Psyllid ID: psy17083


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60
MSNRLGRNIRASVQCRPGWRGEFCDQCKPYPGCKHGYCNGSSWQCICDTNWGGILCDQGH
ccccccccccccEEccccccccccccccccccccccEEcccccEEEcccccccccccccc
cccccccccccEEEccccccccccccccccccccccccccccEEEEEcccccccEccccc
msnrlgrnirasvqcrpgwrgefcdqckpypgckhgycngsswqcicdtnwggilcdqgh
msnrlgrnirasvqcrpgwrgefCDQCKPYPGCKHGYCNGSSWQCICDTNWGGILCDQGH
MSNRLGRNIRASVQCRPGWRGEFCDQCKPYPGCKHGYCNGSSWQCICDTNWGGILCDQGH
********IRASVQCRPGWRGEFCDQCKPYPGCKHGYCNGSSWQCICDTNWGGILC****
*****GR*IRASVQCRPGWRGEFCDQCKPYPGCKHGYCNGSSWQCICDTNWGGILCDQ**
MSNRLGRNIRASVQCRPGWRGEFCDQCKPYPGCKHGYCNGSSWQCICDTNWGGILCDQGH
*****GRNIRASVQCRPGWRGEFCDQCKPYPGCKHGYCNGSSWQCICDTNWGGILCD***
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNRLGRNIRASVQCRPGWRGEFCDQCKPYPGCKHGYCNGSSWQCICDTNWGGILCDQGH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query60 2.2.26 [Sep-21-2011]
P18168 1404 Protein serrate OS=Drosop yes N/A 0.75 0.032 0.755 1e-16
Q90Y57 1242 Protein jagged-1a OS=Dani yes N/A 0.816 0.039 0.58 2e-10
Q9Y219 1238 Protein jagged-2 OS=Homo no N/A 0.866 0.042 0.547 5e-10
P78504 1218 Protein jagged-1 OS=Homo no N/A 0.733 0.036 0.6 8e-10
Q9QXX0 1218 Protein jagged-1 OS=Mus m yes N/A 0.733 0.036 0.6 9e-10
Q9QYE5 1247 Protein jagged-2 OS=Mus m no N/A 0.866 0.041 0.528 9e-10
P97607 1202 Protein jagged-2 (Fragmen yes N/A 0.866 0.043 0.528 9e-10
Q63722 1219 Protein jagged-1 OS=Rattu no N/A 0.733 0.036 0.6 9e-10
Q9NR61 685 Delta-like protein 4 OS=H no N/A 0.783 0.068 0.541 1e-09
Q90Y54 1213 Protein jagged-1b OS=Dani no N/A 0.733 0.036 0.6 2e-09
>sp|P18168|SERR_DROME Protein serrate OS=Drosophila melanogaster GN=Ser PE=1 SV=3 Back     alignment and function desciption
 Score = 84.7 bits (208), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 34/45 (75%), Positives = 40/45 (88%)

Query: 14  QCRPGWRGEFCDQCKPYPGCKHGYCNGSSWQCICDTNWGGILCDQ 58
           +CRPGWRG  C++C  YPGCKHG CNGS+W+C+CDTNWGGILCDQ
Sbjct: 302 ECRPGWRGPLCNECMVYPGCKHGSCNGSAWKCVCDTNWGGILCDQ 346




Acts as a ligand for Notch (N) receptor. Essential for proper ectodermal development. Serrate represents an element in a network of interacting molecules operating at the cell surface during the differentiation of certain tissues.
Drosophila melanogaster (taxid: 7227)
>sp|Q90Y57|JAG1A_DANRE Protein jagged-1a OS=Danio rerio GN=jag1a PE=2 SV=1 Back     alignment and function description
>sp|Q9Y219|JAG2_HUMAN Protein jagged-2 OS=Homo sapiens GN=JAG2 PE=1 SV=3 Back     alignment and function description
>sp|P78504|JAG1_HUMAN Protein jagged-1 OS=Homo sapiens GN=JAG1 PE=1 SV=3 Back     alignment and function description
>sp|Q9QXX0|JAG1_MOUSE Protein jagged-1 OS=Mus musculus GN=Jag1 PE=1 SV=1 Back     alignment and function description
>sp|Q9QYE5|JAG2_MOUSE Protein jagged-2 OS=Mus musculus GN=Jag2 PE=2 SV=2 Back     alignment and function description
>sp|P97607|JAG2_RAT Protein jagged-2 (Fragment) OS=Rattus norvegicus GN=Jag2 PE=2 SV=1 Back     alignment and function description
>sp|Q63722|JAG1_RAT Protein jagged-1 OS=Rattus norvegicus GN=Jag1 PE=1 SV=2 Back     alignment and function description
>sp|Q9NR61|DLL4_HUMAN Delta-like protein 4 OS=Homo sapiens GN=DLL4 PE=1 SV=1 Back     alignment and function description
>sp|Q90Y54|JAG1B_DANRE Protein jagged-1b OS=Danio rerio GN=jag1b PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query60
270010674 1246 hypothetical protein TcasGA2_TC010113 [T 0.733 0.035 0.931 2e-18
332020153 1189 Protein jagged-1 [Acromyrmex echinatior] 0.85 0.042 0.843 2e-18
189239617 1303 PREDICTED: serrate [Tribolium castaneum] 0.75 0.034 0.911 2e-18
328784937 1203 PREDICTED: protein jagged-1 [Apis mellif 0.85 0.042 0.823 2e-18
350422307 1205 PREDICTED: protein jagged-1-like [Bombus 0.85 0.042 0.823 2e-18
383859516 1215 PREDICTED: protein jagged-1b-like [Megac 0.85 0.041 0.823 2e-18
340714233 1205 PREDICTED: protein jagged-1-like [Bombus 0.85 0.042 0.823 2e-18
380026105 1203 PREDICTED: LOW QUALITY PROTEIN: protein 0.85 0.042 0.823 2e-18
345489855 1181 PREDICTED: protein jagged-1b [Nasonia vi 0.85 0.043 0.823 3e-18
242017193 1214 Jagged-2 precursor, putative [Pediculus 0.733 0.036 0.909 2e-17
>gi|270010674|gb|EFA07122.1| hypothetical protein TcasGA2_TC010113 [Tribolium castaneum] Back     alignment and taxonomy information
 Score = 96.7 bits (239), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 44/44 (100%)

Query: 15  CRPGWRGEFCDQCKPYPGCKHGYCNGSSWQCICDTNWGGILCDQ 58
           CRPGWRG+FC+QC+PYPGCKHGYCNGSSWQCICDTNWGGILCDQ
Sbjct: 224 CRPGWRGDFCEQCEPYPGCKHGYCNGSSWQCICDTNWGGILCDQ 267




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332020153|gb|EGI60597.1| Protein jagged-1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|189239617|ref|XP_969486.2| PREDICTED: serrate [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328784937|ref|XP_394560.2| PREDICTED: protein jagged-1 [Apis mellifera] Back     alignment and taxonomy information
>gi|350422307|ref|XP_003493123.1| PREDICTED: protein jagged-1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383859516|ref|XP_003705240.1| PREDICTED: protein jagged-1b-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340714233|ref|XP_003395635.1| PREDICTED: protein jagged-1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380026105|ref|XP_003696800.1| PREDICTED: LOW QUALITY PROTEIN: protein jagged-1-like [Apis florea] Back     alignment and taxonomy information
>gi|345489855|ref|XP_001601286.2| PREDICTED: protein jagged-1b [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|242017193|ref|XP_002429076.1| Jagged-2 precursor, putative [Pediculus humanus corporis] gi|212513940|gb|EEB16338.1| Jagged-2 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query60
FB|FBgn0004197 1404 Ser "Serrate" [Drosophila mela 0.75 0.032 0.755 6.9e-19
UNIPROTKB|F1NND2143 JAG2 "Uncharacterized protein" 0.866 0.363 0.509 4.2e-15
UNIPROTKB|Q9Y219 1238 JAG2 "Protein jagged-2" [Homo 0.866 0.042 0.547 6e-14
ZFIN|ZDB-GENE-011128-2 1253 jag1a "jagged 1a" [Danio rerio 0.816 0.039 0.58 6.1e-14
UNIPROTKB|G3X6N5 1081 JAG2 "Delta-like protein" [Bos 0.866 0.048 0.528 8.2e-14
UNIPROTKB|F1NMD6 1149 JAG2 "Delta-like protein" [Gal 0.866 0.045 0.509 1.1e-13
UNIPROTKB|F1NSD2 1211 JAG2 "Delta-like protein" [Gal 0.866 0.042 0.509 1.2e-13
UNIPROTKB|B4DYR1 1059 JAG1 "Delta-like protein" [Hom 0.733 0.041 0.6 1.3e-13
UNIPROTKB|F1PRK6 1092 JAG2 "Delta-like protein" [Can 0.866 0.047 0.528 1.4e-13
UNIPROTKB|F1M9G2 1199 Jag2 "Delta-like protein" [Rat 0.866 0.043 0.528 1.5e-13
FB|FBgn0004197 Ser "Serrate" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 241 (89.9 bits), Expect = 6.9e-19, P = 6.9e-19
 Identities = 34/45 (75%), Positives = 40/45 (88%)

Query:    14 QCRPGWRGEFCDQCKPYPGCKHGYCNGSSWQCICDTNWGGILCDQ 58
             +CRPGWRG  C++C  YPGCKHG CNGS+W+C+CDTNWGGILCDQ
Sbjct:   302 ECRPGWRGPLCNECMVYPGCKHGSCNGSAWKCVCDTNWGGILCDQ 346




GO:0005886 "plasma membrane" evidence=IDA
GO:0030673 "axolemma" evidence=IDA
GO:0005154 "epidermal growth factor receptor binding" evidence=NAS
GO:0036011 "imaginal disc-derived leg segmentation" evidence=IMP
GO:0005887 "integral to plasma membrane" evidence=NAS
GO:0007219 "Notch signaling pathway" evidence=IMP;NAS
GO:0005112 "Notch binding" evidence=NAS;TAS;IPI
GO:0048749 "compound eye development" evidence=IMP;TAS
GO:0007435 "salivary gland morphogenesis" evidence=IMP;NAS
GO:0007451 "dorsal/ventral lineage restriction, imaginal disc" evidence=TAS
GO:0042688 "crystal cell differentiation" evidence=IMP;TAS
GO:0035167 "larval lymph gland hemopoiesis" evidence=IEP
GO:0042689 "regulation of crystal cell differentiation" evidence=TAS
GO:0005102 "receptor binding" evidence=NAS
GO:0016021 "integral to membrane" evidence=IEA;NAS
GO:0007431 "salivary gland development" evidence=NAS
GO:0007436 "larval salivary gland morphogenesis" evidence=IMP
GO:0035170 "lymph gland crystal cell differentiation" evidence=TAS
GO:0005509 "calcium ion binding" evidence=IEA
GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP
GO:0046331 "lateral inhibition" evidence=IMP
GO:0007423 "sensory organ development" evidence=IMP
GO:0035017 "cuticle pattern formation" evidence=IMP
GO:0045746 "negative regulation of Notch signaling pathway" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0016324 "apical plasma membrane" evidence=IDA
GO:0035214 "eye-antennal disc development" evidence=IMP
GO:0030718 "germ-line stem cell maintenance" evidence=IGI
GO:0009986 "cell surface" evidence=IDA
UNIPROTKB|F1NND2 JAG2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y219 JAG2 "Protein jagged-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-011128-2 jag1a "jagged 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G3X6N5 JAG2 "Delta-like protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NMD6 JAG2 "Delta-like protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NSD2 JAG2 "Delta-like protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|B4DYR1 JAG1 "Delta-like protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PRK6 JAG2 "Delta-like protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1M9G2 Jag2 "Delta-like protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P97607JAG2_RATNo assigned EC number0.52830.86660.0432yesN/A
Q90Y57JAG1A_DANRENo assigned EC number0.580.81660.0394yesN/A
Q9QXX0JAG1_MOUSENo assigned EC number0.60.73330.0361yesN/A
P18168SERR_DROMENo assigned EC number0.75550.750.0320yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 60
KOG4289|consensus 2531 98.86
KOG1225|consensus 525 98.62
KOG1219|consensus 4289 98.58
KOG1225|consensus 525 98.57
KOG1226|consensus 783 98.29
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 98.07
smart0005163 DSL delta serrate ligand. 98.07
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 98.01
PF0000832 EGF: EGF-like domain This is a sub-family of the P 97.91
KOG1226|consensus 783 97.85
KOG4289|consensus 2531 97.77
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 97.76
KOG1219|consensus 4289 97.62
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.41
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 97.13
smart0018135 EGF Epidermal growth factor-like domain. 97.12
PF0141463 DSL: Delta serrate ligand; InterPro: IPR001774 Lig 97.04
KOG4260|consensus 350 97.02
cd0005336 EGF Epidermal growth factor domain, found in epide 96.82
KOG0994|consensus 1758 96.67
KOG1214|consensus 1289 96.55
PHA02887126 EGF-like protein; Provisional 96.51
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 96.31
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 96.3
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 96.14
PHA03099139 epidermal growth factor-like protein (EGF-like pro 96.12
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 95.84
KOG1217|consensus 487 94.64
KOG0994|consensus 1758 94.26
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 94.16
KOG1217|consensus 487 94.15
PF1266224 cEGF: Complement Clr-like EGF-like 92.84
PHA02887126 EGF-like protein; Provisional 92.69
KOG4260|consensus 350 90.89
PHA03099139 epidermal growth factor-like protein (EGF-like pro 90.34
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 87.34
KOG1836|consensus 1705 86.85
KOG3607|consensus716 85.32
KOG3516|consensus 1306 85.25
KOG1836|consensus 1705 84.51
KOG1218|consensus316 84.26
PF12955103 DUF3844: Domain of unknown function (DUF3844); Int 84.06
KOG3607|consensus716 80.91
>KOG4289|consensus Back     alignment and domain information
Probab=98.86  E-value=3.1e-09  Score=72.64  Aligned_cols=50  Identities=28%  Similarity=0.909  Sum_probs=44.2

Q ss_pred             CCCeeEcCCCCcCCCCC----CCCCCCCCC-CCeEEc--CCCeEEeCCCcccCCCCcC
Q psy17083          9 IRASVQCRPGWRGEFCD----QCKPYPGCK-HGYCNG--SSWQCICDTNWGGILCDQG   59 (60)
Q Consensus         9 ~~~~C~C~~g~~g~~C~----~c~~~~~C~-~g~C~~--~~~~C~C~~g~~G~~C~~~   59 (60)
                      +...|.|++||+|.+|+    .|...| |. +|+|..  +.|+|.|.++|+|..|+.+
T Consensus      1220 nglrCrCPpGFTgd~CeTeiDlCYs~p-C~nng~C~srEggYtCeCrpg~tGehCEvs 1276 (2531)
T KOG4289|consen 1220 NGLRCRCPPGFTGDYCETEIDLCYSGP-CGNNGRCRSREGGYTCECRPGFTGEHCEVS 1276 (2531)
T ss_pred             CceeEeCCCCCCcccccchhHhhhcCC-CCCCCceEEecCceeEEecCCccccceeee
Confidence            45689999999999997    488888 98 689986  8899999999999999875



>KOG1225|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>PHA02887 EGF-like protein; Provisional Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PHA02887 EGF-like protein; Provisional Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>KOG3607|consensus Back     alignment and domain information
>KOG3516|consensus Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information
>PF12955 DUF3844: Domain of unknown function (DUF3844); InterPro: IPR024382 This presumed domain is found in fungal species Back     alignment and domain information
>KOG3607|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query60
2vj2_A169 Human Jagged-1, Domains Dsl And Egfs1-3 Length = 16 2e-10
2kb9_A44 Human Jagged-1, Exon 6 Length = 44 3e-10
>pdb|2VJ2|A Chain A, Human Jagged-1, Domains Dsl And Egfs1-3 Length = 169 Back     alignment and structure

Iteration: 1

Score = 60.8 bits (146), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Query: 9 IRASVQCRPGWRGEFCDQCKPYPGCKHGYCNGSSWQCICDTNWGGILCDQ 58 + +C+ GW+G +CD+C P+PGC HG CN WQC+C+TNWGG LCD+ Sbjct: 81 LPGDCRCQYGWQGLYCDKCIPHPGCVHGICN-EPWQCLCETNWGGQLCDK 129
>pdb|2KB9|A Chain A, Human Jagged-1, Exon 6 Length = 44 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query60
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 8e-09
2vj2_A 169 Jagged-1; signalling, polymorphism, glycoprotein, 4e-04
2ygq_A 324 WIF-1, WNT inhibitory factor 1; signaling protein, 7e-07
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 5e-06
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
 Score = 47.4 bits (113), Expect = 8e-09
 Identities = 27/45 (60%), Positives = 36/45 (80%), Gaps = 1/45 (2%)

Query: 14  QCRPGWRGEFCDQCKPYPGCKHGYCNGSSWQCICDTNWGGILCDQ 58
           +C+ GW+G +CD+C P+PGC HG CN   WQC+C+TNWGG LCD+
Sbjct: 86  RCQYGWQGLYCDKCIPHPGCVHGICNE-PWQCLCETNWGGQLCDK 129


>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Length = 463 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query60
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.09
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.07
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.06
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.01
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 98.98
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 98.95
2ygq_A 324 WIF-1, WNT inhibitory factor 1; signaling protein, 98.8
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.73
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.71
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.69
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 98.67
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 98.66
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 98.63
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 98.61
2gy5_A 423 Angiopoietin-1 receptor; ligand-binding domain, tr 98.59
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.58
3k6s_B 687 Integrin beta-2; cell receptor, adhesion molecule, 98.57
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 98.54
3fcs_B 690 Integrin beta-3; beta propeller, rossmann fold, EG 98.47
1a3p_A45 Epidermal growth factor; disulfide connectivities, 98.45
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 98.44
2gy5_A 423 Angiopoietin-1 receptor; ligand-binding domain, tr 98.44
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.4
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 98.39
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 98.35
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 98.31
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 98.3
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 98.28
2bou_A143 EGF-like module containing mucin-like hormone rece 98.27
1aut_L114 Activated protein C; serine proteinase, plasma cal 98.26
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.25
2vh0_B134 Activated factor XA light chain; serine protease, 98.23
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 98.21
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 98.2
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 98.16
1nql_B53 Epidermal growth factor; cell surface receptor, ty 98.09
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 98.06
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 98.03
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 98.03
2bou_A143 EGF-like module containing mucin-like hormone rece 98.02
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 98.02
4fbr_A 267 Lectin, myxobacterial hemagglutinin; beta-barrel, 98.01
2k2s_B61 Micronemal protein 6; microneme protein complex, c 98.0
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 97.98
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 97.91
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 97.91
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 97.86
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 97.81
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 97.81
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 97.8
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 97.76
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.74
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 97.71
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 97.66
3v65_B 386 Low-density lipoprotein receptor-related protein; 97.58
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 97.5
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 97.47
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 97.47
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 97.46
2e26_A 725 Reelin, reeler protein; signaling protein; HET: NA 97.45
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 97.4
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 97.39
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 97.38
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 97.34
1nfu_B 195 Coagulation factor XA, light chain; hydrolase; HET 97.3
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 97.3
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 97.27
1aut_L114 Activated protein C; serine proteinase, plasma cal 97.25
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 97.2
2vh0_B134 Activated factor XA light chain; serine protease, 97.18
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 97.12
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 97.11
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 97.1
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 97.09
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 97.08
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 97.04
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 96.97
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 96.96
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 96.95
2w86_A 147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 96.85
1a3p_A45 Epidermal growth factor; disulfide connectivities, 96.84
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 96.8
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 96.72
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 96.63
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 96.53
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 96.44
1nql_B53 Epidermal growth factor; cell surface receptor, ty 96.43
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 96.39
1uzk_A 162 Fibrillin-1; glycoprotein, extra-cellular matrix, 96.36
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 96.32
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 96.3
2e26_A 725 Reelin, reeler protein; signaling protein; HET: NA 96.26
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 96.25
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 96.24
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 96.22
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 96.21
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 96.01
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 95.98
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 95.92
2i9a_A145 Urokinase-type plasminogen activator; growth facto 95.91
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 95.54
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 95.18
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 94.73
2y38_A403 Laminin subunit alpha-5; structural protein, cell 94.56
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 94.53
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 94.37
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 94.25
2ddu_A 387 Reelin; beta-jelly-roll, signaling protein; 2.05A 94.18
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 93.75
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 93.72
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 92.79
3t3p_B472 Integrin beta-3; integrin, cell adhesion, blood cl 92.58
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 90.95
3v4v_B503 Integrin beta-7; cell adhesion, madcam-1, membrane 90.47
3v65_B 386 Low-density lipoprotein receptor-related protein; 88.43
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 88.43
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 87.47
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 87.44
3fl7_A 536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 86.15
3g5c_A510 ADAM 22; alpha/beta fold, cross-linked domain, cel 83.7
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 82.7
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 82.29
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 82.15
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 81.55
3t5o_A 913 Complement component C6; macpf, MAC, membrane atta 80.95
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
Probab=99.09  E-value=1.4e-10  Score=60.78  Aligned_cols=49  Identities=35%  Similarity=0.941  Sum_probs=34.3

Q ss_pred             CCeeEcCCCCcCCCCC----CCCCCCCCC-CCeEEc--CCCeEEeCCCcccCCCCcC
Q psy17083         10 RASVQCRPGWRGEFCD----QCKPYPGCK-HGYCNG--SSWQCICDTNWGGILCDQG   59 (60)
Q Consensus        10 ~~~C~C~~g~~g~~C~----~c~~~~~C~-~g~C~~--~~~~C~C~~g~~G~~C~~~   59 (60)
                      .+.|.|++||+|..|+    +|...+ |. +++|++  +.++|.|++||.|..|+.+
T Consensus        65 ~~~C~C~~G~~G~~C~~~~~~C~~~~-C~~~g~C~~~~g~~~C~C~~G~~G~~C~~~  120 (135)
T 2vj3_A           65 EFQCICMPGYEGVHCEVNTDECASSP-CLHNGRCLDKINEFQCECPTGFTGHLCQVD  120 (135)
T ss_dssp             CEEEECCTTEESSSSCEECCTTTTCC-STTTCEEEECSSCEEEECCTTEESSSSCEE
T ss_pred             CceeeCCCCCcCCcceecCCcccCCC-cCCCCEeECCCCCeEEECCCCCcCCccCcc
Confidence            4577888888887775    355555 76 467775  5577888888888887654



>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>2ddu_A Reelin; beta-jelly-roll, signaling protein; 2.05A {Mus musculus} Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Back     alignment and structure
>3t3p_B Integrin beta-3; integrin, cell adhesion, blood clotting, fibrinogen, platele; HET: NAG BMA MAN; 2.20A {Homo sapiens} PDB: 3t3m_B* 3nig_B* 3nif_B* 3nid_B* 2vdr_B* 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v4v_B Integrin beta-7; cell adhesion, madcam-1, membrane; HET: NAG BMA MAN 0DU; 3.10A {Homo sapiens} PDB: 3v4p_B* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>3g5c_A ADAM 22; alpha/beta fold, cross-linked domain, cell adhesion, cleavag of basic residues, EGF-like domain, glycoprotein, membrane, phosphoprotein; HET: NAG; 2.36A {Homo sapiens} Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query60
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 99.03
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.92
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.91
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.85
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 98.83
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.77
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.75
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.67
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.65
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.55
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 98.25
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 98.24
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 98.24
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 98.19
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 98.15
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 98.06
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 97.99
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 97.87
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 97.81
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 97.43
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 97.38
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 97.37
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 97.33
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 97.32
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 97.25
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 97.23
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 97.22
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 97.18
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 97.15
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.15
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.15
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 97.08
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 96.97
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 96.96
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.7
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.57
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 96.51
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 96.49
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.44
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 96.3
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.27
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 96.27
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 96.24
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 96.15
d1kloa351 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 95.95
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 95.73
d1i0ua241 Low density lipoprotein (LDL) receptor, different 95.31
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 95.04
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 93.64
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 92.23
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 91.62
d1kloa256 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 91.44
d1nt0a345 Mannose-binding protein associated serine protease 91.34
d1szba245 Mannose-binding protein associated serine protease 89.91
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 89.4
d3bpse140 Low density lipoprotein (LDL) receptor, different 88.02
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Activated protein c (autoprothrombin IIa)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.03  E-value=9e-11  Score=51.30  Aligned_cols=34  Identities=32%  Similarity=0.940  Sum_probs=30.3

Q ss_pred             CCCCCCCCCCCeEEc--CCCeEEeCCCcccCCCCcCC
Q psy17083         26 QCKPYPGCKHGYCNG--SSWQCICDTNWGGILCDQGH   60 (60)
Q Consensus        26 ~c~~~~~C~~g~C~~--~~~~C~C~~g~~G~~C~~~~   60 (60)
                      .|..+| |.||+|++  +.|.|.|++||.|..|+++|
T Consensus        10 ~C~~~P-C~nG~C~~~~~~y~C~C~~G~~G~~Ce~~I   45 (48)
T d1autl1          10 PCASLC-CGHGTCIDGIGSFSCDCRSGWEGRFCQREV   45 (48)
T ss_dssp             SSSSTT-TTSEEECCCSSCCCEEECTTEESTTSCEEC
T ss_pred             cccCCC-CCCCEEECCCCCCeEeCCCCCcCCCccccc
Confidence            577788 99999987  77999999999999999876



>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure