSLLTLGRVInALVe~s-------~HIPYRESKLTRLLQDSLGGkT-KT~ 362 (1041)
T KOG0243|consen 291 KLNLVDLAGSENISRSGARNGRAREAGEINQSLLTLGRVINALVEHS-------GHIPYRESKLTRLLQDSLGGKT-KTC 362 (1041)
T ss_pred ccceeeccccccccccccccchhHHhhhhhHHHHHHHHHHHHHHccC-------CCCCchHHHHHHHHHHHhCCCc-eeE
Confidence 99999999999999999999999999999999999999999999965 9999999999999999999999 999
Q ss_pred EEEecCCCcCcHHHHHHHHHHHHHhcccccccCCC
Q psy16994 296 MIVNVNASPAYAEETVQVLKISSVARDLLTVAKPR 330 (932)
Q Consensus 296 ~i~~~~p~~~~~~et~~~l~~~~~~~~i~~~~~~~ 330 (932)
||+||||+..+++||++||.||.||+.|+|+|..|
T Consensus 363 iIATiSPa~~~lEETlSTLEYA~RAKnIkNKPevN 397 (1041)
T KOG0243|consen 363 IIATISPAKHNLEETLSTLEYAHRAKNIKNKPEVN 397 (1041)
T ss_pred EEEEeCCCcccHHHHHHHHHHHHHhhhccCCCccc
Confidence 99999999999999999999999999999999865
|
|
| >KOG4280|consensus | Back alignment and domain information |
|---|
| >KOG0247|consensus | Back alignment and domain information |
|---|
| >KOG0245|consensus | Back alignment and domain information |
|---|
| >KOG0240|consensus | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >KOG0241|consensus | Back alignment and domain information |
|---|
| >cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >KOG0242|consensus | Back alignment and domain information |
|---|
| >cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >KOG0246|consensus | Back alignment and domain information |
|---|
| >cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >KOG0239|consensus | Back alignment and domain information |
|---|
| >cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >KOG0244|consensus | Back alignment and domain information |
|---|
| >cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >smart00129 KISc Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >cd00106 KISc Kinesin motor domain | Back alignment and domain information |
|---|
| >PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport | Back alignment and domain information |
|---|
| >COG5059 KIP1 Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01363 Motor_domain Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >KOG0933|consensus | Back alignment and domain information |
|---|
| >KOG0161|consensus | Back alignment and domain information |
|---|
| >KOG0161|consensus | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0996|consensus | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0250|consensus | Back alignment and domain information |
|---|
| >KOG0250|consensus | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG4674|consensus | Back alignment and domain information |
|---|
| >KOG0996|consensus | Back alignment and domain information |
|---|
| >KOG4674|consensus | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0964|consensus | Back alignment and domain information |
|---|
| >KOG0964|consensus | Back alignment and domain information |
|---|
| >KOG0976|consensus | Back alignment and domain information |
|---|
| >KOG4643|consensus | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG0933|consensus | Back alignment and domain information |
|---|
| >KOG0976|consensus | Back alignment and domain information |
|---|
| >KOG0971|consensus | Back alignment and domain information |
|---|
| >KOG4643|consensus | Back alignment and domain information |
|---|
| >KOG0971|consensus | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >KOG0977|consensus | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >KOG4673|consensus | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG0612|consensus | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >KOG0612|consensus | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG0995|consensus | Back alignment and domain information |
|---|
| >KOG0247|consensus | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >KOG0995|consensus | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >KOG4673|consensus | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >KOG0018|consensus | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG0946|consensus | Back alignment and domain information |
|---|
| >KOG0018|consensus | Back alignment and domain information |
|---|
| >KOG0963|consensus | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0946|consensus | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >KOG4593|consensus | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >KOG0978|consensus | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0980|consensus | Back alignment and domain information |
|---|
| >KOG0980|consensus | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >KOG0962|consensus | Back alignment and domain information |
|---|
| >KOG0978|consensus | Back alignment and domain information |
|---|
| >KOG0963|consensus | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >KOG1853|consensus | Back alignment and domain information |
|---|
| >KOG0962|consensus | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >TIGR00618 sbcc exonuclease SbcC | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >COG5059 KIP1 Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1899|consensus | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG0979|consensus | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >KOG2129|consensus | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >TIGR00618 sbcc exonuclease SbcC | Back alignment and domain information |
|---|
| >KOG0982|consensus | Back alignment and domain information |
|---|
| >KOG4809|consensus | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG1850|consensus | Back alignment and domain information |
|---|
| >KOG4360|consensus | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG0804|consensus | Back alignment and domain information |
|---|
| >KOG0979|consensus | Back alignment and domain information |
|---|
| >KOG0804|consensus | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >KOG0992|consensus | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >KOG2129|consensus | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >KOG4677|consensus | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >KOG1850|consensus | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >smart00242 MYSc Myosin | Back alignment and domain information |
|---|
| >PF06637 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >COG4717 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif | Back alignment and domain information |
|---|
| >KOG0982|consensus | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >KOG2991|consensus | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >cd01378 MYSc_type_I Myosin motor domain, type I myosins | Back alignment and domain information |
|---|
| >KOG3859|consensus | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >cd00124 MYSc Myosin motor domain | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG4677|consensus | Back alignment and domain information |
|---|
| >cd01381 MYSc_type_VII Myosin motor domain, type VII myosins | Back alignment and domain information |
|---|
| >PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >cd01379 MYSc_type_III Myosin motor domain, type III myosins | Back alignment and domain information |
|---|
| >KOG4460|consensus | Back alignment and domain information |
|---|
| >cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport | Back alignment and domain information |
|---|
| >KOG2991|consensus | Back alignment and domain information |
|---|
| >PF15450 DUF4631: Domain of unknown function (DUF4631) | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd01377 MYSc_type_II Myosin motor domain, type II myosins | Back alignment and domain information |
|---|
| >PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [] | Back alignment and domain information |
|---|
| >cd01380 MYSc_type_V Myosin motor domain, type V myosins | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >KOG0243|consensus | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >smart00053 DYNc Dynamin, GTPase | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >KOG1514|consensus | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >cd01385 MYSc_type_IX Myosin motor domain, type IX myosins | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >cd01382 MYSc_type_VI Myosin motor domain, type VI myosins | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >cd01387 MYSc_type_XV Myosin motor domain, type XV myosins | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 932 | ||||
| 3b6u_A | 372 | Crystal Structure Of The Motor Domain Of Human Kine | 3e-21 | ||
| 1goj_A | 355 | Structure Of A Fast Kinesin: Implications For Atpas | 2e-19 | ||
| 4aqv_C | 373 | Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma | 3e-19 | ||
| 4ap0_A | 370 | The Mitotic Kinesin Eg5 In Complex With Mg-Adp And | 5e-19 | ||
| 1q0b_A | 367 | Crystal Structure Of The Motor Protein Ksp In Compl | 5e-19 | ||
| 4a28_A | 368 | Eg5-2 Length = 368 | 5e-19 | ||
| 1ii6_A | 368 | Crystal Structure Of The Mitotic Kinesin Eg5 In Com | 5e-19 | ||
| 3hqd_A | 369 | Human Kinesin Eg5 Motor Domain In Complex With Ampp | 6e-19 | ||
| 1x88_A | 359 | Human Eg5 Motor Domain Bound To Mg-Adp And Monastro | 6e-19 | ||
| 4a1z_A | 368 | Eg5-1 Length = 368 | 6e-19 | ||
| 2owm_A | 443 | Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 | 8e-19 | ||
| 3zcw_A | 348 | Eg5 - New Allosteric Binding Site Length = 348 | 1e-18 | ||
| 2h58_A | 330 | Crystal Structure Of The Kifc3 Motor Domain In Comp | 3e-18 | ||
| 4gkr_A | 371 | Structure Of The C-Terminal Motor Domain Of Kar3 Fr | 6e-18 | ||
| 4a14_A | 344 | Human Kif7, A Kinesin Involved In Hedgehog Signalli | 9e-18 | ||
| 2wbe_C | 373 | Kinesin-5-Tubulin Complex With Amppnp Length = 373 | 1e-17 | ||
| 4etp_A | 403 | C-Terminal Motor And Motor Homology Domain Of Kar3v | 2e-17 | ||
| 4h1g_A | 715 | Structure Of Candida Albicans Kar3 Motor Domain Fus | 9e-17 | ||
| 1f9t_A | 358 | Crystal Structures Of Kinesin Mutants Reveal A Sign | 9e-17 | ||
| 3kar_A | 346 | The Motor Domain Of Kinesin-Like Protein Kar3, A Sa | 1e-16 | ||
| 3h4s_A | 386 | Structure Of The Complex Of A Mitotic Kinesin With | 1e-16 | ||
| 3lre_A | 355 | Crystal Structure Analysis Of Human Kinesin-8 Motor | 1e-16 | ||
| 3gbj_A | 354 | Crystal Structure Of The Motor Domain Of Kinesin Ki | 1e-16 | ||
| 3t0q_A | 349 | Motor Domain Structure Of The Kar3-Like Kinesin Fro | 2e-16 | ||
| 1f9w_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 5e-16 | ||
| 2xt3_A | 344 | Human Kif7, A Kinesin Involved In Hedgehog Signalli | 7e-16 | ||
| 1f9v_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 7e-16 | ||
| 1f9u_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 8e-16 | ||
| 1sdm_A | 369 | Crystal Structure Of Kinesin-Like Calmodulin Bindin | 1e-15 | ||
| 1t5c_A | 349 | Crystal Structure Of The Motor Domain Of Human Kine | 1e-15 | ||
| 2y5w_A | 365 | Crystal Structure Of Drosophila Melanogaster Kinesi | 3e-15 | ||
| 3nwn_A | 359 | Crystal Structure Of The Human Kif9 Motor Domain In | 6e-15 | ||
| 2vvg_A | 350 | Crystal Structure Of The G.Intestinalis Kinesin 2 G | 1e-14 | ||
| 1ia0_K | 394 | Kif1a Head-Microtubule Complex Structure In Atp-For | 4e-14 | ||
| 3bfn_A | 388 | Crystal Structure Of The Motor Domain Of Human Kine | 6e-14 | ||
| 1i5s_A | 367 | Crystal Structure Of The Kif1a Motor Domain Complex | 7e-14 | ||
| 2rep_A | 376 | Crystal Structure Of The Motor Domain Of Human Kine | 9e-14 | ||
| 1i6i_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 1e-13 | ||
| 1vfv_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 1e-13 | ||
| 3b6v_A | 395 | Crystal Structure Of The Motor Domain Of Human Kine | 2e-13 | ||
| 4atx_C | 340 | Rigor Kinesin Motor Domain With An Ordered Neck-Lin | 2e-12 | ||
| 1mkj_A | 349 | Human Kinesin Motor Domain With Docked Neck Linker | 2e-12 | ||
| 1bg2_A | 325 | Human Ubiquitous Kinesin Motor Domain Length = 325 | 2e-12 | ||
| 2gry_A | 420 | Crystal Structure Of The Human Kif2 Motor Domain In | 3e-11 | ||
| 2ncd_A | 420 | Ncd (Non-Claret Disjunctional) Dimer From D. Melano | 8e-10 | ||
| 2heh_A | 387 | Crystal Structure Of The Kif2c Motor Domain (Casp T | 9e-10 | ||
| 3u06_A | 412 | Crystal Structure Of The Kinesin-14 Ncdg347d Length | 1e-09 | ||
| 1cz7_A | 406 | The Crystal Structure Of A Minus-End Directed Micro | 1e-09 | ||
| 3l1c_A | 383 | Kinesin-14 Protein Ncd, T436s Mutant Length = 383 | 1e-09 | ||
| 1n6m_A | 409 | Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY | 7e-09 | ||
| 1v8j_A | 410 | The Crystal Structure Of The Minimal Functional Dom | 1e-08 | ||
| 3edl_D | 331 | Kinesin13-Microtubule Ring Complex Length = 331 | 2e-08 | ||
| 3pxn_A | 344 | Crystal Structure Of The Drosophila Kinesin Family | 4e-08 | ||
| 1ry6_A | 360 | Crystal Structure Of Internal Kinesin Motor Domain | 5e-08 | ||
| 3dc4_A | 344 | Crystal Structure Of The Drosophila Kinesin Family | 1e-07 |
| >pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 | Back alignment and structure |
|
| >pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 | Back alignment and structure |
| >pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 | Back alignment and structure |
| >pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 | Back alignment and structure |
| >pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 | Back alignment and structure |
| >pdb|4A28|A Chain A, Eg5-2 Length = 368 | Back alignment and structure |
| >pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 | Back alignment and structure |
| >pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 | Back alignment and structure |
| >pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 | Back alignment and structure |
| >pdb|4A1Z|A Chain A, Eg5-1 Length = 368 | Back alignment and structure |
| >pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 | Back alignment and structure |
| >pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 | Back alignment and structure |
| >pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 | Back alignment and structure |
| >pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 | Back alignment and structure |
| >pdb|4A14|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 | Back alignment and structure |
| >pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 | Back alignment and structure |
| >pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 | Back alignment and structure |
| >pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 | Back alignment and structure |
| >pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 | Back alignment and structure |
| >pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 | Back alignment and structure |
| >pdb|3H4S|A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator Length = 386 | Back alignment and structure |
| >pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 | Back alignment and structure |
| >pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 | Back alignment and structure |
| >pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 | Back alignment and structure |
| >pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|2XT3|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 | Back alignment and structure |
| >pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 | Back alignment and structure |
| >pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 | Back alignment and structure |
| >pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 | Back alignment and structure |
| >pdb|3NWN|A Chain A, Crystal Structure Of The Human Kif9 Motor Domain In Complex With Adp Length = 359 | Back alignment and structure |
| >pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 | Back alignment and structure |
| >pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 | Back alignment and structure |
| >pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 | Back alignment and structure |
| >pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 | Back alignment and structure |
| >pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 | Back alignment and structure |
| >pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 | Back alignment and structure |
| >pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 | Back alignment and structure |
| >pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 | Back alignment and structure |
| >pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 | Back alignment and structure |
| >pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 | Back alignment and structure |
| >pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 | Back alignment and structure |
| >pdb|2GRY|A Chain A, Crystal Structure Of The Human Kif2 Motor Domain In Complex With Adp Length = 420 | Back alignment and structure |
| >pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 | Back alignment and structure |
| >pdb|2HEH|A Chain A, Crystal Structure Of The Kif2c Motor Domain (Casp Target) Length = 387 | Back alignment and structure |
| >pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 | Back alignment and structure |
| >pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 | Back alignment and structure |
| >pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 | Back alignment and structure |
| >pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 | Back alignment and structure |
| >pdb|1V8J|A Chain A, The Crystal Structure Of The Minimal Functional Domain Of The Microtubule Destabilizer Kif2c Complexed With Mg-adp Length = 410 | Back alignment and structure |
| >pdb|3EDL|D Chain D, Kinesin13-Microtubule Ring Complex Length = 331 | Back alignment and structure |
| >pdb|3PXN|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Kin10NOD IN Complex With Divalent Manganese And Adp Length = 344 | Back alignment and structure |
| >pdb|1RY6|A Chain A, Crystal Structure Of Internal Kinesin Motor Domain Length = 360 | Back alignment and structure |
| >pdb|3DC4|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Nod In Complex With Adp Length = 344 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 932 | |||
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 2e-41 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 6e-41 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 1e-39 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 2e-39 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 4e-39 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 2e-38 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 2e-07 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 3e-38 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 5e-06 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 4e-38 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 3e-06 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 6e-38 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 3e-04 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 6e-38 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 6e-06 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 7e-38 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 2e-37 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 5e-06 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 4e-37 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 5e-06 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 1e-36 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 4e-06 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 2e-36 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 4e-06 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 2e-36 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 4e-36 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 2e-05 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 7e-36 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 2e-05 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 8e-36 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 4e-35 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 1e-05 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 1e-34 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 2e-34 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 3e-06 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 4e-34 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 2e-05 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 5e-34 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 1e-30 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 3e-06 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 9e-30 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 5e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-21 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 8e-21 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-18 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-16 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-18 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-15 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-14 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-06 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-15 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 6e-13 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 4e-11 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-10 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-10 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-10 | |
| 2kin_B | 100 | Kinesin; motor protein, cytoskeleton; HET: ADP; 2. | 4e-12 | |
| 3kin_B | 117 | Kinesin heavy chain; motor protein, cytoskeleton; | 7e-10 | |
| 1cii_A | 602 | Colicin IA; bacteriocin, ION channel formation, tr | 6e-09 | |
| 1cii_A | 602 | Colicin IA; bacteriocin, ION channel formation, tr | 5e-05 | |
| 2xs1_A | 704 | Programmed cell death 6-interacting protein; prote | 5e-08 | |
| 2xs1_A | 704 | Programmed cell death 6-interacting protein; prote | 4e-05 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 3e-07 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 3e-05 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 2e-04 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 4e-07 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 5e-07 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 9e-07 | |
| 3ghg_C | 411 | Fibrinogen gamma chain; triple-stranded coiled coi | 2e-05 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 3e-05 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 9e-04 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 4e-05 | |
| 3iyk_A | 526 | VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongu | 2e-04 | |
| 3iyk_A | 526 | VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongu | 2e-04 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 2e-04 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 4e-04 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 4e-04 | |
| 4dvy_P | 877 | Cytotoxicity-associated immunodominant antigen; on | 5e-04 |
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 | Back alignment and structure |
|---|
Score = 154 bits (392), Expect = 2e-41
Identities = 59/167 (35%), Positives = 87/167 (52%), Gaps = 6/167 (3%)
Query: 149 GKTFTIQDLTYVNVHSCEEAYRVLRFGKSHLSVAPTELNHRSSRSHCVFSIKLVKVDPGS 208
KT TI ++T + S E +L+ S A T N SS SH +F I L + +
Sbjct: 173 TKTTTITNVTSCKLESEEMVEIILKKANKLRSTASTASNEHSSASHSIFIIHLSGSNAKT 232
Query: 209 EELIMMSSFDICDLAGAERQKRAHTSGDRLREARTINSSLHVLARCFNVLRENNGLKADK 268
+ ++ DLAG+ER + GDRLRE + IN SL L + L + +
Sbjct: 233 GA-HSYGTLNLVDLAGSERINVSQVVGDRLRETQNINKSLSCLGDVIHALGQPDS----T 287
Query: 269 KKLIPFRDSKLTQIFQRSLSGLSSTVKMIVNVNASPAYAEETVQVLK 315
K+ IPFR+SKLT + Q SL+G S T+ M VN++ S ++ ET+ L+
Sbjct: 288 KRHIPFRNSKLTYLLQYSLTGDSKTL-MFVNISPSSSHINETLNSLR 333
|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Length = 100 | Back alignment and structure |
|---|
| >3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Length = 117 | Back alignment and structure |
|---|
| >1cii_A Colicin IA; bacteriocin, ION channel formation, transmembrane protein; 3.00A {Escherichia coli} SCOP: f.1.1.1 h.4.3.1 Length = 602 | Back alignment and structure |
|---|
| >1cii_A Colicin IA; bacteriocin, ION channel formation, transmembrane protein; 3.00A {Escherichia coli} SCOP: f.1.1.1 h.4.3.1 Length = 602 | Back alignment and structure |
|---|
| >2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 | Back alignment and structure |
|---|
| >2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 | Back alignment and structure |
|---|
| >3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C Length = 411 | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3iyk_A VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongue virus} Length = 526 | Back alignment and structure |
|---|
| >3iyk_A VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongue virus} Length = 526 | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Length = 256 | Back alignment and structure |
|---|
| >4dvy_P Cytotoxicity-associated immunodominant antigen; oncoprotein; 3.30A {Helicobacter pylori} Length = 877 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 932 | |||
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 100.0 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 100.0 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 100.0 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 100.0 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 100.0 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 100.0 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 100.0 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 100.0 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 100.0 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 100.0 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 100.0 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 100.0 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 100.0 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 100.0 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 100.0 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 100.0 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 100.0 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 100.0 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 100.0 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 100.0 | |
| 3nwn_A | 359 | Kinesin-like protein KIF9; motor domain, ADP, stru | 100.0 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 100.0 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 100.0 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 100.0 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 100.0 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 100.0 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 100.0 | |
| 4h1g_A | 715 | Maltose binding protein-cakar3 motor domain fusio; | 100.0 | |
| 2kin_B | 100 | Kinesin; motor protein, cytoskeleton; HET: ADP; 2. | 99.92 | |
| 3kin_B | 117 | Kinesin heavy chain; motor protein, cytoskeleton; | 99.88 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 99.44 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 99.27 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 99.26 | |
| 2o0a_A | 298 | S.cerevisiae chromosome XVI reading frame ORF YPL2 | 99.14 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.84 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 97.48 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 97.38 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 97.35 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 96.69 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 96.27 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 95.09 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 94.66 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 94.19 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 93.44 | |
| 4gkw_A | 167 | Spindle assembly abnormal protein 6; double helix, | 93.02 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 92.38 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 91.89 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 89.98 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 89.43 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 87.34 | |
| 2w83_C | 77 | C-JUN-amino-terminal kinase-interacting protein 4; | 86.54 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 85.31 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 84.08 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 83.99 | |
| 3cvf_A | 79 | Homer-3, homer protein homolog 3; coiled coil, alt | 82.74 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 82.14 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 81.81 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 81.45 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 80.05 |
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} | Back alignment and structure |
|---|
Probab=100.00 E-value=6.3e-65 Score=542.35 Aligned_cols=271 Identities=25% Similarity=0.418 Sum_probs=213.4
Q ss_pred cccccccccccccCCCcccccCCCCceEEEe-CCCeEEEcCCCCc--cccCCCCCcceecceecCCCCChHHHHHHHHHH
Q psy16994 51 RVQAFDVKKQILNSFDQSYAGSTFENVLEVL-DQKSIMFKPMKDM--KCSITDTCNLYRFSNIYGPHTTQAELFQNIVHN 127 (932)
Q Consensus 51 ~~~~~~~~~~rvRp~~~~e~~~~~~~~~~~~-~~~~v~~~~~~~~--~~~~~~~~~~f~fd~v~~~~~~q~~v~~~~~~~ 127 (932)
++.|++ |+||+++.|...+...|+.+. +..+|.+.+|... ..........|.||+||++.++|.+||+.++.|
T Consensus 5 ~i~V~v----RvRP~~~~E~~~~~~~~v~~~~~~~~v~v~~~~~~~~~~~~~~~~~~f~FD~Vf~~~~~Q~~Vy~~~~~p 80 (350)
T 2vvg_A 5 NIKVIV----RCRPLNARETRENALNIIRMDEASAQVIVDPPEQEKSATQAKKVPRTFTFDAVYDQTSCNYGIFQASFKP 80 (350)
T ss_dssp BCEEEE----EECCCCHHHHHTTCCBCEEEEGGGTEEEECC--------------EEEECSEEECTTCCHHHHHHHTTHH
T ss_pred CeEEEE----EeCCCChhhhccCCceEEEEcCCCCEEEEeeccccccccccCCCceEeeCCEEECCCcchhHHHHHHHHH
Confidence 455555 999999999766777788765 4568888877521 111123345899999999999999999999999
Q ss_pred HHHHhcCCCCceeeecccccCCCcEEEec---------------------------------------------------
Q psy16994 128 MLERYLNGEDALLFSFGTTNSGKTFTIQD--------------------------------------------------- 156 (932)
Q Consensus 128 ~v~~~~~g~~~~i~~~G~tgsGKt~t~~G--------------------------------------------------- 156 (932)
+|+++++|||+||||||||||||||||.|
T Consensus 81 lv~~~l~G~n~tifAYGqTGSGKTyTm~G~~~~~Giipr~~~~lF~~i~~~~~~~~~~v~vS~~EIYnE~i~DLL~~~~~ 160 (350)
T 2vvg_A 81 LIDAVLEGFNSTIFAYGQTGAGKTWTMGGNKEEPGAIPNSFKHLFDAINSSSSNQNFLVIGSYLELYNEEIRDLIKNNTK 160 (350)
T ss_dssp HHHHHHTTCCEEEEEECSTTSSHHHHHTBCSSSBCHHHHHHHHHHHHHHTCCTTEEEEEEEEEEEEETTEEEETTTTEEE
T ss_pred HHHHHhCCCceeEEeecCCCCCCCEEeecCCccCchHHHHHHHHHHHHHhhccCCcEEEEEEEEEEeCCEEEEcccCCcC
Confidence 99999999999999999999999999998
Q ss_pred ---------------ceEEEecCHHHHHHHHHhhhhccccccccCccCCCCCccEEEEEEEEeCCC-CCcceeEEEEEEE
Q psy16994 157 ---------------LTYVNVHSCEEAYRVLRFGKSHLSVAPTELNHRSSRSHCVFSIKLVKVDPG-SEELIMMSSFDIC 220 (932)
Q Consensus 157 ---------------l~~~~v~s~~~~~~~l~~g~~~r~~~~t~~n~~ssrsh~i~~i~v~~~~~~-~~~~~~~s~l~~v 220 (932)
++++.|.|++|++.+|..|..+|++++|.+|..|||||+||+|+|.+.... +......|+|+||
T Consensus 161 l~i~e~~~~~~~v~gl~~~~v~s~~e~~~ll~~g~~~R~~~~T~~N~~SSRSH~if~i~v~~~~~~~~~~~~~~skl~lV 240 (350)
T 2vvg_A 161 LPLKEDKTRGIYVDGLSMHRVTTAAELSALMDKGFANRHVAATQMNDTSSRSHSIFMVRIECSEVIENKEVIRVGKLNLV 240 (350)
T ss_dssp ECEEEETTTEEEETTCCCEEESSHHHHHHHHHHHHHHC----------CTTCEEEEEEEEEEEEC----CEEEEEEEEEE
T ss_pred ceeeEcCCCCEEecCCEEEEcCCHHHHHHHHHHHHhccccccccCCCCCCcceEEEEEEEEEeeccCCCccEEEEEEEEE
Confidence 788999999999999999999999999999999999999999999987443 3345678999999
Q ss_pred eCCCCccccccccchhhhHHHHHHHHHHHHHHHHHHHHHhccCCCCCCCCCccCCCCchHHhhhhhcCCCCCeeEEEEec
Q psy16994 221 DLAGAERQKRAHTSGDRLREARTINSSLHVLARCFNVLRENNGLKADKKKLIPFRDSKLTQIFQRSLSGLSSTVKMIVNV 300 (932)
Q Consensus 221 DLagse~~~~~~~~~~~~~e~~~in~sl~~l~~~i~~l~~~~~~~~~~~~~vp~r~s~LT~ll~~~l~g~~~~~~~i~~~ 300 (932)
|||||||..++++.|.+++|+.+||+||++||+||.+|..++ .|||||+||||+||+|+|||++ +|+||+||
T Consensus 241 DLAGSEr~~~t~~~g~rl~E~~~IN~SL~aLg~vI~aL~~~~-------~hvPyRdSkLT~lLqdsLgGns-kt~mI~~i 312 (350)
T 2vvg_A 241 DLAGSERQSKTGATGETLVEGAKINLSLSALGLVISKLVEGA-------THIPYRDSKLTRLLQDSLGGNS-KTLMCANI 312 (350)
T ss_dssp ECCCCCC---------------CTTHHHHHHHHHHHHHHHTC-------SSCCGGGCHHHHHTTTTTTSSS-EEEEEEEE
T ss_pred eCCCCCccccccccHHHHHHHHHHhHHHHHHHHHHHHHHcCC-------CCCCccccHHHHHHHHhcCCCc-cEEEEEEe
Confidence 999999999999999999999999999999999999999864 8999999999999999999999 99999999
Q ss_pred CCCcCcHHHHHHHHHHHHHhcccccccCCCCCC
Q psy16994 301 NASPAYAEETVQVLKISSVARDLLTVAKPRHLP 333 (932)
Q Consensus 301 ~p~~~~~~et~~~l~~~~~~~~i~~~~~~~~~~ 333 (932)
+|...+++||++||+||++|+.|++.|..|..|
T Consensus 313 sP~~~~~~ETl~TL~fA~rak~i~n~~~~n~~~ 345 (350)
T 2vvg_A 313 SPASTNYDETMSTLRYADRAKQIKNKPRINEDP 345 (350)
T ss_dssp CCBGGGHHHHHHHHHHHHHHTTCBCCCCCCBSC
T ss_pred CCccccHHHHHHHHHHHHHHhhccccceecCCc
Confidence 999999999999999999999999999988554
|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* | Back alignment and structure |
|---|
| >3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* | Back alignment and structure |
|---|
| >4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} | Back alignment and structure |
|---|
| >2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >2o0a_A S.cerevisiae chromosome XVI reading frame ORF YPL253C; VIK1, motor homology domain, kinesin, motor domain, microtubule-binding; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 932 | ||||
| d2zfia1 | 349 | c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), | 2e-30 | |
| d1f9va_ | 342 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 3e-28 | |
| d1bg2a_ | 323 | c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId | 1e-27 | |
| d1x88a1 | 345 | c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), | 3e-26 | |
| d1x88a1 | 345 | c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), | 5e-05 | |
| d1ry6a_ | 330 | c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu | 5e-25 | |
| d1ry6a_ | 330 | c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu | 1e-04 | |
| d1v8ka_ | 362 | c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c | 6e-25 | |
| d1v8ka_ | 362 | c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c | 1e-04 | |
| d1goja_ | 354 | c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 | 2e-23 | |
| d1goja_ | 354 | c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 | 1e-06 | |
| d2ncda_ | 368 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 7e-21 | |
| d1sdma_ | 364 | c.37.1.9 (A:) Kinesin heavy chain-like protein {Po | 2e-19 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 0.004 |
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin species: Mouse (Mus musculus), kif1a [TaxId: 10090]
Score = 121 bits (304), Expect = 2e-30
Identities = 68/303 (22%), Positives = 112/303 (36%), Gaps = 46/303 (15%)
Query: 64 SFDQSYAGSTFENVLEVLDQKSIMFKPMKDMKCSITDTCNLYRFS----------NIYGP 113
SFD SY T + QK + ++M + N+ F+ + G
Sbjct: 48 SFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGK 107
Query: 114 HTTQAE------LFQNIVHNMLERYLNGEDALLFSFGTTNSGK----------------- 150
+ N ++ S+ +
Sbjct: 108 QEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVRE 167
Query: 151 ----TFTIQDLTYVNVHSCEEAYRVLRFGKSHLSVAPTELNHRSSRSHCVFSIKLVKVD- 205
++DL+ + V S + ++ G +VA T +N SSRSH VF+I +
Sbjct: 168 HPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKPRTVAATNMNETSSRSHAVFNIIFTQKRH 227
Query: 206 --PGSEELIMMSSFDICDLAGAERQKRAHTSGDRLREARTINSSLHVLARCFNVLRE--- 260
+ +S + DLAG+ER G RL+E IN SL L + + L E
Sbjct: 228 DAETNITTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDS 287
Query: 261 --NNGLKADKKKLIPFRDSKLTQIFQRSLSGLSSTVKMIVNVNASPAYAEETVQVLKISS 318
N K K IP+RDS LT + + +L G S T M+ ++ + +ET+ L+ +
Sbjct: 288 GPNKNKKKKKTDFIPYRDSVLTWLLRENLGGNSRTA-MVAALSPADINYDETLSTLRYAD 346
Query: 319 VAR 321
A+
Sbjct: 347 RAK 349
|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 | Back information, alignment and structure |
|---|
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 932 | |||
| d1sdma_ | 364 | Kinesin heavy chain-like protein {Potato (Solanum | 100.0 | |
| d1v8ka_ | 362 | Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 | 100.0 | |
| d1goja_ | 354 | Kinesin {Neurospora crassa [TaxId: 5141]} | 100.0 | |
| d1x88a1 | 345 | Kinesin {Human (Homo sapiens), mitotic kinesin eg5 | 100.0 | |
| d1ry6a_ | 330 | Kinesin {Malaria parasite (Plasmodium falciparum) | 100.0 | |
| d2zfia1 | 349 | Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 | 100.0 | |
| d1bg2a_ | 323 | Kinesin {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1f9va_ | 342 | Kinesin motor Ncd (non-claret disjunctional) {Bake | 100.0 | |
| d2ncda_ | 368 | Kinesin motor Ncd (non-claret disjunctional) {Frui | 100.0 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 93.58 | |
| d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 90.53 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 90.17 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 89.67 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 86.39 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 86.06 | |
| d1lkxa_ | 684 | Myosin S1, motor domain {Dictyostelium discoideum, | 83.73 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 82.64 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 81.76 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 81.37 | |
| d1d0xa2 | 712 | Myosin S1, motor domain {Dictyostelium discoideum | 81.13 | |
| d1br2a2 | 710 | Myosin S1, motor domain {Chicken (Gallus gallus), | 81.03 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 80.3 |
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin heavy chain-like protein species: Potato (Solanum tuberosum) [TaxId: 4113]
Probab=100.00 E-value=1e-58 Score=504.29 Aligned_cols=254 Identities=26% Similarity=0.425 Sum_probs=225.6
Q ss_pred ccccCCCcccccCCCCceEEEeCCCeEEEcCCCCccccCCCCCcceecceecCCCCChHHHHHHHHHHHHHHhcCCCCce
Q psy16994 60 QILNSFDQSYAGSTFENVLEVLDQKSIMFKPMKDMKCSITDTCNLYRFSNIYGPHTTQAELFQNIVHNMLERYLNGEDAL 139 (932)
Q Consensus 60 ~rvRp~~~~e~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~f~fd~v~~~~~~q~~v~~~~~~~~v~~~~~g~~~~ 139 (932)
+||||+.+.|...+...++.+.++.++...+.. ...+.|.||+||+++++|.+||+. +.|+|+++++|+|+|
T Consensus 6 vRvRP~~~~E~~~~~~~~v~~~~~~~~~~~~~~-------~~~~~f~FD~vf~~~~~q~~vy~~-v~~lv~~~l~G~n~~ 77 (364)
T d1sdma_ 6 CRLRPLCEKEIIAKERNAIRSVDEFTVEHLWKD-------DKAKQHMYDRVFDGNATQDDVFED-TKYLVQSAVDGYNVC 77 (364)
T ss_dssp EEECCCCHHHHHTTCCBCEEECSTTEEEEECSS-------SSEEEEECSEEECTTCCHHHHHHT-TTHHHHHHHTTCEEE
T ss_pred EEcCCCChhhcccCCCCeEEeCCCCeEEecCCC-------CCceEEECCeecCCCCCHHHHHHH-HHHHHHHHhcCCcee
Confidence 399999998866667778888888877665432 234589999999999999999987 589999999999999
Q ss_pred eeecccccCCCcEEEec---------------------------------------------------------------
Q psy16994 140 LFSFGTTNSGKTFTIQD--------------------------------------------------------------- 156 (932)
Q Consensus 140 i~~~G~tgsGKt~t~~G--------------------------------------------------------------- 156 (932)
|||||+|||||||||+|
T Consensus 78 i~aYGqTGSGKTyTm~G~~~~~Giipr~~~~lf~~i~~~~~~~~~~v~~S~~EIyne~i~DLL~~~~~~~~~l~~~~~~~ 157 (364)
T d1sdma_ 78 IFAYGQTGSGKTFTIYGADSNPGLTPRAMSELFRIMKKDSNKFSFSLKAYMVELYQDTLVDLLLPKQAKRLKLDIKKDSK 157 (364)
T ss_dssp EEEECSTTSSHHHHHTBCSSSBCHHHHHHHHHHHHHHHGGGTEEEEEEEEEEEESSSCEEETTSCTTSCCCCCEEEECTT
T ss_pred eeccccCCCCcccccccCccccchhHHHHHHHHhhhhhccccccceEEEEEEEEeccccccccCcccccccccceeeccc
Confidence 99999999999999998
Q ss_pred -------ceEEEecCHHHHHHHHHhhhhccccccccCccCCCCCccEEEEEEEEeCCCCCcceeEEEEEEEeCCCCcccc
Q psy16994 157 -------LTYVNVHSCEEAYRVLRFGKSHLSVAPTELNHRSSRSHCVFSIKLVKVDPGSEELIMMSSFDICDLAGAERQK 229 (932)
Q Consensus 157 -------l~~~~v~s~~~~~~~l~~g~~~r~~~~t~~n~~ssrsh~i~~i~v~~~~~~~~~~~~~s~l~~vDLagse~~~ 229 (932)
++++.|.|+++++.+|..|..+|.+++|.+|..|||||+||+|+|.+...+ ......|+|+|||||||||..
T Consensus 158 ~~~~v~~l~~~~v~s~~~~~~~l~~g~~~R~~~~t~~n~~ssRsH~i~~i~v~~~~~~-~~~~~~~kl~~vDLAGsEr~~ 236 (364)
T d1sdma_ 158 GMVSVENVTVVSISTYEELKTIIQRGSEQRHTTGTLMNEQSSRSHLIVSVIIESTNLQ-TQAIARGKLSFVDLAGSERVK 236 (364)
T ss_dssp SCEEEETCCCEEECSHHHHHHHHHHHHHHHCCCSSCTTCHHHHSEEEEEEEEEEEETT-TCCEEEEEEEEEECCCCSCCC
T ss_pred CccccccceeeeeCCHHHHHHHhhccceeeccccccccccccccceEEEEEEEEeccC-cceeeeEEEEeechhhccccc
Confidence 788999999999999999999999999999999999999999999988665 345688999999999999999
Q ss_pred ccccchhhhHHHHHHHHHHHHHHHHHHHHHhccCCCCCCCCCccCCCCchHHhhhhhcCCCCCeeEEEEecCCCcCcHHH
Q psy16994 230 RAHTSGDRLREARTINSSLHVLARCFNVLRENNGLKADKKKLIPFRDSKLTQIFQRSLSGLSSTVKMIVNVNASPAYAEE 309 (932)
Q Consensus 230 ~~~~~~~~~~e~~~in~sl~~l~~~i~~l~~~~~~~~~~~~~vp~r~s~LT~ll~~~l~g~~~~~~~i~~~~p~~~~~~e 309 (932)
.+++.|.+++|+.+||+||++|++||.+|+.++ .|||||+||||+||+++|||++ +|+||+||+|+..+|++
T Consensus 237 ~~~~~g~~~~E~~~iN~SL~~L~~vi~aL~~~~-------~~ipyR~SkLT~lL~d~Lggns-~t~~I~~isp~~~~~~e 308 (364)
T d1sdma_ 237 KSGSAGNQLKEAQSINKSLSALGDVISALSSGN-------QHIPYRNHKLTMLMSDSLGGNA-KTLMFVNISPAESNLDE 308 (364)
T ss_dssp C---------CCCTTCHHHHHHHHHHHHHHHTC-------SCCCGGGCHHHHHTTTTTTSSS-EEEEEEEECCBGGGHHH
T ss_pred cccccCceeeeccccccchhhHHHHHHHHHcCC-------CcCCchhhhhhHHHHhhcCCCc-eEEEEEEeCCCcchHHH
Confidence 999999999999999999999999999999865 7999999999999999999999 99999999999999999
Q ss_pred HHHHHHHHHHhcccccccCCC
Q psy16994 310 TVQVLKISSVARDLLTVAKPR 330 (932)
Q Consensus 310 t~~~l~~~~~~~~i~~~~~~~ 330 (932)
|++||+||++|+.|++.|.+|
T Consensus 309 Tl~TL~fa~~ak~i~n~p~~n 329 (364)
T d1sdma_ 309 THNSLTYASRVRSIVNDPSKN 329 (364)
T ss_dssp HHHHHHHHHHHTTCCCCCCCC
T ss_pred HHHHHHHHHHHhhcccCCccc
Confidence 999999999999999998875
|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|