Psyllid ID: psy17079
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 99 | ||||||
| 242003180 | 543 | T-complex protein 1 subunit eta, putativ | 0.737 | 0.134 | 0.746 | 6e-24 | |
| 16611916 | 541 | chaperonin subunit 1 [Artemia franciscan | 0.747 | 0.136 | 0.693 | 2e-23 | |
| 218749822 | 541 | chaperonin containing TCP1, subunit 7 [N | 0.707 | 0.129 | 0.722 | 9e-23 | |
| 91093052 | 540 | PREDICTED: similar to chaperonin [Tribol | 0.717 | 0.131 | 0.68 | 1e-22 | |
| 147904655 | 480 | uncharacterized protein LOC495278 [Xenop | 0.707 | 0.145 | 0.675 | 3e-22 | |
| 27769226 | 561 | LOC495278 protein, partial [Xenopus laev | 0.707 | 0.124 | 0.675 | 4e-22 | |
| 332020744 | 554 | T-complex protein 1 subunit eta [Acromyr | 0.696 | 0.124 | 0.690 | 4e-22 | |
| 307165869 | 544 | T-complex protein 1 subunit eta [Campono | 0.676 | 0.123 | 0.690 | 8e-22 | |
| 291229965 | 575 | PREDICTED: chaperonin containing TCP1, s | 0.717 | 0.123 | 0.68 | 1e-21 | |
| 307197838 | 496 | T-complex protein 1 subunit eta [Harpegn | 0.676 | 0.135 | 0.690 | 1e-21 |
| >gi|242003180|ref|XP_002422641.1| T-complex protein 1 subunit eta, putative [Pediculus humanus corporis] gi|212505442|gb|EEB09903.1| T-complex protein 1 subunit eta, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 114 bits (286), Expect = 6e-24, Method: Compositional matrix adjust.
Identities = 56/75 (74%), Positives = 61/75 (81%), Gaps = 2/75 (2%)
Query: 2 QSNCWYGVDITKEDISDNMESCVWEPAIVKKNAITAASEAACLVLSVDETIKNPKA-GGE 60
Q WYGVDI KEDISDN E CVWEPA+VK NAITAASEAACL+LSVDETIKN K+ GG+
Sbjct: 469 QGFTWYGVDINKEDISDNFEQCVWEPAVVKINAITAASEAACLILSVDETIKNVKSGGGD 528
Query: 61 GGQGMPMPGRGRGRP 75
+PM GRGRGRP
Sbjct: 529 APSALPM-GRGRGRP 542
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|16611916|gb|AAL27405.1|AF427597_1 chaperonin subunit 1 [Artemia franciscana] | Back alignment and taxonomy information |
|---|
| >gi|218749822|ref|NP_001136327.1| chaperonin containing TCP1, subunit 7 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|91093052|ref|XP_967459.1| PREDICTED: similar to chaperonin [Tribolium castaneum] gi|270002664|gb|EEZ99111.1| hypothetical protein TcasGA2_TC005004 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|147904655|ref|NP_001088419.1| uncharacterized protein LOC495278 [Xenopus laevis] gi|54261482|gb|AAH84429.1| LOC495278 protein [Xenopus laevis] | Back alignment and taxonomy information |
|---|
| >gi|27769226|gb|AAH42312.1| LOC495278 protein, partial [Xenopus laevis] | Back alignment and taxonomy information |
|---|
| >gi|332020744|gb|EGI61148.1| T-complex protein 1 subunit eta [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307165869|gb|EFN60224.1| T-complex protein 1 subunit eta [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|291229965|ref|XP_002734944.1| PREDICTED: chaperonin containing TCP1, subunit 7-like [Saccoglossus kowalevskii] | Back alignment and taxonomy information |
|---|
| >gi|307197838|gb|EFN78949.1| T-complex protein 1 subunit eta [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 99 | ||||||
| FB|FBgn0037632 | 544 | Tcp-1eta "Tcp-1eta" [Drosophil | 0.565 | 0.102 | 0.75 | 1e-18 | |
| UNIPROTKB|F1NZN1 | 520 | F1NZN1 "Uncharacterized protei | 0.565 | 0.107 | 0.714 | 2e-18 | |
| UNIPROTKB|F1NK38 | 539 | F1NK38 "Uncharacterized protei | 0.565 | 0.103 | 0.714 | 2.1e-18 | |
| UNIPROTKB|Q5ZJK8 | 553 | CCT7 "T-complex protein 1 subu | 0.565 | 0.101 | 0.714 | 2.3e-18 | |
| ZFIN|ZDB-GENE-020419-7 | 547 | cct7 "chaperonin containing TC | 0.565 | 0.102 | 0.696 | 4.7e-18 | |
| UNIPROTKB|B7Z1C9 | 415 | CCT7 "Chaperonin containing TC | 0.565 | 0.134 | 0.696 | 2.7e-17 | |
| UNIPROTKB|F5GZK5 | 443 | CCT7 "T-complex protein 1 subu | 0.565 | 0.126 | 0.696 | 3.3e-17 | |
| UNIPROTKB|B8ZZC9 | 501 | CCT7 "T-complex protein 1 subu | 0.565 | 0.111 | 0.696 | 4.6e-17 | |
| UNIPROTKB|E2QZM2 | 487 | E2QZM2 "Uncharacterized protei | 0.565 | 0.114 | 0.678 | 5.5e-17 | |
| UNIPROTKB|Q99832 | 543 | CCT7 "T-complex protein 1 subu | 0.565 | 0.103 | 0.696 | 5.6e-17 |
| FB|FBgn0037632 Tcp-1eta "Tcp-1eta" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 233 (87.1 bits), Expect = 1.0e-18, P = 1.0e-18
Identities = 42/56 (75%), Positives = 49/56 (87%)
Query: 2 QSNCWYGVDITKEDISDNMESCVWEPAIVKKNAITAASEAACLVLSVDETIKNPKA 57
Q WYGVDI KEDISDN E CVWEP+I+K NA+TAA+EAAC++LSVDETIK+PKA
Sbjct: 469 QGGQWYGVDINKEDISDNYEQCVWEPSIIKINALTAAAEAACMILSVDETIKSPKA 524
|
|
| UNIPROTKB|F1NZN1 F1NZN1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NK38 F1NK38 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZJK8 CCT7 "T-complex protein 1 subunit eta" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-020419-7 cct7 "chaperonin containing TCP1, subunit 7 (eta)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B7Z1C9 CCT7 "Chaperonin containing TCP1, subunit 7 (Eta), isoform CRA_a" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F5GZK5 CCT7 "T-complex protein 1 subunit eta" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B8ZZC9 CCT7 "T-complex protein 1 subunit eta" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QZM2 E2QZM2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q99832 CCT7 "T-complex protein 1 subunit eta" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 99 | |||
| cd03340 | 522 | cd03340, TCP1_eta, TCP-1 (CTT or eukaryotic type I | 1e-29 | |
| TIGR02345 | 523 | TIGR02345, chap_CCT_eta, T-complex protein 1, eta | 6e-23 | |
| cd00309 | 464 | cd00309, chaperonin_type_I_II, chaperonin families | 3e-15 | |
| pfam00118 | 481 | pfam00118, Cpn60_TCP1, TCP-1/cpn60 chaperonin fami | 5e-13 | |
| COG0459 | 524 | COG0459, GroL, Chaperonin GroEL (HSP60 family) [Po | 6e-12 | |
| TIGR02339 | 519 | TIGR02339, thermosome_arch, thermosome, various su | 4e-11 | |
| cd03343 | 517 | cd03343, cpn60, cpn60 chaperonin family | 1e-10 | |
| cd03335 | 527 | cd03335, TCP1_alpha, TCP-1 (CTT or eukaryotic type | 2e-08 | |
| cd03337 | 480 | cd03337, TCP1_gamma, TCP-1 (CTT or eukaryotic type | 2e-08 | |
| TIGR02340 | 536 | TIGR02340, chap_CCT_alpha, T-complex protein 1, al | 4e-08 | |
| TIGR02344 | 525 | TIGR02344, chap_CCT_gamma, T-complex protein 1, ga | 7e-08 | |
| cd03341 | 472 | cd03341, TCP1_theta, TCP-1 (CTT or eukaryotic type | 2e-07 | |
| cd03336 | 517 | cd03336, TCP1_beta, TCP-1 (CTT or eukaryotic type | 5e-07 | |
| TIGR02346 | 531 | TIGR02346, chap_CCT_theta, T-complex protein 1, th | 7e-07 | |
| PTZ00212 | 533 | PTZ00212, PTZ00212, T-complex protein 1 subunit be | 1e-06 | |
| cd03338 | 515 | cd03338, TCP1_delta, TCP-1 (CTT or eukaryotic type | 8e-05 | |
| TIGR02342 | 517 | TIGR02342, chap_CCT_delta, T-complex protein 1, de | 2e-04 | |
| TIGR02347 | 531 | TIGR02347, chap_CCT_zeta, T-complex protein 1, zet | 0.004 |
| >gnl|CDD|239456 cd03340, TCP1_eta, TCP-1 (CTT or eukaryotic type II) chaperonin family, eta subunit | Back alignment and domain information |
|---|
Score = 109 bits (275), Expect = 1e-29
Identities = 38/57 (66%), Positives = 46/57 (80%)
Query: 1 MQSNCWYGVDITKEDISDNMESCVWEPAIVKKNAITAASEAACLVLSVDETIKNPKA 57
WYGVDI E I+DN E+ VWEP++VK NA+TAA+EAACL+LSVDETIKNPK+
Sbjct: 466 QGGGKWYGVDINNEGIADNFEAFVWEPSLVKINALTAATEAACLILSVDETIKNPKS 522
|
Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings. In contrast to bacterial group I chaperonins (GroEL), each ring of the eukaryotic cytosolic chaperonin (CTT) consists of eight different, but homologous subunits. Their common function is to sequester nonnative proteins inside their central cavity and promote folding by using energy derived from ATP hydrolysis. The best studied in vivo substrates of CTT are actin and tubulin. Length = 522 |
| >gnl|CDD|200176 TIGR02345, chap_CCT_eta, T-complex protein 1, eta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|238189 cd00309, chaperonin_type_I_II, chaperonin families, type I and type II | Back alignment and domain information |
|---|
| >gnl|CDD|215730 pfam00118, Cpn60_TCP1, TCP-1/cpn60 chaperonin family | Back alignment and domain information |
|---|
| >gnl|CDD|223535 COG0459, GroL, Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|233823 TIGR02339, thermosome_arch, thermosome, various subunits, archaeal | Back alignment and domain information |
|---|
| >gnl|CDD|239459 cd03343, cpn60, cpn60 chaperonin family | Back alignment and domain information |
|---|
| >gnl|CDD|239451 cd03335, TCP1_alpha, TCP-1 (CTT or eukaryotic type II) chaperonin family, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239453 cd03337, TCP1_gamma, TCP-1 (CTT or eukaryotic type II) chaperonin family, gamma subunit | Back alignment and domain information |
|---|
| >gnl|CDD|131393 TIGR02340, chap_CCT_alpha, T-complex protein 1, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233825 TIGR02344, chap_CCT_gamma, T-complex protein 1, gamma subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239457 cd03341, TCP1_theta, TCP-1 (CTT or eukaryotic type II) chaperonin family, theta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239452 cd03336, TCP1_beta, TCP-1 (CTT or eukaryotic type II) chaperonin family, beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233826 TIGR02346, chap_CCT_theta, T-complex protein 1, theta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|185514 PTZ00212, PTZ00212, T-complex protein 1 subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239454 cd03338, TCP1_delta, TCP-1 (CTT or eukaryotic type II) chaperonin family, delta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233824 TIGR02342, chap_CCT_delta, T-complex protein 1, delta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233827 TIGR02347, chap_CCT_zeta, T-complex protein 1, zeta subunit | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 99 | |||
| KOG0361|consensus | 543 | 99.6 | ||
| PRK12852 | 545 | groEL chaperonin GroEL; Reviewed | 99.41 | |
| PRK12850 | 544 | groEL chaperonin GroEL; Reviewed | 99.41 | |
| cd03335 | 527 | TCP1_alpha TCP-1 (CTT or eukaryotic type II) chape | 99.4 | |
| TIGR02347 | 531 | chap_CCT_zeta T-complex protein 1, zeta subunit. M | 99.39 | |
| PRK12851 | 541 | groEL chaperonin GroEL; Reviewed | 99.39 | |
| cd03342 | 484 | TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaper | 99.38 | |
| PRK00013 | 542 | groEL chaperonin GroEL; Reviewed | 99.36 | |
| PTZ00212 | 533 | T-complex protein 1 subunit beta; Provisional | 99.36 | |
| TIGR02341 | 519 | chap_CCT_beta T-complex protein 1, beta subunit. M | 99.36 | |
| TIGR02346 | 531 | chap_CCT_theta T-complex protein 1, theta subunit. | 99.36 | |
| cd03340 | 522 | TCP1_eta TCP-1 (CTT or eukaryotic type II) chapero | 99.36 | |
| cd03336 | 517 | TCP1_beta TCP-1 (CTT or eukaryotic type II) chaper | 99.35 | |
| TIGR02340 | 536 | chap_CCT_alpha T-complex protein 1, alpha subunit. | 99.34 | |
| TIGR02342 | 517 | chap_CCT_delta T-complex protein 1, delta subunit. | 99.33 | |
| PRK12849 | 542 | groEL chaperonin GroEL; Reviewed | 99.32 | |
| cd03338 | 515 | TCP1_delta TCP-1 (CTT or eukaryotic type II) chape | 99.32 | |
| TIGR02345 | 522 | chap_CCT_eta T-complex protein 1, eta subunit. Mem | 99.31 | |
| TIGR02344 | 525 | chap_CCT_gamma T-complex protein 1, gamma subunit. | 99.31 | |
| PRK14104 | 546 | chaperonin GroEL; Provisional | 99.3 | |
| cd03343 | 517 | cpn60 cpn60 chaperonin family. Chaperonins are inv | 99.29 | |
| PLN03167 | 600 | Chaperonin-60 beta subunit; Provisional | 99.28 | |
| TIGR02339 | 519 | thermosome_arch thermosome, various subunits, arch | 99.28 | |
| cd03339 | 526 | TCP1_epsilon TCP-1 (CTT or eukaryotic type II) cha | 99.27 | |
| cd03341 | 472 | TCP1_theta TCP-1 (CTT or eukaryotic type II) chape | 99.26 | |
| cd03337 | 480 | TCP1_gamma TCP-1 (CTT or eukaryotic type II) chape | 99.25 | |
| KOG0363|consensus | 527 | 99.25 | ||
| CHL00093 | 529 | groEL chaperonin GroEL | 99.22 | |
| TIGR02343 | 532 | chap_CCT_epsi T-complex protein 1, epsilon subunit | 99.2 | |
| PTZ00114 | 555 | Heat shock protein 60; Provisional | 99.2 | |
| cd00309 | 464 | chaperonin_type_I_II chaperonin families, type I a | 99.19 | |
| PF00118 | 485 | Cpn60_TCP1: TCP-1/cpn60 chaperonin family Chaperon | 99.18 | |
| TIGR02348 | 524 | GroEL chaperonin GroL. This family consists of Gro | 99.08 | |
| COG0459 | 524 | GroL Chaperonin GroEL (HSP60 family) [Posttranslat | 99.08 | |
| KOG0362|consensus | 537 | 99.07 | ||
| cd03344 | 520 | GroEL GroEL_like type I chaperonin. Chaperonins ar | 98.95 | |
| KOG0358|consensus | 534 | 98.79 | ||
| KOG0364|consensus | 527 | 98.76 | ||
| KOG0357|consensus | 400 | 98.52 | ||
| KOG0360|consensus | 545 | 98.2 | ||
| KOG0359|consensus | 520 | 98.0 | ||
| KOG0356|consensus | 550 | 95.75 |
| >KOG0361|consensus | Back alignment and domain information |
|---|
Probab=99.60 E-value=8.4e-16 Score=126.32 Aligned_cols=74 Identities=65% Similarity=1.008 Sum_probs=65.8
Q ss_pred CCCceeeeeccCCccccccccCcccchHhHHHHHHHHHHHHHHHhchhhHhhCCCCCCCCCCCCCCCCCCCCCcc
Q psy17079 2 QSNCWYGVDITKEDISDNMESCVWEPAIVKKNAITAASEAACLVLSVDETIKNPKAGGEGGQGMPMPGRGRGRPI 76 (99)
Q Consensus 2 ~G~~~~GVdi~~G~i~Dm~e~GV~Ep~~VK~~~ik~A~EaA~~ILrID~iI~a~~~~~~~~~~~~~~~~~~~~~~ 76 (99)
+|..|||||++++.+.|+++.+||||..||.++|++|+|||++||+||++|++++++.+++.++.+ +.++|||+
T Consensus 470 ~G~~w~Gvdi~~e~i~dn~~~~VwEP~~VK~Nai~aateAa~lIlsvDeTikn~~S~~~~p~~a~r-grg~g~p~ 543 (543)
T KOG0361|consen 470 QGEKWYGVDINTEGIADNFEKFVWEPSIVKINAITAATEAACLILSVDETIKNPKSQSAPPSAAGR-GRGRGRPR 543 (543)
T ss_pred cCCceeeeeecccchhhHHHhhccChHHHHHHHHHHHHHhhhheEehhhhhcCCcccCCCCCcccc-CCCCCCCC
Confidence 588999999999999999999999999999999999999999999999999999988775554445 66667775
|
|
| >PRK12852 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >PRK12850 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >cd03335 TCP1_alpha TCP-1 (CTT or eukaryotic type II) chaperonin family, alpha subunit | Back alignment and domain information |
|---|
| >TIGR02347 chap_CCT_zeta T-complex protein 1, zeta subunit | Back alignment and domain information |
|---|
| >PRK12851 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >cd03342 TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaperonin family, zeta subunit | Back alignment and domain information |
|---|
| >PRK00013 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >PTZ00212 T-complex protein 1 subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR02341 chap_CCT_beta T-complex protein 1, beta subunit | Back alignment and domain information |
|---|
| >TIGR02346 chap_CCT_theta T-complex protein 1, theta subunit | Back alignment and domain information |
|---|
| >cd03340 TCP1_eta TCP-1 (CTT or eukaryotic type II) chaperonin family, eta subunit | Back alignment and domain information |
|---|
| >cd03336 TCP1_beta TCP-1 (CTT or eukaryotic type II) chaperonin family, beta subunit | Back alignment and domain information |
|---|
| >TIGR02340 chap_CCT_alpha T-complex protein 1, alpha subunit | Back alignment and domain information |
|---|
| >TIGR02342 chap_CCT_delta T-complex protein 1, delta subunit | Back alignment and domain information |
|---|
| >PRK12849 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >cd03338 TCP1_delta TCP-1 (CTT or eukaryotic type II) chaperonin family, delta subunit | Back alignment and domain information |
|---|
| >TIGR02345 chap_CCT_eta T-complex protein 1, eta subunit | Back alignment and domain information |
|---|
| >TIGR02344 chap_CCT_gamma T-complex protein 1, gamma subunit | Back alignment and domain information |
|---|
| >PRK14104 chaperonin GroEL; Provisional | Back alignment and domain information |
|---|
| >cd03343 cpn60 cpn60 chaperonin family | Back alignment and domain information |
|---|
| >PLN03167 Chaperonin-60 beta subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02339 thermosome_arch thermosome, various subunits, archaeal | Back alignment and domain information |
|---|
| >cd03339 TCP1_epsilon TCP-1 (CTT or eukaryotic type II) chaperonin family, epsilon subunit | Back alignment and domain information |
|---|
| >cd03341 TCP1_theta TCP-1 (CTT or eukaryotic type II) chaperonin family, theta subunit | Back alignment and domain information |
|---|
| >cd03337 TCP1_gamma TCP-1 (CTT or eukaryotic type II) chaperonin family, gamma subunit | Back alignment and domain information |
|---|
| >KOG0363|consensus | Back alignment and domain information |
|---|
| >CHL00093 groEL chaperonin GroEL | Back alignment and domain information |
|---|
| >TIGR02343 chap_CCT_epsi T-complex protein 1, epsilon subunit | Back alignment and domain information |
|---|
| >PTZ00114 Heat shock protein 60; Provisional | Back alignment and domain information |
|---|
| >cd00309 chaperonin_type_I_II chaperonin families, type I and type II | Back alignment and domain information |
|---|
| >PF00118 Cpn60_TCP1: TCP-1/cpn60 chaperonin family Chaperonins cpn60 signature Chaperonins TCP-1 signatures 60 kd chaperonin signature; InterPro: IPR002423 Partially folded polypeptide chains, either newly made by ribosomes or emerging from mature proteins unfolded by stress, run the risk of aggregating with one another to the detriment of the organism | Back alignment and domain information |
|---|
| >TIGR02348 GroEL chaperonin GroL | Back alignment and domain information |
|---|
| >COG0459 GroL Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0362|consensus | Back alignment and domain information |
|---|
| >cd03344 GroEL GroEL_like type I chaperonin | Back alignment and domain information |
|---|
| >KOG0358|consensus | Back alignment and domain information |
|---|
| >KOG0364|consensus | Back alignment and domain information |
|---|
| >KOG0357|consensus | Back alignment and domain information |
|---|
| >KOG0360|consensus | Back alignment and domain information |
|---|
| >KOG0359|consensus | Back alignment and domain information |
|---|
| >KOG0356|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 99 | ||||
| 3iyg_H | 515 | Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST | 2e-19 | ||
| 3p9d_G | 550 | The Crystal Structure Of Yeast Cct Reveals Intrinsi | 3e-11 | ||
| 3ko1_A | 553 | Cystal Structure Of Thermosome From Acidianus Tengc | 2e-07 | ||
| 3p9d_C | 590 | The Crystal Structure Of Yeast Cct Reveals Intrinsi | 1e-05 | ||
| 3iyg_A | 529 | Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST | 3e-05 | ||
| 1q3r_A | 548 | Crystal Structure Of The Chaperonin From Thermococc | 5e-05 | ||
| 1q3s_A | 548 | Crystal Structure Of The Chaperonin From Thermococc | 5e-05 | ||
| 1q2v_A | 548 | Crystal Structure Of The Chaperonin From Thermococc | 5e-05 | ||
| 1a6d_B | 543 | Thermosome From T. Acidophilum Length = 543 | 6e-05 |
| >pdb|3IYG|H Chain H, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 515 | Back alignment and structure |
|
| >pdb|3P9D|G Chain G, The Crystal Structure Of Yeast Cct Reveals Intrinsic Asymmetry Of Eukaryotic Cytosolic Chaperonins Length = 550 | Back alignment and structure |
| >pdb|3KO1|A Chain A, Cystal Structure Of Thermosome From Acidianus Tengchongensis Strain S5 Length = 553 | Back alignment and structure |
| >pdb|3P9D|C Chain C, The Crystal Structure Of Yeast Cct Reveals Intrinsic Asymmetry Of Eukaryotic Cytosolic Chaperonins Length = 590 | Back alignment and structure |
| >pdb|3IYG|A Chain A, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 529 | Back alignment and structure |
| >pdb|1Q3R|A Chain A, Crystal Structure Of The Chaperonin From Thermococcus Strain Ks-1 (Nucleotide-Free Form Of Single Mutant) Length = 548 | Back alignment and structure |
| >pdb|1Q3S|A Chain A, Crystal Structure Of The Chaperonin From Thermococcus Strain Ks-1 (Formiii Crystal Complexed With Adp) Length = 548 | Back alignment and structure |
| >pdb|1Q2V|A Chain A, Crystal Structure Of The Chaperonin From Thermococcus Strain Ks-1 (Nucleotide-Free Form) Length = 548 | Back alignment and structure |
| >pdb|1A6D|B Chain B, Thermosome From T. Acidophilum Length = 543 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 99 | |||
| 3p9d_G | 550 | T-complex protein 1 subunit ETA; HSP60, eukaryotic | 2e-26 | |
| 1q3q_A | 548 | Thermosome alpha subunit; chaperone, chaperonin; H | 3e-26 | |
| 1a6d_A | 545 | Thermosome (alpha subunit); group II chaperonin, C | 6e-25 | |
| 3aq1_B | 500 | Thermosome subunit; group II chaperonin, protein f | 4e-24 | |
| 3ruv_A | 543 | Chaperonin, CPN; double-ring, protein folding mach | 6e-24 | |
| 1a6d_B | 543 | Thermosome (beta subunit); group II chaperonin, CC | 2e-23 | |
| 3p9d_H | 568 | T-complex protein 1 subunit theta; HSP60, eukaryot | 3e-23 | |
| 3ko1_A | 553 | Chaperonin; 9-fold symmetry, double ring, ATP hydr | 7e-23 | |
| 3iyg_H | 515 | T-complex protein 1 subunit ETA; TRIC/CCT, asymmet | 3e-22 | |
| 3p9d_A | 559 | T-complex protein 1 subunit alpha; HSP60, eukaryot | 8e-22 | |
| 3p9d_F | 546 | T-complex protein 1 subunit zeta; HSP60, eukaryoti | 1e-21 | |
| 3iyg_G | 515 | T-complex protein 1 subunit gamma; TRIC/CCT, asymm | 5e-21 | |
| 3p9d_B | 527 | T-complex protein 1 subunit beta; HSP60, eukaryoti | 6e-21 | |
| 3iyg_B | 513 | T-complex protein 1 subunit beta; TRIC/CCT, asymme | 8e-21 | |
| 3p9d_E | 562 | T-complex protein 1 subunit epsilon; HSP60, eukary | 1e-20 | |
| 3iyg_D | 518 | T-complex protein 1 subunit delta; TRIC/CCT, asymm | 3e-20 | |
| 3iyg_A | 529 | T-complex protein 1 subunit alpha; TRIC/CCT, asymm | 1e-19 | |
| 3p9d_D | 528 | T-complex protein 1 subunit delta; HSP60, eukaryot | 1e-19 | |
| 3p9d_C | 590 | T-complex protein 1 subunit gamma; HSP60, eukaryot | 2e-19 | |
| 3iyg_Z | 517 | T-complex protein 1 subunit zeta; TRIC/CCT, asymme | 2e-19 | |
| 3iyg_E | 515 | T-complex protein 1 subunit; TRIC/CCT, asymmetric, | 3e-19 | |
| 3iyg_Q | 512 | T-complex protein 1 subunit theta; TRIC/CCT, asymm | 3e-17 |
| >3p9d_G T-complex protein 1 subunit ETA; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_g* Length = 550 | Back alignment and structure |
|---|
Score = 99 bits (250), Expect = 2e-26
Identities = 37/77 (48%), Positives = 46/77 (59%), Gaps = 2/77 (2%)
Query: 2 QSNCWYGVDITKEDISDNMESCVWEPAIVKKNAITAASEAACLVLSVDETIKNPKAGGEG 61
+ WYGV E+I DN VWEPA+VK NA+ +A+EA L+LSVDETI N +
Sbjct: 474 KGEKWYGVVFETENIGDNFAKFVWEPALVKINALNSATEATNLILSVDETITNKGSESAN 533
Query: 62 GQGMP--MPGRGRGRPI 76
MP GRGRG P+
Sbjct: 534 AGMMPPQGAGRGRGMPM 550
|
| >1q3q_A Thermosome alpha subunit; chaperone, chaperonin; HET: ANP; 2.30A {Thermococcus SP} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1q2v_A* 1q3s_A* 1q3r_A Length = 548 | Back alignment and structure |
|---|
| >1a6d_A Thermosome (alpha subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_A* Length = 545 | Back alignment and structure |
|---|
| >3aq1_B Thermosome subunit; group II chaperonin, protein folding, chaperone; 2.75A {Methanococcoides burtonii} Length = 500 | Back alignment and structure |
|---|
| >3ruv_A Chaperonin, CPN; double-ring, protein folding machinery, group II chaperonin, binding, chaperone; HET: ANP; 2.24A {Methanococcus maripaludis} PDB: 3rus_A* 3ruw_A* 3ruq_A* 3los_A 3kfb_A* 3izi_A 3izj_A 3izm_A 3izh_A 3kfe_A* 3iyf_A* 3kfk_A* 3izk_A 3izl_A 3j03_A 3izn_A 3j02_A Length = 543 | Back alignment and structure |
|---|
| >1a6d_B Thermosome (beta subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_B* 1e0r_B Length = 543 | Back alignment and structure |
|---|
| >3p9d_H T-complex protein 1 subunit theta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_h* Length = 568 | Back alignment and structure |
|---|
| >3ko1_A Chaperonin; 9-fold symmetry, double ring, ATP hydrolase, chaperone, NUCL binding; HET: ADP; 3.70A {Acidianus tengchongensis} Length = 553 | Back alignment and structure |
|---|
| >3iyg_H T-complex protein 1 subunit ETA; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 515 | Back alignment and structure |
|---|
| >3p9d_A T-complex protein 1 subunit alpha; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_a* Length = 559 | Back alignment and structure |
|---|
| >3p9d_F T-complex protein 1 subunit zeta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_f* Length = 546 | Back alignment and structure |
|---|
| >3iyg_G T-complex protein 1 subunit gamma; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 515 | Back alignment and structure |
|---|
| >3p9d_B T-complex protein 1 subunit beta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_b* Length = 527 | Back alignment and structure |
|---|
| >3iyg_B T-complex protein 1 subunit beta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} PDB: 3ktt_B 4a0o_A 4a0v_A 4a0w_A 4a13_A Length = 513 | Back alignment and structure |
|---|
| >3p9d_E T-complex protein 1 subunit epsilon; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_e* Length = 562 | Back alignment and structure |
|---|
| >3iyg_D T-complex protein 1 subunit delta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 518 | Back alignment and structure |
|---|
| >3iyg_A T-complex protein 1 subunit alpha; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 529 | Back alignment and structure |
|---|
| >3p9d_D T-complex protein 1 subunit delta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_d* Length = 528 | Back alignment and structure |
|---|
| >3p9d_C T-complex protein 1 subunit gamma; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_c* 2bbm_B 2bbn_B Length = 590 | Back alignment and structure |
|---|
| >3iyg_Z T-complex protein 1 subunit zeta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 517 | Back alignment and structure |
|---|
| >3iyg_E T-complex protein 1 subunit; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 515 | Back alignment and structure |
|---|
| >3iyg_Q T-complex protein 1 subunit theta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 512 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 99 | |||
| 3ruv_A | 543 | Chaperonin, CPN; double-ring, protein folding mach | 99.53 | |
| 3p9d_G | 550 | T-complex protein 1 subunit ETA; HSP60, eukaryotic | 99.52 | |
| 3aq1_B | 500 | Thermosome subunit; group II chaperonin, protein f | 99.5 | |
| 3p9d_H | 568 | T-complex protein 1 subunit theta; HSP60, eukaryot | 99.49 | |
| 3iyg_A | 529 | T-complex protein 1 subunit alpha; TRIC/CCT, asymm | 99.47 | |
| 3rtk_A | 546 | 60 kDa chaperonin 2; heat shock protein, chaperone | 99.46 | |
| 3ko1_A | 553 | Chaperonin; 9-fold symmetry, double ring, ATP hydr | 99.46 | |
| 3p9d_F | 546 | T-complex protein 1 subunit zeta; HSP60, eukaryoti | 99.45 | |
| 3iyg_Z | 517 | T-complex protein 1 subunit zeta; TRIC/CCT, asymme | 99.45 | |
| 1a6d_B | 543 | Thermosome (beta subunit); group II chaperonin, CC | 99.44 | |
| 1q3q_A | 548 | Thermosome alpha subunit; chaperone, chaperonin; H | 99.44 | |
| 3iyg_B | 513 | T-complex protein 1 subunit beta; TRIC/CCT, asymme | 99.43 | |
| 3iyg_H | 515 | T-complex protein 1 subunit ETA; TRIC/CCT, asymmet | 99.42 | |
| 1a6d_A | 545 | Thermosome (alpha subunit); group II chaperonin, C | 99.42 | |
| 3iyg_D | 518 | T-complex protein 1 subunit delta; TRIC/CCT, asymm | 99.41 | |
| 3p9d_D | 528 | T-complex protein 1 subunit delta; HSP60, eukaryot | 99.39 | |
| 1we3_A | 543 | CPN60(groel); chaperonin, chaperone, groel, HSP60, | 99.38 | |
| 3iyg_G | 515 | T-complex protein 1 subunit gamma; TRIC/CCT, asymm | 99.38 | |
| 3p9d_E | 562 | T-complex protein 1 subunit epsilon; HSP60, eukary | 99.38 | |
| 3iyg_Q | 512 | T-complex protein 1 subunit theta; TRIC/CCT, asymm | 99.38 | |
| 3iyg_E | 515 | T-complex protein 1 subunit; TRIC/CCT, asymmetric, | 99.38 | |
| 3p9d_B | 527 | T-complex protein 1 subunit beta; HSP60, eukaryoti | 99.37 | |
| 3p9d_A | 559 | T-complex protein 1 subunit alpha; HSP60, eukaryot | 99.37 | |
| 3p9d_C | 590 | T-complex protein 1 subunit gamma; HSP60, eukaryot | 99.33 | |
| 1iok_A | 545 | Chaperonin 60; chaperone; 3.20A {Paracoccus denitr | 99.29 | |
| 1kp8_A | 547 | Groel protein; chaperonin, assisted protein foldin | 99.28 |
| >3ruv_A Chaperonin, CPN; double-ring, protein folding machinery, group II chaperonin, binding, chaperone; HET: ANP; 2.24A {Methanococcus maripaludis} PDB: 3rus_A* 3ruw_A* 3ruq_A* 3los_A 3kfb_A* 3izi_A 3izj_A 3izm_A 3izh_A 3kfe_A* 3iyf_A* 3kfk_A* 3izk_A 3izl_A 3j03_A 3izn_A 3j02_A | Back alignment and structure |
|---|
Probab=99.53 E-value=2.5e-15 Score=123.84 Aligned_cols=60 Identities=30% Similarity=0.410 Sum_probs=51.5
Q ss_pred CCCceeeeeccCCccccccccCcccchHhHHHHHHHHHHHHHHHhchhhHhhCCCCCCCC
Q psy17079 2 QSNCWYGVDITKEDISDNMESCVWEPAIVKKNAITAASEAACLVLSVDETIKNPKAGGEG 61 (99)
Q Consensus 2 ~G~~~~GVdi~~G~i~Dm~e~GV~Ep~~VK~~~ik~A~EaA~~ILrID~iI~a~~~~~~~ 61 (99)
+|+.++|||+.+|++.||++.|||||+.||+++|++|+|+|++|||||++|.+++.++|+
T Consensus 466 ~~~~~~G~d~~~g~~~dm~~~gI~dp~~vk~~al~~A~~~a~~iL~id~ii~~~~~~~~~ 525 (543)
T 3ruv_A 466 NGNKCAGLNVFTGAVEDMCENGVVEPLRVKTQAIQSAAESTEMLLRIDDVIAAEKLRGAP 525 (543)
T ss_dssp TCCTTEEECTTTCSEEETTTTTCEEEHHHHHHHHHHHHHHHHHHHTCCEEEEEC------
T ss_pred cCCceeeeeCCCCccccHHHcCCEecHHHHHHHHHHHHHHHHHHHhHHhheecCccCCCC
Confidence 355689999999999999999999999999999999999999999999999998887664
|
| >3p9d_G T-complex protein 1 subunit ETA; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_g* 4d8q_G* 4d8r_g* | Back alignment and structure |
|---|
| >3aq1_B Thermosome subunit; group II chaperonin, protein folding, chaperone; 2.75A {Methanococcoides burtonii} | Back alignment and structure |
|---|
| >3p9d_H T-complex protein 1 subunit theta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_h* 4d8q_H* 4d8r_h* | Back alignment and structure |
|---|
| >3iyg_A T-complex protein 1 subunit alpha; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3rtk_A 60 kDa chaperonin 2; heat shock protein, chaperone; 2.80A {Mycobacterium tuberculosis} PDB: 1sjp_A | Back alignment and structure |
|---|
| >3ko1_A Chaperonin; 9-fold symmetry, double ring, ATP hydrolase, chaperone, NUCL binding; HET: ADP; 3.70A {Acidianus tengchongensis} | Back alignment and structure |
|---|
| >3p9d_F T-complex protein 1 subunit zeta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_f* 4d8q_F* 4d8r_f* | Back alignment and structure |
|---|
| >3iyg_Z T-complex protein 1 subunit zeta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >1a6d_B Thermosome (beta subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_B* 1e0r_B | Back alignment and structure |
|---|
| >1q3q_A Thermosome alpha subunit; chaperone, chaperonin; HET: ANP; 2.30A {Thermococcus SP} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1q2v_A* 1q3s_A* 1q3r_A | Back alignment and structure |
|---|
| >3iyg_B T-complex protein 1 subunit beta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} PDB: 3ktt_B 4a0o_A 4a0v_A 4a0w_A 4a13_A | Back alignment and structure |
|---|
| >3iyg_H T-complex protein 1 subunit ETA; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >1a6d_A Thermosome (alpha subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_A* | Back alignment and structure |
|---|
| >3iyg_D T-complex protein 1 subunit delta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3p9d_D T-complex protein 1 subunit delta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_d* 4d8q_D* 4d8r_d* | Back alignment and structure |
|---|
| >1we3_A CPN60(groel); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1wf4_a* | Back alignment and structure |
|---|
| >3iyg_G T-complex protein 1 subunit gamma; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3p9d_E T-complex protein 1 subunit epsilon; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_e* 4d8q_E* 4d8r_e* | Back alignment and structure |
|---|
| >3iyg_Q T-complex protein 1 subunit theta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3iyg_E T-complex protein 1 subunit; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3p9d_B T-complex protein 1 subunit beta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_b* 4d8q_B* 4d8r_b* | Back alignment and structure |
|---|
| >3p9d_A T-complex protein 1 subunit alpha; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_a* 4d8q_A* 4d8r_a* | Back alignment and structure |
|---|
| >3p9d_C T-complex protein 1 subunit gamma; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_c* 4d8q_C* 4d8r_c* 2bbm_B 2bbn_B | Back alignment and structure |
|---|
| >1iok_A Chaperonin 60; chaperone; 3.20A {Paracoccus denitrificans} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 | Back alignment and structure |
|---|
| >1kp8_A Groel protein; chaperonin, assisted protein folding, chaperone; HET: ATP; 2.00A {Escherichia coli} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1gr5_A 2c7e_A* 1grl_A 1oel_A 1xck_A 1gru_A 1mnf_A 1aon_A 2c7c_A 2c7d_A 2cgt_A 2nwc_A 3e76_A* 2eu1_A 1j4z_A 1kpo_O 1sx3_A* 3c9v_A 1ss8_A 3cau_A ... | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 99 | ||||
| d1a6da1 | 245 | a.129.1.2 (A:17-145,A:404-519) Thermosome, E domai | 2e-14 | |
| d1a6db1 | 243 | a.129.1.2 (B:20-144,B:404-521) Thermosome, E domai | 9e-14 | |
| d1q3qa1 | 258 | a.129.1.2 (A:9-145,A:406-526) Thermosome, E domain | 7e-11 | |
| d1we3a1 | 255 | a.129.1.1 (A:3-138,A:409-527) GroEL, E domain {The | 2e-07 | |
| d1sjpa1 | 180 | a.129.1.1 (A:62-134,A:408-514) GroEL, E domain {My | 6e-07 |
| >d1a6da1 a.129.1.2 (A:17-145,A:404-519) Thermosome, E domain {Archaeon Thermoplasma acidophilum, alpha chain [TaxId: 2303]} Length = 245 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: GroEL equatorial domain-like superfamily: GroEL equatorial domain-like family: Group II chaperonin (CCT, TRIC), ATPase domain domain: Thermosome, E domain species: Archaeon Thermoplasma acidophilum, alpha chain [TaxId: 2303]
Score = 64.0 bits (155), Expect = 2e-14
Identities = 15/52 (28%), Positives = 26/52 (50%)
Query: 1 MQSNCWYGVDITKEDISDNMESCVWEPAIVKKNAITAASEAACLVLSVDETI 52
+ GVD+ + D V +P VK +A+ +A E A ++L +D+ I
Sbjct: 194 EKGRISVGVDLDNNGVGDMKAKGVVDPLRVKTHALESAVEVATMILRIDDVI 245
|
| >d1a6db1 a.129.1.2 (B:20-144,B:404-521) Thermosome, E domain {Archaeon Thermoplasma acidophilum, beta chain [TaxId: 2303]} Length = 243 | Back information, alignment and structure |
|---|
| >d1q3qa1 a.129.1.2 (A:9-145,A:406-526) Thermosome, E domain {Archaeon Thermococcus sp. ks-1, alpha chain [TaxId: 79679]} Length = 258 | Back information, alignment and structure |
|---|
| >d1we3a1 a.129.1.1 (A:3-138,A:409-527) GroEL, E domain {Thermus thermophilus [TaxId: 274]} Length = 255 | Back information, alignment and structure |
|---|
| >d1sjpa1 a.129.1.1 (A:62-134,A:408-514) GroEL, E domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]} Length = 180 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 99 | |||
| d1a6db1 | 243 | Thermosome, E domain {Archaeon Thermoplasma acidop | 99.45 | |
| d1a6da1 | 245 | Thermosome, E domain {Archaeon Thermoplasma acidop | 99.36 | |
| d1q3qa1 | 258 | Thermosome, E domain {Archaeon Thermococcus sp. ks | 99.09 | |
| d1we3a1 | 255 | GroEL, E domain {Thermus thermophilus [TaxId: 274] | 98.96 | |
| d1sjpa1 | 180 | GroEL, E domain {Mycobacterium tuberculosis, GroEL | 98.74 | |
| d1ioka1 | 252 | GroEL, E domain {Paracoccus denitrificans [TaxId: | 98.16 | |
| d1kp8a1 | 252 | GroEL, E domain {Escherichia coli [TaxId: 562]} | 97.15 |
| >d1a6db1 a.129.1.2 (B:20-144,B:404-521) Thermosome, E domain {Archaeon Thermoplasma acidophilum, beta chain [TaxId: 2303]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: GroEL equatorial domain-like superfamily: GroEL equatorial domain-like family: Group II chaperonin (CCT, TRIC), ATPase domain domain: Thermosome, E domain species: Archaeon Thermoplasma acidophilum, beta chain [TaxId: 2303]
Probab=99.45 E-value=1.3e-14 Score=107.48 Aligned_cols=52 Identities=37% Similarity=0.569 Sum_probs=49.0
Q ss_pred CCCceeeeeccCCccccccccCcccchHhHHHHHHHHHHHHHHHhchhhHhh
Q psy17079 2 QSNCWYGVDITKEDISDNMESCVWEPAIVKKNAITAASEAACLVLSVDETIK 53 (99)
Q Consensus 2 ~G~~~~GVdi~~G~i~Dm~e~GV~Ep~~VK~~~ik~A~EaA~~ILrID~iI~ 53 (99)
+|+.++|||+.+|.+.||.+.|||||+.||+++|++|+|+|++|||||+||.
T Consensus 192 ~~~~~~Gvd~~~g~i~d~~~~gV~dp~~vk~~ai~~A~e~a~~iL~iD~iis 243 (243)
T d1a6db1 192 KGNKTYGINVFTGEIEDMVKNGVIEPIRVGKQAIESATEAAIMILRIDDVIA 243 (243)
T ss_dssp TTCTTEEEETTTTEEEETTTTTCEEEHHHHHHHHHHHHHHHHHHHHEEEEEC
T ss_pred CCCCceeEECcCCEEeehHhcccEecHHHHHHHHHHHHHHHHHHHHHHHhcC
Confidence 3667899999999999999999999999999999999999999999999873
|
| >d1a6da1 a.129.1.2 (A:17-145,A:404-519) Thermosome, E domain {Archaeon Thermoplasma acidophilum, alpha chain [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1q3qa1 a.129.1.2 (A:9-145,A:406-526) Thermosome, E domain {Archaeon Thermococcus sp. ks-1, alpha chain [TaxId: 79679]} | Back information, alignment and structure |
|---|
| >d1we3a1 a.129.1.1 (A:3-138,A:409-527) GroEL, E domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sjpa1 a.129.1.1 (A:62-134,A:408-514) GroEL, E domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ioka1 a.129.1.1 (A:2-136,A:410-526) GroEL, E domain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1kp8a1 a.129.1.1 (A:2-136,A:410-526) GroEL, E domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|