Score = 130 bits (328), Expect = 2e-30, Method: Compositional matrix adjust.
Identities = 57/105 (54%), Positives = 80/105 (76%)
Query: 1 MADTEVVSREEEKKIVHTYPLVHKTDMADELMTEVVDLCSMACEKHAANLEQASRVIKDT 60
M +TE E + K + T+PLV +DM +E+ E ++LC ACEK + N E A+++IK+T
Sbjct: 1 MGETEGKKEEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKET 60
Query: 61 MDKKYGPAWHVVVGETFGFEITYECKSLLYMFFGGNLAICMWKCS 105
MDKK+G +WHVV+GE FGFEIT+E K+LLY++FGG LA+C+WKCS
Sbjct: 61 MDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS 105
Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity. Mus musculus (taxid: 10090)
Acts as one of several non-catalytic accessory components of the cytoplasmic dynein complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures.
Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures.
Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures.
Mus musculus (taxid: 10090)
Close Homologs in the Non-Redundant Database Detected by BLAST
>PF01221 Dynein_light: Dynein light chain type 1 ; InterPro: IPR001372 Dynein is a multisubunit microtubule-dependent motor enzyme that acts as the force generating protein of eukaryotic cilia and flagella
The cytoplasmic isoform of dynein acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. Dynein is composed of a number of ATP-binding large subunits (see IPR004273 from INTERPRO), intermediate size subunits and small subunits. Among the small subunits, there is a family of highly conserved proteins which make up this family [, ]. Both type 1 (DLC1) and 2 (DLC2) dynein light chains have a similar two-layer alpha-beta core structure consisting of beta-alpha(2)-beta-X-beta(2) [, ].; GO: 0007017 microtubule-based process, 0005875 microtubule associated complex; PDB: 1F95_A 1F96_A 1F3C_A 3P8M_B 2XQQ_C 1RE6_A 1CMI_A 1PWK_A 1PWJ_A 4DS1_C ....
>PF04155 Ground-like: Ground-like domain; InterPro: IPR007284 This group of proteins contain one or more copies of the ground-like domain, which are specific to Caenorhabditis elegans and Caenorhabditis briggsae
It has been proposed that the ground-like domain containing proteins may bind and modulate the activity of Patched-like membrane molecules, reminiscent of the modulating activities of neuropeptides [].
>PF05075 DUF684: Protein of unknown function (DUF684); InterPro: IPR007767 This family contains uncharacterised proteins from Caenorhabditis elegans
>PF10703 MoaF: Molybdenum cofactor biosynthesis protein F; InterPro: IPR024724 Molybdenum cofactor biosynthesis protein F (MoaF) is essential for the production of the monoamine-inducible 30kDa protein in Klebsiella []
It is necessary for reconstituting organoautotrophic growth in Ralstonia eutropha []. MoaF is conserved in proteobacteria and some lower eukaryotes. The operon regulating the Moa genes is responsible for molybdenum cofactor biosynthesis.
>pdb|4DS1|A Chain A, The Structure Of A Yeast Dyn2-Nup159 Complex And The Molecular Basis For The Dynein Light Chain - Nuclear Pore Interaction Length = 97