Psyllid ID: psy17091


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250
MKPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFEPEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINKSENINSSISLDFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTNIHSIEYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAGIRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYLEKYFYRTFSLIDALEKNIVGEIYNRYEKIGLKIIAAYMKKLSKNDVEKFYSIHKNRPFFKNLVNFMISGPVFIQVLEGEDAIKKHRILIGDTDPIKAAKGTIRADFAESIDKNIVHELGEMPFRAKQLQKWIHKFGVSDFNKMTDLSMSLRKKLKNSVYIKAPHIMSDQISFDGTRKWIFHVKKNIIETVFIPEKNRNTLCISTQVGCAINCIFCSTGRQGFVRNLTVGEIIGQLWVTEFKLRREKNIKINSQGKRQITNIVMMGMGEPLLNYKSTIGALKLILSDHAYGLSRRHVILSTSGIIPMIDKLAQECPVELAVSLHASNNNLRNKLVPISKKYPLKELILACHRYITYSPRHMITFEYCMLHGINDTDIHAIELISLMRKNKILTSCKINLIPFNCFPNSNLICSKNSRIKIFAKILMNSGIFVTIRKIRGNDINAACGQLSGEETDIVKKEMYSFIDELNGDNLSLRPEGTASVIRSVIENNLIYDGPKRLWYSGPMFRHERPQYGRYRQFYQIGVEAIGFPGPDIDAELIIMCSRLWKNLNLKNICLELNSIGNFNERKKYCIDLINYIKKHKDSKWFCEDIKHSLYLNSLRVLDSKNLIIREILINAPKLLDYLEKDSLDHFYGIQKILNYNNISYKINTKLVRGMDYYNRTVFEWTTDKLGSQNSICGGGRYDFLIKKFSNKFVPASGFAIGIERLIELIKKININHNFSHQCDIYIVHVGKEAELKAFVLSENLRTLGLKVILNCVFNNIHESFKSQMKRANASNANFAAIIGENEIINNTLIIKDLRNKYEDPTLKQISISFKDAENYFYKKIIKNINN
cccEEEEEccccccHHHHHHHHHccccEEEcccccccccccccEEEEccEEEEEEEccccccccccHHHHHHHHHHHHHHHHccEEEEEEcccccccHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHccccccEEccccccccHHHHHHHHHHHccccccccccccccccccccccEEEEEccccccHHHHHHHHHccccEEEccccccccccccccEEEccEEEEEEEccccccccccccccHHHHHHHHHHHHHHccEEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHHHHcccccccHHHHcccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccccccEEEEccccccccEEEEEEcccccccHHHHHHHHHHHHHHccccccEEEEEEccccccHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHcccccEEEEEEcccccccccccccccccccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHccHHHHHHHHccEEEcccccccccccccccEEEEEEccccEEEEEEEEccccccEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEcccccccccccHHHHHHHHHccccccccccEEEEcccccHHHHHHHHcccccEEEEEccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEEEEEcccccccHHHHHHHHHHHHccccccccEEcccccccccccccccccHHHHHHHHHHHHHcccEEEEEEccccHHHHHHcccccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHccccccccEEEEEEcccccccccccccccccccccEEEcccccccHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHHHHHccccccccHHHHcccccccccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccEEEccccccccccccccEEEEEccccccccccccccccHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEEccHHHHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHHcccccEEEEEccccccccEEEEEcccccccccccHHcccHHHHHHHHHHHHHHHHHcc
cccEEEEEccccccHHHHHHHHHcccEEEcccccccccccEEEEEEEccEEEEEEccccccHHHHHHHHHHHccccccccccEEEEEEEEEcccccHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHcccccccEEEHcccccHHHHHHHHHHHcccccHcccccccccccccccEEEEEEccccccHHHHHHHHHcccEEEcccccccccccEEEEEEEccEEEEEEccccccHHHHccHHHHHHHHHHHHHHHHHccEEEEEEEccccccHHHHHHHHHHHHcccEEEEEEEcccccccccHHHHHHHHHHHHcHcccccEEEEEcccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccEEEEEEEEEccccccEEEEEEccHHHccHHHHHHHHHHHHHHccccHHHHcccHHHHHHHHHHHccEEEEEEEEcccHHHHHHHcHHHcccccHHHHHcccccccEEEEEEEcccHHHHHHHHHccccHHHcccccHHHHHccccccccEEEcccHHHHHHHHHHHccHHHccccHHHHHHHHHHHHHHHcHEEEEccHHHHHccccccHHHHHEEHHccEEEEEEEccccccEEEEEccccEEEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHccEEEcccccccEEEEEEccccccHcccHcHHHHHHHHHHHccccccccEEEEccccHHHHHHHHHHHccEEEEEEEccccccHHHccccccccccHHHHHHHHHHHHHcccccEEEEEEEEEccccccHHHHHHHHHHHHHcccccccEEEEcccccccccccccccccHHHHHHHHHHHcccEEEEEEcccccHHHHHccccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccccccEEEEccccccccccccccHHHHEEEEEEEccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccHHHHHHHHEEHHHHHHcccHHHHHHHHHHcHHHHHHHHHHcccHHHHHHHHHHccccEEEEEccEEEccccccccEEEEEcccccccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccccccEEEEEEccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHcHHHHHHHHHHHHHHHHccccccccEEEEEcHHHHHHHHHHHHHHHcc
MKPVLVLvgrpnvgkstlfnrltnsrdalvanypgltrdrhygegyigkkSFIIidtggfepevkKGIMHEMTKQTKQAIIESDIIIFIVDgrqglveqDKLITNFLRKSGQPIVLVINKseninssisldfyelgignpHIISALYGNGIKNFLENILTIElpykkffkkkeftnihSIEYIKVAIvgkpnvgkSTLINSllgenrvitydtpgttrDSIKSLFEynnkkyilidtagirrrnKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTSRITRALISAIknhppcrkklirpklryahqggknppiiviHGNRLKYIGNDYKRYLEKYFYRTFSLIDALEKNIVGEIYNRYEKIGLKIIAAYMKKLSKNDVEKFYSIHKNRPFFKNLVNFMISGPVFIQVLEGEDAIKKHRiligdtdpikaakgtiradFAESIDKNIVHELGEMPFRAKQLQKWIHKFgvsdfnkmTDLSMSLRKKLKnsvyikaphimsdqisfdgtRKWIFHVKKNIIEtvfipeknrntlcistqvgcaincifcstgrqgfvrNLTVGEIIGQLWVTEFKLRREKNIKINSQGKRQITNIVMMGmgepllnyKSTIGALKLILSDHAYGLSRRHVILSTSGIIPMIDKLAQECPVELAVSLHAsnnnlrnklvpiskkyplKELILACHRYitysprhmiTFEYCmlhgindtdIHAIELISLMRKNKILTSckinlipfncfpnsnlicsknSRIKIFAKILMNSGIFVTIRKIrgndinaacgqlsgeeTDIVKKEMYSFIDelngdnlslrpegtASVIRSVIEnnliydgpkrlwysgpmfrherpqygryrqFYQIGVeaigfpgpdidAELIIMCSRLWKNLNLKNICLELnsignfneRKKYCIDLINYIKkhkdskwfcedikhslylnslrvldsknLIIREILINAPKLLDYLEKDSLDHFYGIQKILNYNNISYKINTKLVRGMDYYNRTVFEWTtdklgsqnsicgggryDFLIKKfsnkfvpasgfAIGIERLIELIKKINinhnfshqcDIYIVHVGKEAELKAFVLSENLRTLGLKVILNCVFNNIHESFKSQMKRANASNANFAAIIGENEIINNTLIIKDLrnkyedptlkqiSISFKDAENYFYKKIIKNINN
mkpvlvlvgrpnvgkstlfnrltnsrdaLVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFEPEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINKSENINSSISLDFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTNIHSIEYIKVAIVGKPNVGKSTLINsllgenrvitydtpgttrdsikslfeynnkkyilidtagirrrnKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTSRITRALISaiknhppcrkKLIRPKLRyahqggknppiivihgnrLKYIGNDYKRYLEKYFYRTFSLIDALEKNIVGEIYNRYEKIGLKIIAAYMKKLSKNDVEKFYSIHKNRPFFKNLVNFMISGPVFIQVLEGEDAIKKHRiligdtdpikaAKGTIRADFAESIDKNIVHELGEMPFRAKQLQKWIHKFGVSDFNKMTDLSMSLRKKLKNSVYIKaphimsdqisfdgTRKWIFHVKKNIIetvfipeknrNTLCISTQVGCAINCIFCSTGRQGFVRNLTVGEIIGQLWvtefklrreknikinsqgkrqitnIVMMGMGEPLLNYKSTIGALKLILSDHAYGLSRRHVILSTSGIIPMIDKLAQECPVELAVSLhasnnnlrnklvpiskkyPLKELILACHRYITYSPRHMITFEYCMLHGINDTDIHAIELISLMRKNKILTSCKINLIPFNCFPNSNLICSKNSRIKIFAKILMNSGIFVTIRKIRGNDINAACGQLSGEETDIVKKEMYSFIDElngdnlslrpEGTASVIRSVIENNLIYDGPKRLWYSGPMFRHERPQYGRYRQFYQIGVEAIGFPGPDIDAELIIMCSRLWKNLNLKNICLELnsignfneRKKYCIDLINYIKKHKDSKWFCEDIKHSLYLNSLRVLDSKNLIIREILINAPKLLDYLEKDSLDHFYGIQkilnynnisYKINTKLVRGMDYYNRTVFEWttdklgsqnsiCGGGRYDFLIKKFSNKFVPASGFAIGIERLIELIKKININHNFSHQCDIYIVHVGKEAELKAFVLSENLRTLGLKVILNCVFNNIHESFKSQMKRANASNANFAAIIGENEIINNTLIIKDLRNKYEDptlkqisisfkdaenyfykkiikninn
MKPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFEPEVKKGIMHEMTKQTKQAiiesdiiifiVDGRQGLVEQDKLITNFLRKSGQPIVLVinkseninssisLDFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTNIHSIEYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAGIRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNKWDSiihnqrkiiknnikkklnFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYLEKYFYRTFSLIDALEKNIVGEIYNRYEKIGLKIIAAYMKKLSKNDVEKFYSIHKNRPFFKNLVNFMISGPVFIQVLEGEDAIKKHRILIGDTDPIKAAKGTIRADFAESIDKNIVHELGEMPFRAKQLQKWIHKFGVSDFNKMTDLSMSLRKKLKNSVYIKAPHIMSDQISFDGTRKWIFHVKKNIIETVFIPEKNRNTLCISTQVGCAINCIFCSTGRQGFVRNLTVGEIIGQLWVTEFKLRREKNIKINSQGKRQITNIVMMGMGEPLLNYKSTIGALKLILSDHAYGLSRRHVILSTSGIIPMIDKLAQECPVELAVSLHASNNNLRNKLVPISKKYPLKELILACHRYITYSPRHMITFEYCMLHGINDTDIHAIELISLMRKNKILTSCKINLIPFNCFPNSNLICSKNSRIKIFAKILMNSGIFVTIRKIRGNDINAACGQLSGEETDIVKKEMYSFIDELNGDNLSLRPEGTASVIRSVIENNLIYDGPKRLWYSGPMFRHERPQYGRYRQFYQIGVEAIGFPGPDIDAELIIMCSRLWKNLNLKNICLELNSIGNFNERKKYCIDLINYIKKHKDSKWFCEDIKHSLYLNSLRVLDSKNLIIREILINAPKLLDYLEKDSLDHFYGIQKILNYNNISYKINTKLVRGMDYYNRTVFEWTTDKLGSQNSICGGGRYDFLIKKFSNKFVPASGFAIGIERLIELIKKININHNFSHQCDIYIVHVGKEAELKAFVLSENLRTLGLKVILNCVFNNIHESFKSQMKRanasnanfaaiigeneiinntliiKDLRNKYEDPTLKQISISFKDAENYFYKKIIKNINN
***VLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFEPEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINKSENINSSISLDFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTNIHSIEYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAGIRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYLEKYFYRTFSLIDALEKNIVGEIYNRYEKIGLKIIAAYMKKLSKNDVEKFYSIHKNRPFFKNLVNFMISGPVFIQVLEGEDAIKKHRILIGDTDPIKAAKGTIRADFAESIDKNIVHELGEMPFRAKQLQKWIHKFGVSDFNKMTDLSMSLRKKLKNSVYIKAPHIMSDQISFDGTRKWIFHVKKNIIETVFIPEKNRNTLCISTQVGCAINCIFCSTGRQGFVRNLTVGEIIGQLWVTEFKLRREKNIKINSQGKRQITNIVMMGMGEPLLNYKSTIGALKLILSDHAYGLSRRHVILSTSGIIPMIDKLAQECPVELAVSLHASNNNLRNKLVPISKKYPLKELILACHRYITYSPRHMITFEYCMLHGINDTDIHAIELISLMRKNKILTSCKINLIPFNCFPNSNLICSKNSRIKIFAKILMNSGIFVTIRKIRGNDINAACGQLSGEETDIVKKEMYSFIDELNGDNLSLRPEGTASVIRSVIENNLIYDGPKRLWYSGPMFRHERPQYGRYRQFYQIGVEAIGFPGPDIDAELIIMCSRLWKNLNLKNICLELNSIGNFNERKKYCIDLINYIKKHKDSKWFCEDIKHSLYLNSLRVLDSKNLIIREILINAPKLLDYLEKDSLDHFYGIQKILNYNNISYKINTKLVRGMDYYNRTVFEWTTDKLGSQNSICGGGRYDFLIKKFSNKFVPASGFAIGIERLIELIKKININHNFSHQCDIYIVHVGKEAELKAFVLSENLRTLGLKVILNCVFNNIHESFKSQMKRANASNANFAAIIGENEIINNTLIIKDLRNKYEDPTLKQISISFKDAENYFYKKIIKN***
MKPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFEPEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINKSENINSSISLDFYELGIGNPHIISALYGNGIKNFLENILTIELPYK*************IEYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAGIRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYLEKYFYRTFSLIDALEKNIV******************************************LVNFMISGPVFIQVLEGEDAI*****************GTIRADFAESIDKNIVHELGEMPFRAKQLQKWIHKFGVSDFNKMTDLSMSLRKKLKNSVYIKAPHIMSDQISFDGTRKWIFHVKKNIIETVFIPEKNRNTLCISTQVGCAINCIFCSTGRQGFVRNLTVGEIIGQLWVTEFKLRRE*******QGKRQITNIVMMGMGEPLLNYKSTIGALKLILSDHAYGLSRRHVILSTSGIIPMIDKLAQECPVELAVSLHASNNNLRNKLVPISKKYPLKELILACHRYITYSPRHMITFEYCMLHGINDTDIHAIELISLMRKNKILTSCKINLIPFNCFPNSNLICSKNSRIKIFAKILMNSGIFVTIRKIRGNDINAACGQLSGEETDIVKKEM*************LRPEGTASVIRSVIENNLIYDGPKRLWYSGPMFRHERPQYGRYRQFYQIGVEAIGFPGPDIDAELIIMCSRLWKNLNLKNICLELNSIGNFNERKKYCIDLINYIKKHKDSKWFCEDIKHSLYLNSLRVLDSKNLIIREILINAPKLLDYLEKDSLDHFYGIQKILNYNNISYKINTKLVRGMDYYNRTVFEWTTDKLGSQNSICGGGRYDFLIKKFSNKFVPASGFAIGIERLIELIKKININHNFSHQCDIYIVHVGKEAELKAFVLSENLRTLGLKVILNCVFNNIHESFKSQMKRANASNANFAAIIGENEIINNTLIIKDLRNK*******QISISFKDAENYFYK*II*****
MKPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFEPEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINKSENINSSISLDFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTNIHSIEYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAGIRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYLEKYFYRTFSLIDALEKNIVGEIYNRYEKIGLKIIAAYMKKLSKNDVEKFYSIHKNRPFFKNLVNFMISGPVFIQVLEGEDAIKKHRILIGDTDPIKAAKGTIRADFAESIDKNIVHELGEMPFRAKQLQKWIHKFGVSDFNKMTDLSMSLRKKLKNSVYIKAPHIMSDQISFDGTRKWIFHVKKNIIETVFIPEKNRNTLCISTQVGCAINCIFCSTGRQGFVRNLTVGEIIGQLWVTEFKLRREKNIKINSQGKRQITNIVMMGMGEPLLNYKSTIGALKLILSDHAYGLSRRHVILSTSGIIPMIDKLAQECPVELAVSLHASNNNLRNKLVPISKKYPLKELILACHRYITYSPRHMITFEYCMLHGINDTDIHAIELISLMRKNKILTSCKINLIPFNCFPNSNLICSKNSRIKIFAKILMNSGIFVTIRKIRGNDINAACGQLSGEETDIVKKEMYSFIDELNGDNLSLRPEGTASVIRSVIENNLIYDGPKRLWYSGPMFRHERPQYGRYRQFYQIGVEAIGFPGPDIDAELIIMCSRLWKNLNLKNICLELNSIGNFNERKKYCIDLINYIKKHKDSKWFCEDIKHSLYLNSLRVLDSKNLIIREILINAPKLLDYLEKDSLDHFYGIQKILNYNNISYKINTKLVRGMDYYNRTVFEWTTDKLGSQNSICGGGRYDFLIKKFSNKFVPASGFAIGIERLIELIKKININHNFSHQCDIYIVHVGKEAELKAFVLSENLRTLGLKVILNCVFNNIHESFKSQMKRANASNANFAAIIGENEIINNTLIIKDLRNKYEDPTLKQISISFKDAENYFYKKIIKNINN
MKPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFEPEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINKSENINSSISLDFYELGIGNPHIISALYGNGIKNFLENILTIELPY**********NIHSIEYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAGIRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYLEKYFYRTFSLIDALEKNIVGEIYNRYEKIGLKIIAAYMKKLSKNDVEKFYSIHKNRPFFKNLVNFMISGPVFIQVLEGEDAIKKHRILIGDTDPIKAAKGTIRADFAESIDKNIVHELGEMPFRAKQLQKWIHKFGVSDFNKMTDLSMSLRKKLKNSVYIKAPHIMSDQISFDGTRKWIFHVKKNIIETVFIPEKNRNTLCISTQVGCAINCIFCSTGRQGFVRNLTVGEIIGQLWVTEFKLRREKNIKINSQGKRQITNIVMMGMGEPLLNYKSTIGALKLILSDHAYGLSRRHVILSTSGIIPMIDKLAQECPVELAVSLHASNNNLRNKLVPISKKYPLKELILACHRYITYSPRHMITFEYCMLHGINDTDIHAIELISLMRKNKILTSCKINLIPFNCFPNSNLICSKNSRIKIFAKILMNSGIFVTIRKIRGNDINAACGQLSGEETDIVKKEMYSFIDELNGDNLSLRPEGTASVIRSVIENNLIYDGPKRLWYSGPMFRHERPQYGRYRQFYQIGVEAIGFPGPDIDAELIIMCSRLWKNLNLKNICLELNSIGNFNERKKYCIDLINYIKKHKDSKWFCEDIKHSLYLNSLRVLDSKNLIIREILINAPKLLDYLEKDSLDHFYGIQKILNYNNISYKINTKLVRGMDYYNRTVFEWTTDKLGSQNSICGGGRYDFLIKKFSNKFVPASGFAIGIERLIELIKKININHNFSHQCDIYIVHVGKEAELKAFVLSENLRTLGLKVILNCVFNNIHESFKSQMKRANASNANFAAIIGENEIINNTLIIKDLRNKYEDPTLKQISISFKDAENYFYKKIIKNINN
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFEPEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINKSENINSSISLDFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTNIHSIEYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAGIRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYLEKYFYRTFSLIDALEKNIVGEIYNRYEKIGLKIIAAYMKKLSKNDVEKFYSIHKNRPFFKNLVNFMISGPVFIQVLEGEDAIKKHRILIGDTDPIKAAKGTIRADFAESIDKNIVHELGEMPFRAKQLQKWIHKFGVSDFNKMTDLSMSLRKKLKNSVYIKAPHIMSDQISFDGTRKWIFHVKKNIIETVFIPEKNRNTLCISTQVGCAINCIFCSTGRQGFVRNLTVGEIIGQLWVTEFKLRREKNIKINSQGKRQITNIVMMGMGEPLLNYKSTIGALKLILSDHAYGLSRRHVILSTSGIIPMIDKLAQECPVELAVSLHASNNNLRNKLVPISKKYPLKELILACHRYITYSPRHMITFEYCMLHGINDTDIHAIELISLMRKNKILTSCKINLIPFNCFPNSNLICSKNSRIKIFAKILMNSGIFVTIRKIRGNDINAACGQLSGEETDIVKKEMYSFIDELNGDNLSLRPEGTASVIRSVIENNLIYDGPKRLWYSGPMFRHERPQYGRYRQFYQIGVEAIGFPGPDIDAELIIMCSRLWKNLNLKNICLELNSIGNFNERKKYCIDLINYIKKHKDSKWFCEDIKHSLYLNSLRVLDSKNLIIREILINAPKLLDYLEKDSLDHFYGIQKILNYNNISYKINTKLVRGMDYYNRTVFEWTTDKLGSQNSICGGGRYDFLIKKFSNKFVPASGFAIGIERLIELIKKININHNFSHQCDIYIVHVGKEAELKAFVLSENLRTLGLKVILNCVFNNIHESFKSQMKRANASNANFAAIIGENEIINNTLIIKDLRNKYEDPTLKQISISFKDAENYFYKKIIKNINN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1250 2.2.26 [Sep-21-2011]
A6SZW6447 GTPase Der OS=Janthinobac yes N/A 0.340 0.953 0.606 1e-157
A4G4K6447 GTPase Der OS=Herminiimon yes N/A 0.340 0.953 0.604 1e-155
A0K7T2445 GTPase Der OS=Burkholderi yes N/A 0.339 0.952 0.575 1e-148
B1JT88445 GTPase Der OS=Burkholderi yes N/A 0.339 0.952 0.575 1e-148
Q1BGX0445 GTPase Der OS=Burkholderi yes N/A 0.339 0.952 0.575 1e-148
B4EAW5445 GTPase Der OS=Burkholderi yes N/A 0.339 0.952 0.575 1e-148
Q39FR3445 GTPase Der OS=Burkholderi yes N/A 0.339 0.952 0.571 1e-147
B1YR40445 GTPase Der OS=Burkholderi yes N/A 0.339 0.952 0.568 1e-147
A9AH00445 GTPase Der OS=Burkholderi yes N/A 0.339 0.952 0.573 1e-147
A4JEN6445 GTPase Der OS=Burkholderi yes N/A 0.339 0.952 0.571 1e-147
>sp|A6SZW6|DER_JANMA GTPase Der OS=Janthinobacterium sp. (strain Marseille) GN=der PE=3 SV=1 Back     alignment and function desciption
 Score =  557 bits (1436), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 261/430 (60%), Positives = 342/430 (79%), Gaps = 4/430 (0%)

Query: 1   MKPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGF 60
           MKPV+ L+GRPNVGKSTLFNRLT SRDALVA+ PGLTRDRHYGEG +G++ F++IDTGGF
Sbjct: 1   MKPVIALIGRPNVGKSTLFNRLTRSRDALVADLPGLTRDRHYGEGRVGERPFLVIDTGGF 60

Query: 61  EPEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINK 120
           EP  K+GIMHEM KQTKQA+ E+D++IFIVDGRQGL   DK IT+FLRKSG+ ++LV+NK
Sbjct: 61  EPVAKEGIMHEMAKQTKQAVAEADVVIFIVDGRQGLTPHDKTITDFLRKSGRSVMLVVNK 120

Query: 121 SENIN-SSISLDFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTNIHS 179
           +E +  ++++ DFYELG+G+P++ISA +G+G+ + +E  L I    +   ++   +N  S
Sbjct: 121 AEGMKYTTVTADFYELGMGDPYVISAAHGDGVNDLVEEALNIAFAQRPPEEEAPASNDRS 180

Query: 180 IEYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAG 239
           I   K+AIVG+PNVGKSTL+N+LLGE RVI +D PGTTRDSI+  FE + K Y LIDTAG
Sbjct: 181 I---KLAIVGRPNVGKSTLVNTLLGEERVIAFDLPGTTRDSIEIPFERDGKHYTLIDTAG 237

Query: 240 IRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVC 299
           IRRR K FE IEKFSV+KTL+SI EANVV+LLLDAQQ+IS QD +IA FI ESGR+L+V 
Sbjct: 238 IRRRGKVFEAIEKFSVVKTLQSISEANVVLLLLDAQQDISEQDAHIAGFILESGRALVVG 297

Query: 300 VNKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHL 359
           VNKWD +  ++R  IK ++++KL+FLSFA  +F+SA+K + I   M+S++  Y +++ +L
Sbjct: 298 VNKWDGLTSDRRDEIKMDLERKLSFLSFAKTHFVSALKSSGIGPMMKSVDGAYAAAMSNL 357

Query: 360 STSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYLE 419
           ST ++TRALI A+++  P RK  IRPKLRYAHQGG NPPI+VIHGN L+ I  +YKR+LE
Sbjct: 358 STPKLTRALIEAVEHQQPRRKGSIRPKLRYAHQGGMNPPIVVIHGNALEAIDANYKRFLE 417

Query: 420 KYFYRTFSLI 429
           K+F  TFSL+
Sbjct: 418 KHFRETFSLV 427




GTPase that plays an essential role in the late steps of ribosome biogenesis.
Janthinobacterium sp. (strain Marseille) (taxid: 375286)
>sp|A4G4K6|DER_HERAR GTPase Der OS=Herminiimonas arsenicoxydans GN=der PE=3 SV=1 Back     alignment and function description
>sp|A0K7T2|DER_BURCH GTPase Der OS=Burkholderia cenocepacia (strain HI2424) GN=der PE=3 SV=1 Back     alignment and function description
>sp|B1JT88|DER_BURCC GTPase Der OS=Burkholderia cenocepacia (strain MC0-3) GN=der PE=3 SV=1 Back     alignment and function description
>sp|Q1BGX0|DER_BURCA GTPase Der OS=Burkholderia cenocepacia (strain AU 1054) GN=der PE=3 SV=1 Back     alignment and function description
>sp|B4EAW5|DER_BURCJ GTPase Der OS=Burkholderia cepacia (strain J2315 / LMG 16656) GN=der PE=3 SV=1 Back     alignment and function description
>sp|Q39FR3|DER_BURS3 GTPase Der OS=Burkholderia sp. (strain 383) GN=der PE=3 SV=1 Back     alignment and function description
>sp|B1YR40|DER_BURA4 GTPase Der OS=Burkholderia ambifaria (strain MC40-6) GN=der PE=3 SV=1 Back     alignment and function description
>sp|A9AH00|DER_BURM1 GTPase Der OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=der PE=3 SV=1 Back     alignment and function description
>sp|A4JEN6|DER_BURVG GTPase Der OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=der PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1250
398836196446 ribosome-associated GTPase EngA [Herbasp 0.340 0.955 0.616 1e-158
300312253447 GTP-binding protein [Herbaspirillum sero 0.340 0.953 0.609 1e-157
340787109447 GTP-binding protein [Collimonas fungivor 0.340 0.953 0.616 1e-156
152981185447 GTP-binding protein EngA [Janthinobacter 0.340 0.953 0.606 1e-155
399018047447 ribosome-associated GTPase EngA [Herbasp 0.34 0.950 0.597 1e-155
409406674447 GTP-binding protein [Herbaspirillum sp. 0.34 0.950 0.610 1e-155
445498326448 GTP-binding protein EngA [Janthinobacter 0.34 0.948 0.589 1e-153
134094495447 GTP-binding protein EngA [Herminiimonas 0.340 0.953 0.604 1e-153
395763286448 GTP-binding protein Der [Janthinobacteri 0.34 0.948 0.598 1e-153
427401453445 GTPase Der [Massilia timonae CCUG 45783] 0.34 0.955 0.589 1e-151
>gi|398836196|ref|ZP_10593542.1| ribosome-associated GTPase EngA [Herbaspirillum sp. YR522] gi|398213200|gb|EJM99794.1| ribosome-associated GTPase EngA [Herbaspirillum sp. YR522] Back     alignment and taxonomy information
 Score =  565 bits (1455), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 265/430 (61%), Positives = 341/430 (79%), Gaps = 4/430 (0%)

Query: 1   MKPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGF 60
           MKPV+ LVGRPNVGKSTLFNRLT SRDALVA+ PGLTRDRHYGEG +G++ F++IDTGGF
Sbjct: 1   MKPVIALVGRPNVGKSTLFNRLTRSRDALVADLPGLTRDRHYGEGRVGERPFLVIDTGGF 60

Query: 61  EPEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINK 120
           EP  K+GIMHEM KQTKQA++E+D+++FIVDGRQGL   DK IT+FLRK G+P++LV+NK
Sbjct: 61  EPVAKEGIMHEMAKQTKQAVVEADVVVFIVDGRQGLTPHDKTITDFLRKCGRPVLLVVNK 120

Query: 121 SENIN-SSISLDFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTNIHS 179
           SE +  +S++ DFYELG+G+P++ISA +G+G+ + +E  L +    +    + E      
Sbjct: 121 SEGMKYTSVTADFYELGMGDPYVISAAHGDGVADLVEEALNV---VEANRPEAEPEPEGQ 177

Query: 180 IEYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAG 239
           +  IK+AIVG+PNVGKSTL+N+LLGE RVI +D PGTTRDSI+  FE + ++Y LIDTAG
Sbjct: 178 VRGIKIAIVGRPNVGKSTLVNTLLGEERVIAFDMPGTTRDSIEIPFERDGQQYTLIDTAG 237

Query: 240 IRRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVC 299
           IRRR K FE IEKFSV+KTL+SI +ANVV+LLLDAQQ+IS QD +IA FI ESGR+L+V 
Sbjct: 238 IRRRGKVFEAIEKFSVVKTLQSISDANVVLLLLDAQQDISEQDAHIAGFILESGRALVVG 297

Query: 300 VNKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHL 359
           VNKWD +  +QR  IKN+I +KLNFLSFA  +F+SA+K + I   M+SIN  Y ++  +L
Sbjct: 298 VNKWDGLQSDQRDAIKNDIDRKLNFLSFANTHFVSALKNSGIGPVMKSINSAYAAATANL 357

Query: 360 STSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYLE 419
           ST R+TRAL  A+++  P RK  IRPKLRYAHQGG+NPP++VIHGN L  I ++YKRYLE
Sbjct: 358 STPRLTRALEQAVEHQQPPRKGSIRPKLRYAHQGGQNPPVVVIHGNALDAINDNYKRYLE 417

Query: 420 KYFYRTFSLI 429
           K+F  TFSL+
Sbjct: 418 KHFRETFSLV 427




Source: Herbaspirillum sp. YR522

Species: Herbaspirillum sp. YR522

Genus: Herbaspirillum

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria

>gi|300312253|ref|YP_003776345.1| GTP-binding protein [Herbaspirillum seropedicae SmR1] gi|300075038|gb|ADJ64437.1| GTP-binding protein [Herbaspirillum seropedicae SmR1] Back     alignment and taxonomy information
>gi|340787109|ref|YP_004752574.1| GTP-binding protein [Collimonas fungivorans Ter331] gi|340552376|gb|AEK61751.1| GTP-binding protein [Collimonas fungivorans Ter331] Back     alignment and taxonomy information
>gi|152981185|ref|YP_001353813.1| GTP-binding protein EngA [Janthinobacterium sp. Marseille] gi|166198722|sp|A6SZW6.1|DER_JANMA RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA gi|151281262|gb|ABR89672.1| GTP-binding protein EngA [Janthinobacterium sp. Marseille] Back     alignment and taxonomy information
>gi|399018047|ref|ZP_10720233.1| ribosome-associated GTPase EngA [Herbaspirillum sp. CF444] gi|398102012|gb|EJL92204.1| ribosome-associated GTPase EngA [Herbaspirillum sp. CF444] Back     alignment and taxonomy information
>gi|409406674|ref|ZP_11255136.1| GTP-binding protein [Herbaspirillum sp. GW103] gi|386435223|gb|EIJ48048.1| GTP-binding protein [Herbaspirillum sp. GW103] Back     alignment and taxonomy information
>gi|445498326|ref|ZP_21465181.1| GTP-binding protein EngA [Janthinobacterium sp. HH01] gi|444788321|gb|ELX09869.1| GTP-binding protein EngA [Janthinobacterium sp. HH01] Back     alignment and taxonomy information
>gi|134094495|ref|YP_001099570.1| GTP-binding protein EngA [Herminiimonas arsenicoxydans] gi|166198721|sp|A4G4K6.1|DER_HERAR RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA gi|133738398|emb|CAL61443.1| GTP-binding protein EngA [Herminiimonas arsenicoxydans] Back     alignment and taxonomy information
>gi|395763286|ref|ZP_10443955.1| GTP-binding protein Der [Janthinobacterium lividum PAMC 25724] Back     alignment and taxonomy information
>gi|427401453|ref|ZP_18892525.1| GTPase Der [Massilia timonae CCUG 45783] gi|425719562|gb|EKU82494.1| GTPase Der [Massilia timonae CCUG 45783] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1250
UNIPROTKB|P0A6P5490 der "50S ribosomal subunit sta 0.197 0.504 0.481 4e-91
UNIPROTKB|Q603C0366 rlmN "Dual-specificity RNA met 0.262 0.896 0.510 9.6e-89
UNIPROTKB|Q9KTW7494 der "GTPase Der" [Vibrio chole 0.213 0.540 0.432 1.3e-88
TIGR_CMR|VC_0763494 VC_0763 "GTP-binding protein" 0.213 0.540 0.432 1.3e-88
UNIPROTKB|Q47WC5498 der "GTPase Der" [Colwellia ps 0.214 0.538 0.446 1.6e-88
TIGR_CMR|CPS_4247498 CPS_4247 "GTP-binding protein 0.214 0.538 0.446 1.6e-88
UNIPROTKB|Q83C83443 der "GTPase Der" [Coxiella bur 0.336 0.950 0.444 2.6e-86
TIGR_CMR|CBU_1245443 CBU_1245 "GTP-binding protein" 0.336 0.950 0.444 2.6e-86
UNIPROTKB|Q8EC29373 rlmN "Dual-specificity RNA met 0.266 0.892 0.518 1.9e-84
TIGR_CMR|SO_3315373 SO_3315 "conserved hypothetica 0.266 0.892 0.518 1.9e-84
UNIPROTKB|P0A6P5 der "50S ribosomal subunit stability factor" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
 Score = 620 (223.3 bits), Expect = 4.0e-91, Sum P(2) = 4.0e-91
 Identities = 119/247 (48%), Positives = 168/247 (68%)

Query:   183 IKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAGIRR 242
             IK+AIVG+PNVGKSTL N +LGE RV+ YD PGTTRDSI    E + ++Y+LIDTAG+R+
Sbjct:   203 IKLAIVGRPNVGKSTLTNRILGEERVVVYDMPGTTRDSIYIPMERDGREYVLIDTAGVRK 262

Query:   243 RNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCVNK 302
             R K  + +EKFSVIKTL++I +ANVV+L++DA++ IS QD+++  FI  SGRSL++ VNK
Sbjct:   263 RGKITDAVEKFSVIKTLQAIEDANVVMLVIDAREGISDQDLSLLGFILNSGRSLVIVVNK 322

Query:   303 WDSXXXXXXXXXXXXXXXXXXFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLSTS 362
             WD                   F+ FA  +FISA+  + + +  ES+   YDSS   + TS
Sbjct:   323 WDGLSQEVKEQVKETLDFRLGFIDFARVHFISALHGSGVGNLFESVREAYDSSTRRVGTS 382

Query:   363 RITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYLEKYF 422
              +TR +  A+++H P   +  R KL+YAH GG NPPI+VIHGN++K + + YKRYL  YF
Sbjct:   383 MLTRIMTMAVEDHQPPLVRGRRVKLKYAHAGGYNPPIVVIHGNQVKDLPDSYKRYLMNYF 442

Query:   423 YRTFSLI 429
              ++  ++
Sbjct:   443 RKSLDVM 449


GO:0005829 "cytosol" evidence=IDA
GO:0006184 "GTP catabolic process" evidence=IDA
GO:0042254 "ribosome biogenesis" evidence=IEA
GO:0032794 "GTPase activating protein binding" evidence=IPI
GO:0043022 "ribosome binding" evidence=IDA
GO:0003924 "GTPase activity" evidence=IDA
GO:0005525 "GTP binding" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0000027 "ribosomal large subunit assembly" evidence=IMP
UNIPROTKB|Q603C0 rlmN "Dual-specificity RNA methyltransferase RlmN" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KTW7 der "GTPase Der" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0763 VC_0763 "GTP-binding protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
UNIPROTKB|Q47WC5 der "GTPase Der" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_4247 CPS_4247 "GTP-binding protein EngA" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|Q83C83 der "GTPase Der" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1245 CBU_1245 "GTP-binding protein" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
UNIPROTKB|Q8EC29 rlmN "Dual-specificity RNA methyltransferase RlmN" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|SO_3315 SO_3315 "conserved hypothetical protein TIGR00048" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q46ZI7DER_CUPPJNo assigned EC number0.56170.340.9507yesN/A
Q5P7B7DER_AROAENo assigned EC number0.52210.33680.9524yesN/A
Q0BEX1DER_BURCMNo assigned EC number0.56870.33920.9528yesN/A
Q13X32DER_BURXLNo assigned EC number0.57800.33920.9528yesN/A
B4RKD2DER_NEIG2No assigned EC number0.51280.3360.8659yesN/A
Q47BS0DER_DECARNo assigned EC number0.54540.3360.9480yesN/A
B4EAW5DER_BURCJNo assigned EC number0.57570.33920.9528yesN/A
Q82XU6DER_NITEUNo assigned EC number0.54540.33840.9057yesN/A
B2SXS6DER_BURPPNo assigned EC number0.57570.33920.9528yesN/A
B3R1J8DER_CUPTRNo assigned EC number0.57540.33840.9463yesN/A
B1JT88DER_BURCCNo assigned EC number0.57570.33920.9528yesN/A
A4G4K6DER_HERARNo assigned EC number0.60460.34080.9530yesN/A
B2JIU7DER_BURP8No assigned EC number0.56380.33840.9484yesN/A
A4SYD7DER_POLSQNo assigned EC number0.54390.33760.9295yesN/A
Q9JV01DER_NEIMANo assigned EC number0.51740.3360.8659yesN/A
A0K7T2DER_BURCHNo assigned EC number0.57570.33920.9528yesN/A
A4JEN6DER_BURVGNo assigned EC number0.57100.33920.9528yesN/A
Q2Y6F9DER_NITMUNo assigned EC number0.53480.3360.9012yesN/A
A1KT93DER_NEIMFNo assigned EC number0.52090.33520.8639yesN/A
Q7WHN4DER_BORBRNo assigned EC number0.52660.33920.9401yesN/A
A9IK66DER_BORPDNo assigned EC number0.52680.34080.9445yesN/A
A1TM31DER_ACIACNo assigned EC number0.50340.33920.9485yesN/A
Q3SL66DER_THIDANo assigned EC number0.52680.3360.8955yesN/A
Q1LLJ5DER_RALMENo assigned EC number0.55470.340.9507yesN/A
Q39FR3DER_BURS3No assigned EC number0.57100.33920.9528yesN/A
A9AH00DER_BURM1No assigned EC number0.57340.33920.9528yesN/A
B1XU78DER_POLNSNo assigned EC number0.53000.33760.9295yesN/A
A3NA49DER_BURP6No assigned EC number0.57340.33920.9528yesN/A
Q21W32DER_RHOFDNo assigned EC number0.50340.33920.9485yesN/A
A1K3Z3DER_AZOSBNo assigned EC number0.52210.33680.9524yesN/A
Q0AE46DER_NITECNo assigned EC number0.52210.33840.9038yesN/A
Q7W6Q0DER_BORPANo assigned EC number0.52660.33920.9401yesN/A
Q1BGX0DER_BURCANo assigned EC number0.57570.33920.9528yesN/A
Q8Y026DER_RALSONo assigned EC number0.54770.340.9507yesN/A
A3MK70DER_BURM7No assigned EC number0.57340.33920.9528yesN/A
B1YR40DER_BURA4No assigned EC number0.56870.33920.9528yesN/A
B2U9V3DER_RALPJNo assigned EC number0.55240.340.9507yesN/A
Q7NS92DER_CHRVONo assigned EC number0.51740.33520.8933yesN/A
Q7VWL4DER_BORPENo assigned EC number0.52660.33920.9401yesN/A
C5CXH0DER_VARPSNo assigned EC number0.51390.34080.9530yesN/A
A3NVW6DER_BURP0No assigned EC number0.57340.33920.9528yesN/A
O87407DER_NEIG1No assigned EC number0.51280.3360.8659yesN/A
Q63US9DER_BURPSNo assigned EC number0.57340.33920.9528yesN/A
A2S2A6DER_BURM9No assigned EC number0.57340.33920.9528yesN/A
Q9JZY1DER_NEIMBNo assigned EC number0.52210.3360.8659yesN/A
A6SZW6DER_JANMANo assigned EC number0.60690.34080.9530yesN/A
A2SHB1DER_METPPNo assigned EC number0.50810.33920.9506yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.4LOW CONFIDENCE prediction!
4th Layer2.7.4.6LOW CONFIDENCE prediction!
3rd Layer2.1.10.691
3rd Layer6.1.10.691
4th Layer6.1.1.21LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1250
PRK00093435 PRK00093, PRK00093, GTP-binding protein Der; Revie 0.0
TIGR03594429 TIGR03594, GTPase_EngA, ribosome-associated GTPase 0.0
COG1160444 COG1160, COG1160, Predicted GTPases [General funct 1e-163
TIGR00442397 TIGR00442, hisS, histidyl-tRNA synthetase 1e-155
PRK00037412 PRK00037, hisS, histidyl-tRNA synthetase; Reviewed 1e-154
COG0124429 COG0124, HisS, Histidyl-tRNA synthetase [Translati 1e-136
PRK11194372 PRK11194, PRK11194, ribosomal RNA large subunit me 1e-133
COG0820349 COG0820, COG0820, Predicted Fe-S-cluster redox enz 1e-126
TIGR00048355 TIGR00048, TIGR00048, 23S rRNA m2A2503 methyltrans 1e-113
PRK14454342 PRK14454, PRK14454, ribosomal RNA large subunit me 5e-96
CHL00201430 CHL00201, syh, histidine-tRNA synthetase; Provisio 9e-94
PRK14463349 PRK14463, PRK14463, ribosomal RNA large subunit me 1e-91
PRK14460354 PRK14460, PRK14460, ribosomal RNA large subunit me 9e-91
PRK09518712 PRK09518, PRK09518, bifunctional cytidylate kinase 1e-87
PRK03003472 PRK03003, PRK03003, GTP-binding protein Der; Revie 1e-85
PRK14459373 PRK14459, PRK14459, ribosomal RNA large subunit me 5e-84
PRK14467348 PRK14467, PRK14467, ribosomal RNA large subunit me 1e-82
PRK14457345 PRK14457, PRK14457, ribosomal RNA large subunit me 1e-81
PRK14461371 PRK14461, PRK14461, ribosomal RNA large subunit me 6e-80
PRK14469343 PRK14469, PRK14469, ribosomal RNA large subunit me 3e-79
PRK14468343 PRK14468, PRK14468, ribosomal RNA large subunit me 4e-79
PRK14466345 PRK14466, PRK14466, ribosomal RNA large subunit me 1e-78
PRK14455356 PRK14455, PRK14455, ribosomal RNA large subunit me 2e-78
cd00773261 cd00773, HisRS-like_core, Class II Histidinyl-tRNA 3e-74
PRK14462356 PRK14462, PRK14462, ribosomal RNA large subunit me 9e-74
cd01895174 cd01895, EngA2, EngA2 GTPase contains the second d 1e-73
PRK14456368 PRK14456, PRK14456, ribosomal RNA large subunit me 4e-70
cd01894157 cd01894, EngA1, EngA1 GTPase contains the first do 4e-67
PRK14453347 PRK14453, PRK14453, chloramphenicol/florfenicol re 1e-55
PRK00668134 PRK00668, ndk, mulitfunctional nucleoside diphosph 1e-55
PRK14465342 PRK14465, PRK14465, ribosomal RNA large subunit me 1e-49
COG0105135 COG0105, Ndk, Nucleoside diphosphate kinase [Nucle 3e-48
cd04413130 cd04413, NDPk_I, Nucleoside diphosphate kinase Gro 4e-48
pfam00334135 pfam00334, NDK, Nucleoside diphosphate kinase 6e-48
smart00562135 smart00562, NDK, Enzymes that catalyze nonsubstrat 4e-44
PRK14470336 PRK14470, PRK14470, ribosomal RNA large subunit me 2e-39
PRK14464344 PRK14464, PRK14464, ribosomal RNA large subunit me 2e-37
TIGR00443313 TIGR00443, hisZ_biosyn_reg, ATP phosphoribosyltran 5e-37
PRK12292391 PRK12292, hisZ, ATP phosphoribosyltransferase regu 2e-36
cd01894157 cd01894, EngA1, EngA1 GTPase contains the first do 9e-35
PTZ00093149 PTZ00093, PTZ00093, nucleoside diphosphate kinase, 4e-33
pfam01926117 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase 5e-33
cd04164159 cd04164, trmE, trmE is a tRNA modification GTPase 1e-32
cd00595133 cd00595, NDPk, Nucleoside diphosphate kinases (NDP 2e-31
pfam01926117 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase 5e-31
pfam13393308 pfam13393, tRNA-synt_His, Histidyl-tRNA synthetase 3e-30
COG0486454 COG0486, ThdF, Predicted GTPase [General function 2e-29
PRK14545139 PRK14545, PRK14545, nucleoside diphosphate kinase; 1e-28
PRK05291449 PRK05291, trmE, tRNA modification GTPase TrmE; Rev 4e-28
cd00880161 cd00880, Era_like, E 1e-27
PRK14541140 PRK14541, PRK14541, nucleoside diphosphate kinase; 2e-27
PRK14540134 PRK14540, PRK14540, nucleoside diphosphate kinase; 3e-27
cd04164159 cd04164, trmE, trmE is a tRNA modification GTPase 1e-25
COG3705390 COG3705, HisZ, ATP phosphoribosyltransferase invol 1e-25
PLN02530487 PLN02530, PLN02530, histidine-tRNA ligase 1e-25
pfam00587171 pfam00587, tRNA-synt_2b, tRNA synthetase class II 1e-25
cd00880161 cd00880, Era_like, E 2e-25
cd01895174 cd01895, EngA2, EngA2 GTPase contains the second d 3e-25
PRK14542137 PRK14542, PRK14542, nucleoside diphosphate kinase; 5e-25
PRK05291449 PRK05291, trmE, tRNA modification GTPase TrmE; Rev 4e-24
PLN02619238 PLN02619, PLN02619, nucleoside-diphosphate kinase 4e-24
PRK00089292 PRK00089, era, GTPase Era; Reviewed 1e-23
cd04163168 cd04163, Era, E 1e-23
cd04163168 cd04163, Era, E 2e-23
COG0486454 COG0486, ThdF, Predicted GTPase [General function 3e-23
TIGR00450442 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPas 3e-23
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 5e-23
COG1159298 COG1159, Era, GTPase [General function prediction 7e-23
COG1159298 COG1159, Era, GTPase [General function prediction 2e-22
PRK00089292 PRK00089, era, GTPase Era; Reviewed 4e-21
TIGR00436270 TIGR00436, era, GTP-binding protein Era 5e-20
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 5e-20
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 1e-19
PRK14544183 PRK14544, PRK14544, nucleoside diphosphate kinase; 1e-18
cd04415131 cd04415, NDPk7A, Nucleoside diphosphate kinase 7 d 2e-18
PRK12420423 PRK12420, PRK12420, histidyl-tRNA synthetase; Prov 4e-18
TIGR03918391 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster 7e-18
cd00670235 cd00670, Gly_His_Pro_Ser_Thr_tRS_core, Gly_His_Pro 1e-17
cd0085991 cd00859, HisRS_anticodon, HisRS Histidyl-anticodon 1e-17
cd01879159 cd01879, FeoB, Ferrous iron transport protein B (F 1e-16
PLN02931177 PLN02931, PLN02931, nucleoside diphosphate kinase 2e-16
PRK14543169 PRK14543, PRK14543, nucleoside diphosphate kinase; 2e-16
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 4e-16
TIGR00436270 TIGR00436, era, GTP-binding protein Era 4e-16
cd04416132 cd04416, NDPk_TX, NDP kinase domain of thioredoxin 8e-16
TIGR03918391 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster 3e-15
TIGR00450442 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPas 4e-15
cd01876170 cd01876, YihA_EngB, YihA (EngB) GTPase family 5e-15
cd04414135 cd04414, NDPk6, Nucleoside diphosphate kinase 6 (N 7e-15
pfam02421190 pfam02421, FeoB_N, Ferrous iron transport protein 2e-14
PLN02972763 PLN02972, PLN02972, Histidyl-tRNA synthetase 2e-14
cd01856171 cd01856, YlqF, Circularly permuted YlqF GTPase 8e-14
COG0370653 COG0370, FeoB, Fe2+ transport system protein B [In 2e-13
COG2262411 COG2262, HflX, GTPases [General function predictio 6e-13
COG1161322 COG1161, COG1161, Predicted GTPases [General funct 9e-13
PRK12295373 PRK12295, hisZ, ATP phosphoribosyltransferase regu 1e-12
cd01849146 cd01849, YlqF_related_GTPase, Circularly permuted 2e-12
cd01855191 cd01855, YqeH, Circularly permuted YqeH GTPase 4e-12
TIGR03596276 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-bi 4e-12
TIGR00437591 TIGR00437, feoB, ferrous iron transporter FeoB 5e-12
PRK09563287 PRK09563, rbgA, GTPase YlqF; Reviewed 1e-11
cd04418132 cd04418, NDPk5, Nucleoside diphosphate kinase homo 1e-11
cd01876170 cd01876, YihA_EngB, YihA (EngB) GTPase family 3e-11
COG0218200 COG0218, COG0218, Predicted GTPase [General functi 4e-11
COG0218200 COG0218, COG0218, Predicted GTPase [General functi 6e-11
TIGR03597360 TIGR03597, GTPase_YqeH, ribosome biogenesis GTPase 6e-11
TIGR03598178 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-bi 7e-11
PRK00454196 PRK00454, engB, GTP-binding protein YsxC; Reviewed 2e-10
cd00768211 cd00768, class_II_aaRS-like_core, Class II tRNA am 5e-10
cd01878204 cd01878, HflX, HflX GTPase family 6e-10
pfam04055165 pfam04055, Radical_SAM, Radical SAM superfamily 9e-10
cd04412134 cd04412, NDPk7B, Nucleoside diphosphate kinase 7 d 1e-09
cd01857140 cd01857, HSR1_MMR1, A circularly permuted subfamil 2e-09
COG0370653 COG0370, FeoB, Fe2+ transport system protein B [In 5e-09
TIGR03156351 TIGR03156, GTP_HflX, GTP-binding protein HflX 8e-09
cd00881183 cd00881, GTP_translation_factor, GTP translation f 1e-08
cd01881167 cd01881, Obg_like, Obg-like family of GTPases cons 1e-08
cd09912180 cd09912, DLP_2, Dynamin-like protein including dyn 2e-08
cd01859157 cd01859, MJ1464, An uncharacterized, circularly pe 2e-08
pfam02421190 pfam02421, FeoB_N, Ferrous iron transport protein 3e-08
cd01897167 cd01897, NOG, Nucleolar GTP-binding protein (NOG) 3e-08
cd01879159 cd01879, FeoB, Ferrous iron transport protein B (F 6e-08
PRK15494339 PRK15494, era, GTPase Era; Provisional 6e-08
COG1084346 COG1084, COG1084, Predicted GTPase [General functi 8e-08
PRK12299335 PRK12299, obgE, GTPase CgtA; Reviewed 1e-07
PRK12295373 PRK12295, hisZ, ATP phosphoribosyltransferase regu 3e-07
TIGR00437591 TIGR00437, feoB, ferrous iron transporter FeoB 3e-07
pfam0312993 pfam03129, HGTP_anticodon, Anticodon binding domai 3e-07
PRK00454196 PRK00454, engB, GTP-binding protein YsxC; Reviewed 4e-07
cd01898170 cd01898, Obg, Obg GTPase 5e-07
cd01896233 cd01896, DRG, Developmentally Regulated GTP-bindin 7e-07
COG1163365 COG1163, DRG, Predicted GTPase [General function p 7e-07
TIGR03598178 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-bi 8e-07
cd01856171 cd01856, YlqF, Circularly permuted YlqF GTPase 1e-06
cd11383140 cd11383, YfjP, YfjP GTPase 1e-06
COG1161322 COG1161, COG1161, Predicted GTPases [General funct 2e-06
COG0012372 COG0012, COG0012, Predicted GTPase, probable trans 2e-06
PRK13796365 PRK13796, PRK13796, GTPase YqeH; Provisional 2e-06
PRK09601364 PRK09601, PRK09601, GTP-binding protein YchF; Revi 3e-06
cd01899318 cd01899, Ygr210, Ygr210 GTPase 3e-06
cd04178171 cd04178, Nucleostemin_like, A circularly permuted 4e-06
cd01900274 cd01900, YchF, YchF GTPase 4e-06
cd00881183 cd00881, GTP_translation_factor, GTP translation f 6e-06
cd01878204 cd01878, HflX, HflX GTPase family 9e-06
TIGR02729329 TIGR02729, Obg_CgtA, Obg family GTPase CgtA 9e-06
cd01881167 cd01881, Obg_like, Obg-like family of GTPases cons 1e-05
PRK09602396 PRK09602, PRK09602, translation-associated GTPase; 1e-05
PRK04213201 PRK04213, PRK04213, GTP-binding protein; Provision 2e-05
TIGR03596276 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-bi 3e-05
PRK12421392 PRK12421, PRK12421, ATP phosphoribosyltransferase 3e-05
cd01335204 cd01335, Radical_SAM, Radical SAM superfamily 3e-05
COG0536369 COG0536, Obg, Predicted GTPase [General function p 3e-05
PRK09563287 PRK09563, rbgA, GTPase YlqF; Reviewed 4e-05
COG1100219 COG1100, COG1100, GTPase SAR1 and related small G 4e-05
pfam00009184 pfam00009, GTP_EFTU, Elongation factor Tu GTP bind 4e-05
cd11383140 cd11383, YfjP, YfjP GTPase 5e-05
COG3596296 COG3596, COG3596, Predicted GTPase [General functi 8e-05
pfam00009184 pfam00009, GTP_EFTU, Elongation factor Tu GTP bind 1e-04
PRK09554772 PRK09554, feoB, ferrous iron transport protein B; 1e-04
cd04166209 cd04166, CysN_ATPS, CysN, together with protein Cy 1e-04
PRK01889356 PRK01889, PRK01889, GTPase RsgA; Reviewed 1e-04
cd01854211 cd01854, YjeQ_EngC, Ribosomal interacting GTPase Y 1e-04
PRK12293281 PRK12293, hisZ, ATP phosphoribosyltransferase regu 2e-04
cd01897167 cd01897, NOG, Nucleolar GTP-binding protein (NOG) 3e-04
COG2262411 COG2262, HflX, GTPases [General function predictio 4e-04
PRK15494339 PRK15494, era, GTPase Era; Provisional 4e-04
pfam08477116 pfam08477, Miro, Miro-like protein 4e-04
COG1100219 COG1100, COG1100, GTPase SAR1 and related small G 6e-04
TIGR02034406 TIGR02034, CysN, sulfate adenylyltransferase, larg 7e-04
cd04178171 cd04178, Nucleostemin_like, A circularly permuted 8e-04
PRK04213201 PRK04213, PRK04213, GTP-binding protein; Provision 0.001
COG3596296 COG3596, COG3596, Predicted GTPase [General functi 0.001
PRK12298390 PRK12298, obgE, GTPase CgtA; Reviewed 0.001
PRK12297424 PRK12297, obgE, GTPase CgtA; Reviewed 0.001
cd09912180 cd09912, DLP_2, Dynamin-like protein including dyn 0.002
COG1163365 COG1163, DRG, Predicted GTPase [General function p 0.002
COG0012372 COG0012, COG0012, Predicted GTPase, probable trans 0.002
PTZ00258390 PTZ00258, PTZ00258, GTP-binding protein; Provision 0.002
TIGR03156351 TIGR03156, GTP_HflX, GTP-binding protein HflX 0.003
COG1162301 COG1162, COG1162, Predicted GTPases [General funct 0.003
COG5256428 COG5256, TEF1, Translation elongation factor EF-1a 0.003
cd01858157 cd01858, NGP_1, A novel nucleolar GTP-binding prot 0.003
pfam03193161 pfam03193, DUF258, Protein of unknown function, DU 0.004
>gnl|CDD|234628 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
 Score =  571 bits (1476), Expect = 0.0
 Identities = 199/428 (46%), Positives = 282/428 (65%), Gaps = 10/428 (2%)

Query: 2   KPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFE 61
           KPV+ +VGRPNVGKSTLFNRLT  RDA+VA+ PG+TRDR YGE     + FI+IDTGG E
Sbjct: 1   KPVVAIVGRPNVGKSTLFNRLTGKRDAIVADTPGVTRDRIYGEAEWLGREFILIDTGGIE 60

Query: 62  PEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINKS 121
           P+   G   ++ +Q + AI E+D+I+F+VDGR GL   D+ I   LRKS +P++LV+NK 
Sbjct: 61  PD-DDGFEKQIREQAELAIEEADVILFVVDGRAGLTPADEEIAKILRKSNKPVILVVNKV 119

Query: 122 ENINSSISL-DFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTNIHSI 180
           +  +      +FY LG+G P+ ISA +G GI + L+ IL  ELP ++   +++       
Sbjct: 120 DGPDEEADAYEFYSLGLGEPYPISAEHGRGIGDLLDAILE-ELPEEEEEDEED------- 171

Query: 181 EYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAGI 240
           E IK+AI+G+PNVGKS+LIN+LLGE RVI  D  GTTRDSI + FE + +KY LIDTAGI
Sbjct: 172 EPIKIAIIGRPNVGKSSLINALLGEERVIVSDIAGTTRDSIDTPFERDGQKYTLIDTAGI 231

Query: 241 RRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCV 300
           RR+ K  E +EK+SVI+TLK+I  A+VV+L++DA + I+ QD+ IA    E+GR+L++ V
Sbjct: 232 RRKGKVTEGVEKYSVIRTLKAIERADVVLLVIDATEGITEQDLRIAGLALEAGRALVIVV 291

Query: 301 NKWDSIIHNQRKIIKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIHLS 360
           NKWD +     +  K  ++++L FL +A   FISA+    ++  +E+I+  Y+++   +S
Sbjct: 292 NKWDLVDEKTMEEFKKELRRRLPFLDYAPIVFISALTGQGVDKLLEAIDEAYENANRRIS 351

Query: 361 TSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYLEK 420
           TS + R L  A++ HPP   K  R K++YA Q G NPP  V+  N  + +   YKRYLE 
Sbjct: 352 TSVLNRVLEEAVERHPPPLVKGRRLKIKYATQVGTNPPTFVLFVNDPELLPFSYKRYLEN 411

Query: 421 YFYRTFSL 428
                F  
Sbjct: 412 QLREAFDF 419


Length = 435

>gnl|CDD|234274 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|224082 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|213530 TIGR00442, hisS, histidyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|234586 PRK00037, hisS, histidyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|223202 COG0124, HisS, Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|183031 PRK11194, PRK11194, ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>gnl|CDD|223890 COG0820, COG0820, Predicted Fe-S-cluster redox enzyme [General function prediction only] Back     alignment and domain information
>gnl|CDD|232798 TIGR00048, TIGR00048, 23S rRNA m2A2503 methyltransferase Back     alignment and domain information
>gnl|CDD|184686 PRK14454, PRK14454, ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>gnl|CDD|164576 CHL00201, syh, histidine-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|237720 PRK14463, PRK14463, ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>gnl|CDD|172935 PRK14460, PRK14460, ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>gnl|CDD|236546 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>gnl|CDD|179525 PRK03003, PRK03003, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|184689 PRK14459, PRK14459, ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>gnl|CDD|184693 PRK14467, PRK14467, ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>gnl|CDD|184688 PRK14457, PRK14457, ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>gnl|CDD|237718 PRK14461, PRK14461, ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>gnl|CDD|172944 PRK14469, PRK14469, ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>gnl|CDD|184694 PRK14468, PRK14468, ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>gnl|CDD|237721 PRK14466, PRK14466, ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>gnl|CDD|237717 PRK14455, PRK14455, ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>gnl|CDD|238396 cd00773, HisRS-like_core, Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain Back     alignment and domain information
>gnl|CDD|237719 PRK14462, PRK14462, ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>gnl|CDD|206682 cd01895, EngA2, EngA2 GTPase contains the second domain of EngA Back     alignment and domain information
>gnl|CDD|172932 PRK14456, PRK14456, ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>gnl|CDD|206681 cd01894, EngA1, EngA1 GTPase contains the first domain of EngA Back     alignment and domain information
>gnl|CDD|184685 PRK14453, PRK14453, chloramphenicol/florfenicol resistance protein; Provisional Back     alignment and domain information
>gnl|CDD|179085 PRK00668, ndk, mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated Back     alignment and domain information
>gnl|CDD|172940 PRK14465, PRK14465, ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>gnl|CDD|223183 COG0105, Ndk, Nucleoside diphosphate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|239876 cd04413, NDPk_I, Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate Back     alignment and domain information
>gnl|CDD|201162 pfam00334, NDK, Nucleoside diphosphate kinase Back     alignment and domain information
>gnl|CDD|197791 smart00562, NDK, Enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates Back     alignment and domain information
>gnl|CDD|172945 PRK14470, PRK14470, ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>gnl|CDD|184691 PRK14464, PRK14464, ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>gnl|CDD|232978 TIGR00443, hisZ_biosyn_reg, ATP phosphoribosyltransferase, regulatory subunit Back     alignment and domain information
>gnl|CDD|237043 PRK12292, hisZ, ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>gnl|CDD|206681 cd01894, EngA1, EngA1 GTPase contains the first domain of EngA Back     alignment and domain information
>gnl|CDD|173387 PTZ00093, PTZ00093, nucleoside diphosphate kinase, cytosolic; Provisional Back     alignment and domain information
>gnl|CDD|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase Back     alignment and domain information
>gnl|CDD|206727 cd04164, trmE, trmE is a tRNA modification GTPase Back     alignment and domain information
>gnl|CDD|238335 cd00595, NDPk, Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation Back     alignment and domain information
>gnl|CDD|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase Back     alignment and domain information
>gnl|CDD|222097 pfam13393, tRNA-synt_His, Histidyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|223561 COG0486, ThdF, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|184734 PRK14545, PRK14545, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|235392 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>gnl|CDD|206646 cd00880, Era_like, E Back     alignment and domain information
>gnl|CDD|173007 PRK14541, PRK14541, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|184733 PRK14540, PRK14540, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|206727 cd04164, trmE, trmE is a tRNA modification GTPase Back     alignment and domain information
>gnl|CDD|226228 COG3705, HisZ, ATP phosphoribosyltransferase involved in histidine biosynthesis [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|178145 PLN02530, PLN02530, histidine-tRNA ligase Back     alignment and domain information
>gnl|CDD|216009 pfam00587, tRNA-synt_2b, tRNA synthetase class II core domain (G, H, P, S and T) Back     alignment and domain information
>gnl|CDD|206646 cd00880, Era_like, E Back     alignment and domain information
>gnl|CDD|206682 cd01895, EngA2, EngA2 GTPase contains the second domain of EngA Back     alignment and domain information
>gnl|CDD|173008 PRK14542, PRK14542, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|235392 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>gnl|CDD|178228 PLN02619, PLN02619, nucleoside-diphosphate kinase Back     alignment and domain information
>gnl|CDD|234624 PRK00089, era, GTPase Era; Reviewed Back     alignment and domain information
>gnl|CDD|206726 cd04163, Era, E Back     alignment and domain information
>gnl|CDD|206726 cd04163, Era, E Back     alignment and domain information
>gnl|CDD|223561 COG0486, ThdF, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|232980 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase TrmE Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|224081 COG1159, Era, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224081 COG1159, Era, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|234624 PRK00089, era, GTPase Era; Reviewed Back     alignment and domain information
>gnl|CDD|129528 TIGR00436, era, GTP-binding protein Era Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|173010 PRK14544, PRK14544, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|239878 cd04415, NDPk7A, Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>gnl|CDD|237097 PRK12420, PRK12420, histidyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|234395 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster maturation GTPase HydF Back     alignment and domain information
>gnl|CDD|238359 cd00670, Gly_His_Pro_Ser_Thr_tRS_core, Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain Back     alignment and domain information
>gnl|CDD|238436 cd00859, HisRS_anticodon, HisRS Histidyl-anticodon binding domain Back     alignment and domain information
>gnl|CDD|206667 cd01879, FeoB, Ferrous iron transport protein B (FeoB) family Back     alignment and domain information
>gnl|CDD|215503 PLN02931, PLN02931, nucleoside diphosphate kinase family protein Back     alignment and domain information
>gnl|CDD|237749 PRK14543, PRK14543, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|129528 TIGR00436, era, GTP-binding protein Era Back     alignment and domain information
>gnl|CDD|239879 cd04416, NDPk_TX, NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively Back     alignment and domain information
>gnl|CDD|234395 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster maturation GTPase HydF Back     alignment and domain information
>gnl|CDD|232980 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase TrmE Back     alignment and domain information
>gnl|CDD|206665 cd01876, YihA_EngB, YihA (EngB) GTPase family Back     alignment and domain information
>gnl|CDD|239877 cd04414, NDPk6, Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues Back     alignment and domain information
>gnl|CDD|217025 pfam02421, FeoB_N, Ferrous iron transport protein B Back     alignment and domain information
>gnl|CDD|215525 PLN02972, PLN02972, Histidyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|206749 cd01856, YlqF, Circularly permuted YlqF GTPase Back     alignment and domain information
>gnl|CDD|223447 COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|225171 COG2262, HflX, GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|224083 COG1161, COG1161, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|183413 PRK12295, hisZ, ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>gnl|CDD|206746 cd01849, YlqF_related_GTPase, Circularly permuted YlqF-related GTPases Back     alignment and domain information
>gnl|CDD|206748 cd01855, YqeH, Circularly permuted YqeH GTPase Back     alignment and domain information
>gnl|CDD|213833 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>gnl|CDD|232975 TIGR00437, feoB, ferrous iron transporter FeoB Back     alignment and domain information
>gnl|CDD|236570 PRK09563, rbgA, GTPase YlqF; Reviewed Back     alignment and domain information
>gnl|CDD|239880 cd04418, NDPk5, Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species Back     alignment and domain information
>gnl|CDD|206665 cd01876, YihA_EngB, YihA (EngB) GTPase family Back     alignment and domain information
>gnl|CDD|223296 COG0218, COG0218, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|223296 COG0218, COG0218, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213834 TIGR03597, GTPase_YqeH, ribosome biogenesis GTPase YqeH Back     alignment and domain information
>gnl|CDD|213835 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>gnl|CDD|234770 PRK00454, engB, GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>gnl|CDD|238391 cd00768, class_II_aaRS-like_core, Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>gnl|CDD|206666 cd01878, HflX, HflX GTPase family Back     alignment and domain information
>gnl|CDD|217866 pfam04055, Radical_SAM, Radical SAM superfamily Back     alignment and domain information
>gnl|CDD|239875 cd04412, NDPk7B, Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>gnl|CDD|206750 cd01857, HSR1_MMR1, A circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|223447 COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|234125 TIGR03156, GTP_HflX, GTP-binding protein HflX Back     alignment and domain information
>gnl|CDD|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors Back     alignment and domain information
>gnl|CDD|206668 cd01881, Obg_like, Obg-like family of GTPases consist of five subfamilies: Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>gnl|CDD|206739 cd09912, DLP_2, Dynamin-like protein including dynamins, mitofusins, and guanylate-binding proteins Back     alignment and domain information
>gnl|CDD|206752 cd01859, MJ1464, An uncharacterized, circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|217025 pfam02421, FeoB_N, Ferrous iron transport protein B Back     alignment and domain information
>gnl|CDD|206684 cd01897, NOG, Nucleolar GTP-binding protein (NOG) Back     alignment and domain information
>gnl|CDD|206667 cd01879, FeoB, Ferrous iron transport protein B (FeoB) family Back     alignment and domain information
>gnl|CDD|185391 PRK15494, era, GTPase Era; Provisional Back     alignment and domain information
>gnl|CDD|224009 COG1084, COG1084, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|237048 PRK12299, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|183413 PRK12295, hisZ, ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>gnl|CDD|232975 TIGR00437, feoB, ferrous iron transporter FeoB Back     alignment and domain information
>gnl|CDD|202547 pfam03129, HGTP_anticodon, Anticodon binding domain Back     alignment and domain information
>gnl|CDD|234770 PRK00454, engB, GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>gnl|CDD|206685 cd01898, Obg, Obg GTPase Back     alignment and domain information
>gnl|CDD|206683 cd01896, DRG, Developmentally Regulated GTP-binding protein (DRG) Back     alignment and domain information
>gnl|CDD|224085 COG1163, DRG, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213835 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>gnl|CDD|206749 cd01856, YlqF, Circularly permuted YlqF GTPase Back     alignment and domain information
>gnl|CDD|206743 cd11383, YfjP, YfjP GTPase Back     alignment and domain information
>gnl|CDD|224083 COG1161, COG1161, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|223091 COG0012, COG0012, Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|237511 PRK13796, PRK13796, GTPase YqeH; Provisional Back     alignment and domain information
>gnl|CDD|236583 PRK09601, PRK09601, GTP-binding protein YchF; Reviewed Back     alignment and domain information
>gnl|CDD|206686 cd01899, Ygr210, Ygr210 GTPase Back     alignment and domain information
>gnl|CDD|206753 cd04178, Nucleostemin_like, A circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|206687 cd01900, YchF, YchF GTPase Back     alignment and domain information
>gnl|CDD|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors Back     alignment and domain information
>gnl|CDD|206666 cd01878, HflX, HflX GTPase family Back     alignment and domain information
>gnl|CDD|233986 TIGR02729, Obg_CgtA, Obg family GTPase CgtA Back     alignment and domain information
>gnl|CDD|206668 cd01881, Obg_like, Obg-like family of GTPases consist of five subfamilies: Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>gnl|CDD|236584 PRK09602, PRK09602, translation-associated GTPase; Reviewed Back     alignment and domain information
>gnl|CDD|179790 PRK04213, PRK04213, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213833 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>gnl|CDD|237098 PRK12421, PRK12421, ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>gnl|CDD|100105 cd01335, Radical_SAM, Radical SAM superfamily Back     alignment and domain information
>gnl|CDD|223610 COG0536, Obg, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|236570 PRK09563, rbgA, GTPase YlqF; Reviewed Back     alignment and domain information
>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain Back     alignment and domain information
>gnl|CDD|206743 cd11383, YfjP, YfjP GTPase Back     alignment and domain information
>gnl|CDD|226124 COG3596, COG3596, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain Back     alignment and domain information
>gnl|CDD|236563 PRK09554, feoB, ferrous iron transport protein B; Reviewed Back     alignment and domain information
>gnl|CDD|206729 cd04166, CysN_ATPS, CysN, together with protein CysD, forms the ATP sulfurylase (ATPS) complex Back     alignment and domain information
>gnl|CDD|234988 PRK01889, PRK01889, GTPase RsgA; Reviewed Back     alignment and domain information
>gnl|CDD|206747 cd01854, YjeQ_EngC, Ribosomal interacting GTPase YjeQ/EngC, a circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|183411 PRK12293, hisZ, ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>gnl|CDD|206684 cd01897, NOG, Nucleolar GTP-binding protein (NOG) Back     alignment and domain information
>gnl|CDD|225171 COG2262, HflX, GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|185391 PRK15494, era, GTPase Era; Provisional Back     alignment and domain information
>gnl|CDD|219856 pfam08477, Miro, Miro-like protein Back     alignment and domain information
>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|213679 TIGR02034, CysN, sulfate adenylyltransferase, large subunit Back     alignment and domain information
>gnl|CDD|206753 cd04178, Nucleostemin_like, A circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|179790 PRK04213, PRK04213, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226124 COG3596, COG3596, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|237047 PRK12298, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|237046 PRK12297, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|206739 cd09912, DLP_2, Dynamin-like protein including dynamins, mitofusins, and guanylate-binding proteins Back     alignment and domain information
>gnl|CDD|224085 COG1163, DRG, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|223091 COG0012, COG0012, Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|240334 PTZ00258, PTZ00258, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|234125 TIGR03156, GTP_HflX, GTP-binding protein HflX Back     alignment and domain information
>gnl|CDD|224084 COG1162, COG1162, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|227581 COG5256, TEF1, Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|206751 cd01858, NGP_1, A novel nucleolar GTP-binding protein, circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|217416 pfam03193, DUF258, Protein of unknown function, DUF258 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1250
PRK14461371 ribosomal RNA large subunit methyltransferase N; P 100.0
COG0820349 Predicted Fe-S-cluster redox enzyme [General funct 100.0
PRK14459373 ribosomal RNA large subunit methyltransferase N; P 100.0
PRK11194372 ribosomal RNA large subunit methyltransferase N; P 100.0
PRK14465342 ribosomal RNA large subunit methyltransferase N; P 100.0
PRK14462356 ribosomal RNA large subunit methyltransferase N; P 100.0
PRK14466345 ribosomal RNA large subunit methyltransferase N; P 100.0
PRK14467348 ribosomal RNA large subunit methyltransferase N; P 100.0
PRK14454342 ribosomal RNA large subunit methyltransferase N; P 100.0
PRK14457345 ribosomal RNA large subunit methyltransferase N; P 100.0
COG1160444 Predicted GTPases [General function prediction onl 100.0
TIGR00048355 radical SAM enzyme, Cfr family. A Staphylococcus s 100.0
PRK14464344 ribosomal RNA large subunit methyltransferase N; P 100.0
PRK14470336 ribosomal RNA large subunit methyltransferase N; P 100.0
PRK14453347 chloramphenicol/florfenicol resistance protein; Pr 100.0
PRK14460354 ribosomal RNA large subunit methyltransferase N; P 100.0
PRK14455356 ribosomal RNA large subunit methyltransferase N; P 100.0
PRK14456368 ribosomal RNA large subunit methyltransferase N; P 100.0
PRK14463349 ribosomal RNA large subunit methyltransferase N; P 100.0
PRK14468343 ribosomal RNA large subunit methyltransferase N; P 100.0
PRK14469343 ribosomal RNA large subunit methyltransferase N; P 100.0
COG0124429 HisS Histidyl-tRNA synthetase [Translation, riboso 100.0
PRK03003472 GTP-binding protein Der; Reviewed 100.0
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 100.0
PRK00093435 GTP-binding protein Der; Reviewed 100.0
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 100.0
CHL00201430 syh histidine-tRNA synthetase; Provisional 100.0
PLN02972763 Histidyl-tRNA synthetase 100.0
PLN02530487 histidine-tRNA ligase 100.0
KOG1936|consensus518 100.0
TIGR00442397 hisS histidyl-tRNA synthetase. This model finds a 100.0
PRK00037412 hisS histidyl-tRNA synthetase; Reviewed 100.0
PRK12420423 histidyl-tRNA synthetase; Provisional 100.0
PRK12292391 hisZ ATP phosphoribosyltransferase regulatory subu 100.0
PRK12421392 ATP phosphoribosyltransferase regulatory subunit; 100.0
TIGR00443314 hisZ_biosyn_reg ATP phosphoribosyltransferase, reg 100.0
PRK12295373 hisZ ATP phosphoribosyltransferase regulatory subu 100.0
cd00773261 HisRS-like_core Class II Histidinyl-tRNA synthetas 100.0
TIGR00418563 thrS threonyl-tRNA synthetase. This model represen 100.0
PF13393311 tRNA-synt_His: Histidyl-tRNA synthetase; PDB: 3HRI 100.0
PRK12293281 hisZ ATP phosphoribosyltransferase regulatory subu 100.0
PRK12444639 threonyl-tRNA synthetase; Reviewed 100.0
PRK12305575 thrS threonyl-tRNA synthetase; Reviewed 100.0
PRK00413638 thrS threonyl-tRNA synthetase; Reviewed 100.0
COG3705390 HisZ ATP phosphoribosyltransferase involved in his 100.0
PRK14799545 thrS threonyl-tRNA synthetase; Provisional 100.0
PRK12294272 hisZ ATP phosphoribosyltransferase regulatory subu 100.0
PRK09194565 prolyl-tRNA synthetase; Provisional 99.97
PLN02908686 threonyl-tRNA synthetase 99.97
COG0105135 Ndk Nucleoside diphosphate kinase [Nucleotide tran 99.97
PRK12325439 prolyl-tRNA synthetase; Provisional 99.96
PRK14542137 nucleoside diphosphate kinase; Provisional 99.96
TIGR00409568 proS_fam_II prolyl-tRNA synthetase, family II. Pro 99.96
KOG1191|consensus531 99.95
KOG1035|consensus1351 99.95
PRK14541140 nucleoside diphosphate kinase; Provisional 99.95
cd04415131 NDPk7A Nucleoside diphosphate kinase 7 domain A (N 99.95
PRK14545139 nucleoside diphosphate kinase; Provisional 99.95
PRK14540134 nucleoside diphosphate kinase; Provisional 99.95
PTZ00093149 nucleoside diphosphate kinase, cytosolic; Provisio 99.95
PRK11145246 pflA pyruvate formate lyase-activating enzyme 1; P 99.95
PLN02619238 nucleoside-diphosphate kinase 99.94
PLN02931177 nucleoside diphosphate kinase family protein 99.94
cd04418132 NDPk5 Nucleoside diphosphate kinase homolog 5 (NDP 99.94
PRK14543169 nucleoside diphosphate kinase; Provisional 99.94
PRK00668134 ndk mulitfunctional nucleoside diphosphate kinase/ 99.94
cd04413130 NDPk_I Nucleoside diphosphate kinase Group I (NDPk 99.94
PRK03991613 threonyl-tRNA synthetase; Validated 99.94
cd04414135 NDPk6 Nucleoside diphosphate kinase 6 (NDP kinase 99.94
cd04412134 NDPk7B Nucleoside diphosphate kinase 7 domain B (N 99.93
PLN02837614 threonine-tRNA ligase 99.93
PRK04173456 glycyl-tRNA synthetase; Provisional 99.93
cd04416132 NDPk_TX NDP kinase domain of thioredoxin domain-co 99.93
cd00595133 NDPk Nucleoside diphosphate kinases (NDP kinases, 99.93
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.92
COG0441589 ThrS Threonyl-tRNA synthetase [Translation, riboso 99.92
TIGR00408472 proS_fam_I prolyl-tRNA synthetase, family I. Proly 99.92
TIGR01290442 nifB nitrogenase cofactor biosynthesis protein Nif 99.92
PRK10076213 pyruvate formate lyase II activase; Provisional 99.92
COG1159298 Era GTPase [General function prediction only] 99.92
COG1159298 Era GTPase [General function prediction only] 99.92
PRK14544183 nucleoside diphosphate kinase; Provisional 99.92
COG0486454 ThdF Predicted GTPase [General function prediction 99.91
KOG0888|consensus156 99.91
PF00334135 NDK: Nucleoside diphosphate kinase; InterPro: IPR0 99.91
smart00562135 NDK These are enzymes that catalyze nonsubstrate s 99.91
COG1160444 Predicted GTPases [General function prediction onl 99.91
PRK08661477 prolyl-tRNA synthetase; Provisional 99.91
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.9
COG1180260 PflA Pyruvate-formate lyase-activating enzyme [Pos 99.89
COG0486454 ThdF Predicted GTPase [General function prediction 99.88
TIGR02493235 PFLA pyruvate formate-lyase 1-activating enzyme. A 99.88
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.88
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.87
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.86
PRK15494339 era GTPase Era; Provisional 99.86
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.86
TIGR02494295 PFLE_PFLC glycyl-radical enzyme activating protein 99.85
PRK15494339 era GTPase Era; Provisional 99.84
PRK00089292 era GTPase Era; Reviewed 99.84
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.84
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 99.82
PRK13762322 tRNA-modifying enzyme; Provisional 99.82
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.82
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.82
TIGR03821321 AblA_like_1 lysine-2,3-aminomutase-related protein 99.82
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.82
PRK00164331 moaA molybdenum cofactor biosynthesis protein A; R 99.81
COG0218200 Predicted GTPase [General function prediction only 99.81
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.81
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.81
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.8
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.8
PRK00089292 era GTPase Era; Reviewed 99.8
PLN02734684 glycyl-tRNA synthetase 99.8
PRK12296500 obgE GTPase CgtA; Reviewed 99.8
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.8
PRK03003472 GTP-binding protein Der; Reviewed 99.8
PRK12298390 obgE GTPase CgtA; Reviewed 99.8
TIGR03278404 methan_mark_10 putative methanogenesis marker prot 99.8
TIGR00389551 glyS_dimeric glycyl-tRNA synthetase, dimeric type. 99.8
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.8
PRK12299335 obgE GTPase CgtA; Reviewed 99.8
COG0370653 FeoB Fe2+ transport system protein B [Inorganic io 99.79
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.79
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.79
COG0218200 Predicted GTPase [General function prediction only 99.79
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.79
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.79
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.79
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.79
PRK11058426 GTPase HflX; Provisional 99.79
KOG1637|consensus560 99.78
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.78
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.78
PRK12299335 obgE GTPase CgtA; Reviewed 99.77
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.77
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.77
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.77
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.77
PRK00093435 GTP-binding protein Der; Reviewed 99.77
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.77
PRK09554772 feoB ferrous iron transport protein B; Reviewed 99.77
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.77
KOG1191|consensus531 99.77
KOG2324|consensus457 99.77
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 99.77
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.76
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.76
cd00670235 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_t 99.76
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 99.76
cd00881189 GTP_translation_factor GTP translation factor fami 99.76
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.76
PRK11058426 GTPase HflX; Provisional 99.76
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.76
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 99.76
KOG0084|consensus205 99.76
PRK09563287 rbgA GTPase YlqF; Reviewed 99.76
PRK12298390 obgE GTPase CgtA; Reviewed 99.76
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.76
KOG1423|consensus379 99.75
PRK04213201 GTP-binding protein; Provisional 99.75
PRK12297424 obgE GTPase CgtA; Reviewed 99.75
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.75
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 99.75
PRK12296500 obgE GTPase CgtA; Reviewed 99.75
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 99.75
PRK12297424 obgE GTPase CgtA; Reviewed 99.75
KOG1423|consensus379 99.75
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.75
PRK14894539 glycyl-tRNA synthetase; Provisional 99.74
COG0370653 FeoB Fe2+ transport system protein B [Inorganic io 99.74
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.74
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.74
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.74
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.74
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 99.74
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.74
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.74
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.74
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.74
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.73
KOG0084|consensus205 99.73
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.73
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.73
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.73
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.73
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.73
PRK12317425 elongation factor 1-alpha; Reviewed 99.73
COG1084346 Predicted GTPase [General function prediction only 99.73
COG0423558 GRS1 Glycyl-tRNA synthetase (class II) [Translatio 99.72
COG1084346 Predicted GTPase [General function prediction only 99.72
PRK04213201 GTP-binding protein; Provisional 99.72
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 99.72
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.72
KOG0094|consensus221 99.72
KOG0092|consensus200 99.72
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.72
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.72
TIGR00475581 selB selenocysteine-specific elongation factor Sel 99.72
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.72
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.72
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.72
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.72
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.72
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.72
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 99.72
cd00771298 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class 99.72
TIGR00437591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.72
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.72
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.72
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.71
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.71
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.71
CHL00071409 tufA elongation factor Tu 99.71
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.71
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.71
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.71
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.71
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.71
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.71
KOG0092|consensus200 99.71
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.71
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.71
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.71
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.71
cd00881189 GTP_translation_factor GTP translation factor fami 99.71
PLN00223181 ADP-ribosylation factor; Provisional 99.71
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.71
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.71
PLN03118211 Rab family protein; Provisional 99.71
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.71
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.71
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.71
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.71
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.7
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.7
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.7
KOG0394|consensus210 99.7
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.7
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.7
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.7
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.7
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.7
PRK12736394 elongation factor Tu; Reviewed 99.7
COG2262411 HflX GTPases [General function prediction only] 99.7
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.7
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.7
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.7
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.7
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.7
KOG0094|consensus221 99.7
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.7
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.7
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.7
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.7
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.7
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.7
PLN03127447 Elongation factor Tu; Provisional 99.7
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.7
COG0442500 ProS Prolyl-tRNA synthetase [Translation, ribosoma 99.69
KOG0078|consensus207 99.69
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.69
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.69
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.69
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.69
PRK09554772 feoB ferrous iron transport protein B; Reviewed 99.69
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.69
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.69
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.69
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.69
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.69
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.69
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.69
PTZ00133182 ADP-ribosylation factor; Provisional 99.69
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.69
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.69
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.69
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.69
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.69
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.69
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.69
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.69
PRK10512614 selenocysteinyl-tRNA-specific translation factor; 99.69
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.69
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.69
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.69
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.69
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.69
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.69
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.69
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.69
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.69
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.69
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.69
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.68
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.68
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.68
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.68
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.68
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.68
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.68
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.68
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.68
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.68
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.68
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.68
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.68
PRK12289352 GTPase RsgA; Reviewed 99.68
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.68
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.68
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.68
KOG1489|consensus366 99.68
PLN00223181 ADP-ribosylation factor; Provisional 99.68
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.68
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.68
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.68
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.68
KOG0078|consensus207 99.68
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.68
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.68
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.68
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.68
TIGR00487587 IF-2 translation initiation factor IF-2. This mode 99.68
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.68
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.68
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.68
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.68
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.68
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.67
PTZ00369189 Ras-like protein; Provisional 99.67
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.67
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.67
PRK12735396 elongation factor Tu; Reviewed 99.67
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.67
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.67
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.67
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.67
cd01896233 DRG The developmentally regulated GTP-binding prot 99.67
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.67
PRK05306787 infB translation initiation factor IF-2; Validated 99.67
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.67
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.67
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.67
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.67
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.67
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.67
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.67
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.66
PLN03110216 Rab GTPase; Provisional 99.66
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.66
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.66
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.66
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.66
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.66
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.66
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.66
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.66
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.66
PRK00049396 elongation factor Tu; Reviewed 99.66
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.66
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.66
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.66
TIGR00485394 EF-Tu translation elongation factor TU. This align 99.66
KOG0098|consensus216 99.66
cd01896233 DRG The developmentally regulated GTP-binding prot 99.66
PTZ00133182 ADP-ribosylation factor; Provisional 99.66
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.66
CHL00189742 infB translation initiation factor 2; Provisional 99.66
TIGR01393595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.66
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.66
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.66
PTZ00369189 Ras-like protein; Provisional 99.66
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.66
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.65
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.65
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.65
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.65
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.65
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.65
TIGR00487587 IF-2 translation initiation factor IF-2. This mode 99.65
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.65
PRK05306787 infB translation initiation factor IF-2; Validated 99.65
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.65
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.65
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.65
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.65
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 99.65
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.65
PLN03110216 Rab GTPase; Provisional 99.65
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.64
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.64
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.64
PLN02951373 Molybderin biosynthesis protein CNX2 99.64
KOG0087|consensus222 99.64
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.64
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.64
PLN03118211 Rab family protein; Provisional 99.64
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.64
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 99.64
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.64
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.64
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.64
TIGR00437591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.64
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.64
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.64
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.64
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.64
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.63
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.63
KOG0098|consensus216 99.63
PLN03126478 Elongation factor Tu; Provisional 99.63
TIGR00491590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.63
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.63
COG1163365 DRG Predicted GTPase [General function prediction 99.63
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.63
KOG0394|consensus210 99.63
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.63
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.63
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.63
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.63
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.63
PRK05124474 cysN sulfate adenylyltransferase subunit 1; Provis 99.63
PLN03108210 Rab family protein; Provisional 99.63
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.63
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.62
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.62
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.62
KOG0080|consensus209 99.62
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.62
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.62
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.62
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.62
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 99.62
KOG1490|consensus620 99.62
TIGR01394594 TypA_BipA GTP-binding protein TypA/BipA. This bact 99.62
PLN03108210 Rab family protein; Provisional 99.62
PRK10218607 GTP-binding protein; Provisional 99.62
COG2262411 HflX GTPases [General function prediction only] 99.62
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.62
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.62
KOG0093|consensus193 99.62
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.61
KOG0087|consensus222 99.61
PF1471480 KH_dom-like: KH-domain-like of EngA bacterial GTPa 99.61
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 99.61
CHL00189742 infB translation initiation factor 2; Provisional 99.61
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.61
TIGR01393595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.61
TIGR00483426 EF-1_alpha translation elongation factor EF-1 alph 99.61
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.61
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.61
KOG1489|consensus366 99.61
KOG0095|consensus213 99.61
TIGR00475581 selB selenocysteine-specific elongation factor Sel 99.61
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.61
KOG0462|consensus650 99.61
PRK12317425 elongation factor 1-alpha; Reviewed 99.6
TIGR03680406 eif2g_arch translation initiation factor 2 subunit 99.6
COG0536369 Obg Predicted GTPase [General function prediction 99.6
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.6
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.6
PRK05433600 GTP-binding protein LepA; Provisional 99.6
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.6
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 99.6
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.6
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.6
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.6
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.59
PRK12739691 elongation factor G; Reviewed 99.59
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.59
PRK13796365 GTPase YqeH; Provisional 99.59
COG1163365 DRG Predicted GTPase [General function prediction 99.59
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.59
KOG0080|consensus209 99.59
COG1161322 Predicted GTPases [General function prediction onl 99.59
KOG0093|consensus193 99.59
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.59
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.59
KOG0079|consensus198 99.59
PRK09866741 hypothetical protein; Provisional 99.59
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.59
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.59
PTZ00141446 elongation factor 1- alpha; Provisional 99.59
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.59
PRK04000411 translation initiation factor IF-2 subunit gamma; 99.59
TIGR00491590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.58
COG0731296 Fe-S oxidoreductases [Energy production and conver 99.58
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.58
PRK10512614 selenocysteinyl-tRNA-specific translation factor; 99.58
PRK00007693 elongation factor G; Reviewed 99.58
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.58
KOG0079|consensus198 99.57
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 99.57
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.57
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 99.57
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 99.57
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.56
PRK04004586 translation initiation factor IF-2; Validated 99.56
KOG0095|consensus213 99.56
>PRK14461 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
Probab=100.00  E-value=6.5e-103  Score=871.78  Aligned_cols=341  Identities=36%  Similarity=0.618  Sum_probs=319.3

Q ss_pred             cchhhhhhhhcCChhHHHHHHHHHHHhcCCCCchhhcccCHHHHHHHhhcCccCCCeeeEEEEcCCC-ceEEEEEeC-CC
Q psy17091        526 ESIDKNIVHELGEMPFRAKQLQKWIHKFGVSDFNKMTDLSMSLRKKLKNSVYIKAPHIMSDQISFDG-TRKWIFHVK-KN  603 (1250)
Q Consensus       526 ~~~~~n~~~~~g~~~~ra~qi~~w~~~~~~~~~~~~~~~~~~~r~~l~~~~~~~~~~~~~~~~~~d~-t~k~l~~~~-~~  603 (1250)
                      .+.+++++.+.|+|+|||+|||+|+|++++.+|++|||||+++|++|++.|.+..+++++.+.|.|| |+||||+|+ |+
T Consensus        15 ~~el~~~~~~~g~~~fRa~Qi~~wiy~~~~~~~~~mtnlpk~lR~~L~~~~~i~~l~~~~~~~S~Dg~T~K~L~~l~DG~   94 (371)
T PRK14461         15 LAELTELLTAWGQPAFRARQLYRHLYVNLADSVLAMTDLPLALRERLTAELPLSTLRLEQVQIGDNGLTRKALFRLPDGA   94 (371)
T ss_pred             HHHHHHHHHHcCCCchHHHHHHHHHHHcCCCCHHHccccCHHHHHHHhhccccCCcceEEEEECCCCCeEEEEEEcCCCC
Confidence            3467788989999999999999999999999999999999999999999999999999999999999 999999999 99


Q ss_pred             eEEEEEeccCCCceeeeecccCCcccccccccCCCCcccCCChhhhHHHHHHHHHHhhhhhhc-cc-cCCCCCCcceeee
Q psy17091        604 IIETVFIPEKNRNTLCISTQVGCAINCIFCSTGRQGFVRNLTVGEIIGQLWVTEFKLRREKNI-KI-NSQGKRQITNIVM  681 (1250)
Q Consensus       604 ~ve~v~~~~~~~~t~c~ssq~GC~~~C~fC~t~~~~~~r~l~~~ei~~q~~~~~~~~~~~~~~-~~-~~~~~~~~~~ivf  681 (1250)
                      .||||+||+++|+|+||||||||+|+|+|||||++||.||||++||++||+.+++.++..... +. ..+...+++||||
T Consensus        95 ~IEtVli~~~~r~TlCvSSQvGC~mgC~FCaTG~~G~~RNLt~~EIv~Qv~~~~~~l~~~~~~~~~~~~~~~~~i~NIVf  174 (371)
T PRK14461         95 VVETVLMIYPDRATVCVSTQAGCGMGCVFCATGTLGLLRNLSSGEIVAQVIWASRELRAMGAAISKRHAGPVGRVTNLVF  174 (371)
T ss_pred             EEEEEEEecCCCceEEEEccCCccCCCCcccCCCCCcccCCCHHHHHHHHHHHHHHhhhcccccccccccccCceeeEEE
Confidence            999999999999999999999999999999999999999999999999999998876411000 00 0011146999999


Q ss_pred             cccCccCCCHHHHHHHHHHhhcCCCCCCCCceEEEEecCchhHHHHhhhh-CCCeEEEEccCCChhhhhccCCCCCCCCH
Q psy17091        682 MGMGEPLLNYKSTIGALKLILSDHAYGLSRRHVILSTSGIIPMIDKLAQE-CPVELAVSLHASNNNLRNKLVPISKKYPL  760 (1250)
Q Consensus       682 mg~GEpl~n~~~v~~~~~~~~~~~~~~~~~~~itvsT~g~~~~i~~~~~~-~~~~la~sl~~~~~~~r~~~~p~~~~~~~  760 (1250)
                      |||||||+|||+|++|++++++++||+||+|||||||||++|+|++|+++ .+++||||||||||++|++|||+|++||+
T Consensus       175 MGMGEPL~NydnV~~ai~il~d~~g~~is~R~ITVST~Givp~I~~la~~~~~v~LAiSLHA~~~e~R~~lmPin~~ypl  254 (371)
T PRK14461        175 MGMGEPFANYDRWWQAVERLHDPQGFNLGARSMTVSTVGLVKGIRRLANERLPINLAISLHAPDDALRSELMPVNRRYPI  254 (371)
T ss_pred             EccCCchhhHHHHHHHHHHhcCccccCcCCCceEEEeecchhHHHHHHhcccCceEEEEeCCCCHHHHHHhcCcccCCCH
Confidence            99999999999999999999999999999999999999999999999997 59999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhhCCCceEEEEEEEeccCCCCHHHHHHHHHHhhcCCCcc------ceeEeeeccCCCCCCCCCCCcHHH
Q psy17091        761 KELILACHRYITYSPRHMITFEYCMLHGINDTDIHAIELISLMRKNKILT------SCKINLIPFNCFPNSNLICSKNSR  834 (1250)
Q Consensus       761 ~~l~~~~~~~~~~~~~~~v~~e~~li~g~nd~~~~~~~l~~~~~~~~~~~------~~~vnlip~n~~~~~~~~~p~~e~  834 (1250)
                      ++|+++|++|..+++ |||||||+||+||||+++||++|++++++    +      +|+||||||||+++.+|++|+.++
T Consensus       255 ~eLl~a~~~y~~~t~-rrit~EYvLi~gvNDs~e~A~~L~~llk~----~~~~~~l~~~VNLIp~Np~~~~~~~~ps~~~  329 (371)
T PRK14461        255 ADLMAATRDYIAKTR-RRVSFEYVLLQGKNDHPEQAAALARLLRG----EAPPGPLLVHVNLIPWNPVPGTPLGRSERER  329 (371)
T ss_pred             HHHHHHHHHHHHhhC-CEEEEEEEEECCCCCCHHHHHHHHHHHcC----CccccCCceEEEEecCCCCCCCCCCCCCHHH
Confidence            999999999998876 59999999999999999999999999999    7      899999999999999999999999


Q ss_pred             HHHHHHHHHhCCCeEEEeccCccchHHhhhhcCCccc
Q psy17091        835 IKIFAKILMNSGIFVTIRKIRGNDINAACGQLSGEET  871 (1250)
Q Consensus       835 i~~f~~iL~~~G~~~~ir~~~g~~i~~acgql~~~~~  871 (1250)
                      +++|+++|+++|+.++||.++|.||+||||||+.++.
T Consensus       330 i~~F~~~L~~~gi~vtiR~s~G~DI~AACGQL~~~~~  366 (371)
T PRK14461        330 VTTFQRILTDYGIPCTVRVERGVEIAAACGQLAGRHT  366 (371)
T ss_pred             HHHHHHHHHHCCceEEEeCCCCcChhhcCcccccCCC
Confidence            9999999999999999999999999999999998763



>COG0820 Predicted Fe-S-cluster redox enzyme [General function prediction only] Back     alignment and domain information
>PRK14459 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK11194 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK14465 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK14462 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK14466 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK14467 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK14454 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK14457 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR00048 radical SAM enzyme, Cfr family Back     alignment and domain information
>PRK14464 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK14470 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK14453 chloramphenicol/florfenicol resistance protein; Provisional Back     alignment and domain information
>PRK14460 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK14455 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK14456 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK14463 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK14468 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK14469 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>COG0124 HisS Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>CHL00201 syh histidine-tRNA synthetase; Provisional Back     alignment and domain information
>PLN02972 Histidyl-tRNA synthetase Back     alignment and domain information
>PLN02530 histidine-tRNA ligase Back     alignment and domain information
>KOG1936|consensus Back     alignment and domain information
>TIGR00442 hisS histidyl-tRNA synthetase Back     alignment and domain information
>PRK00037 hisS histidyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12420 histidyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12292 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PRK12421 ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>TIGR00443 hisZ_biosyn_reg ATP phosphoribosyltransferase, regulatory subunit Back     alignment and domain information
>PRK12295 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>cd00773 HisRS-like_core Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain Back     alignment and domain information
>TIGR00418 thrS threonyl-tRNA synthetase Back     alignment and domain information
>PF13393 tRNA-synt_His: Histidyl-tRNA synthetase; PDB: 3HRI_E 3HRK_A 3LC0_A 1Z7N_A 1Z7M_D 3NET_A 1H4V_B 3OD1_A 4E51_B 3RAC_A Back     alignment and domain information
>PRK12293 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PRK12444 threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12305 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK00413 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG3705 HisZ ATP phosphoribosyltransferase involved in histidine biosynthesis [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14799 thrS threonyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12294 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PRK09194 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>PLN02908 threonyl-tRNA synthetase Back     alignment and domain information
>COG0105 Ndk Nucleoside diphosphate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12325 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK14542 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>TIGR00409 proS_fam_II prolyl-tRNA synthetase, family II Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>PRK14541 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>cd04415 NDPk7A Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>PRK14545 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PRK14540 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PTZ00093 nucleoside diphosphate kinase, cytosolic; Provisional Back     alignment and domain information
>PRK11145 pflA pyruvate formate lyase-activating enzyme 1; Provisional Back     alignment and domain information
>PLN02619 nucleoside-diphosphate kinase Back     alignment and domain information
>PLN02931 nucleoside diphosphate kinase family protein Back     alignment and domain information
>cd04418 NDPk5 Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species Back     alignment and domain information
>PRK14543 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PRK00668 ndk mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated Back     alignment and domain information
>cd04413 NDPk_I Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate Back     alignment and domain information
>PRK03991 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>cd04414 NDPk6 Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues Back     alignment and domain information
>cd04412 NDPk7B Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>PLN02837 threonine-tRNA ligase Back     alignment and domain information
>PRK04173 glycyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd04416 NDPk_TX NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively Back     alignment and domain information
>cd00595 NDPk Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>COG0441 ThrS Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00408 proS_fam_I prolyl-tRNA synthetase, family I Back     alignment and domain information
>TIGR01290 nifB nitrogenase cofactor biosynthesis protein NifB Back     alignment and domain information
>PRK10076 pyruvate formate lyase II activase; Provisional Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>PRK14544 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0888|consensus Back     alignment and domain information
>PF00334 NDK: Nucleoside diphosphate kinase; InterPro: IPR001564 Nucleoside diphosphate kinases (2 Back     alignment and domain information
>smart00562 NDK These are enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK08661 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>COG1180 PflA Pyruvate-formate lyase-activating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR02493 PFLA pyruvate formate-lyase 1-activating enzyme Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>PRK13762 tRNA-modifying enzyme; Provisional Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>TIGR03821 AblA_like_1 lysine-2,3-aminomutase-related protein Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>PRK00164 moaA molybdenum cofactor biosynthesis protein A; Reviewed Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>PLN02734 glycyl-tRNA synthetase Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR03278 methan_mark_10 putative methanogenesis marker protein 10 Back     alignment and domain information
>TIGR00389 glyS_dimeric glycyl-tRNA synthetase, dimeric type Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>KOG1637|consensus Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>KOG2324|consensus Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd00670 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>KOG0084|consensus Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>PRK14894 glycyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>KOG0084|consensus Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG0423 GRS1 Glycyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>KOG0094|consensus Back     alignment and domain information
>KOG0092|consensus Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>cd00771 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>KOG0092|consensus Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>KOG0394|consensus Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>KOG0094|consensus Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>COG0442 ProS Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0078|consensus Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>KOG0078|consensus Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>KOG0098|consensus Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>PLN02951 Molybderin biosynthesis protein CNX2 Back     alignment and domain information
>KOG0087|consensus Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>KOG0098|consensus Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>KOG0394|consensus Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>KOG0080|consensus Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>KOG1490|consensus Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>KOG0093|consensus Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>KOG0087|consensus Back     alignment and domain information
>PF14714 KH_dom-like: KH-domain-like of EngA bacterial GTPase enzymes, C-terminal; PDB: 2HJG_A 1MKY_A Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>KOG0095|consensus Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>KOG0462|consensus Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>KOG0080|consensus Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG0093|consensus Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>KOG0079|consensus Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>COG0731 Fe-S oxidoreductases [Energy production and conversion] Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>KOG0079|consensus Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>KOG0095|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1250
4e51_A467 Crystal Structure Of A Histidyl-Trna Synthetase His 1e-110
3rf9_A404 X-Ray Structure Of Rlmn From Escherichia Coli Lengt 6e-92
1htt_A423 Histidyl-Trna Synthetase Length = 423 4e-91
2el9_A431 Crystal Structure Of E.Coli Histidyl-Trna Synthetas 5e-91
1kmm_A424 Histidyl-Trna Synthetase Complexed With Histidyl-Ad 5e-91
3rfa_A404 X-Ray Structure Of Rlmn From Escherichia Coli In Co 9e-91
4dcs_A456 Crystal Structure Of B. Subtilis Enga In Complex Wi 8e-66
2hjg_A436 The Crystal Structure Of The B. Subtilis Yphc Gtpas 2e-63
1adj_A421 Histidyl-Trna Synthetase In Complex With Histidine 1e-59
1qe0_A420 Crystal Structure Of Apo S. Aureus Histidyl-Trna Sy 8e-53
1mky_A439 Structural Analysis Of The Domain Interactions In D 1e-46
4dut_A145 The Structure Of Nucleoside Diphosphate Kinase (Ndk 6e-39
3vgu_A141 E134a Mutant Nucleoside Diphosphate Kinase Derived 1e-32
3vgs_A141 Wild-Type Nucleoside Diphosphate Kinase Derived Fro 1e-32
2nck_R144 Crystal Structure Of Myxococcus Xanthus Nucleoside 2e-30
3pj9_A140 Crystal Structure Of A Nucleoside Diphosphate Kinas 2e-29
2hur_A142 Escherichia Coli Nucleoside Diphosphate Kinase Leng 7e-26
2zua_A174 Crystal Structure Of Nucleoside Diphosphate Kinase 2e-22
3q83_A157 Crystal Structure Of Staphylococcus Aureus Nucleosi 2e-22
1wu7_A434 Crystal Structure Of Histidyl-Trna Synthetase From 5e-22
3js9_A156 Crystal Structure Of Nucleoside Diphosphate Kinase 1e-21
1wkj_A137 Crystal Structure Of Nucleoside Diphosphate Kinase 1e-21
3r9l_A155 Crystal Structure Of Nucleoside Diphosphate Kinase 7e-21
3b54_A161 Saccharomyces Cerevisiae Nucleoside Diphosphate Kin 3e-20
3l7u_A172 Crystal Structure Of Human Nm23-H1 Length = 172 3e-20
1jxv_A152 Crystal Structure Of Human Nucleoside Diphosphate K 3e-20
2hve_A152 S120g Mutant Of Human Nucleoside Diphosphate Kinase 4e-20
1bhn_A152 Nucleoside Diphosphate Kinase Isoform A From Bovine 5e-20
2vu5_A148 Crystal Structure Of Pndk From Bacillus Anthracis L 5e-20
1hhq_A155 Role Of Active Site Resiude Lys16 In Nucleoside Dip 8e-20
1ndp_A155 Adenosine 5'-Diphosphate Binding And The Active Sit 9e-20
1npk_A154 Refined X-Ray Structure Of Dictyostelium Nucleoside 9e-20
1ncl_A150 Thermal Stability Of Hexameric And Tetrameric Nucle 1e-19
1xiq_A157 Plasmodium Falciparum Nucleoside Diphosphate Kinase 2e-19
3ztq_A142 Hexagonal Crystal Form P61 Of The Aquifex Aeolicus 2e-19
2az1_A181 Structure Of A Halophilic Nucleoside Diphosphate Ki 2e-19
2az3_A164 Structure Of A Halophilic Nucleoside Diphosphate Ki 2e-19
1ndl_A153 The Awd Nucleotide Diphosphate Kinase From Drosophi 2e-19
1nsk_R152 The Crystal Structure Of A Human Nucleoside Diphosp 3e-19
2dyk_A161 Crystal Structure Of N-Terminal Gtp-Binding Domain 3e-19
2dyk_A161 Crystal Structure Of N-Terminal Gtp-Binding Domain 3e-14
1nue_A151 X-ray Structure Of Nm23 Human Nucleoside Diphosphat 3e-19
3ddi_A146 Crystal Structure Of The Mimivirus Ndk +kpn-N62l-R1 4e-19
3em1_A146 Crystal Structure Of The Mimivirus Ndk +kpn-N62l Do 5e-19
1zs6_A169 Structure Of Human Nucleoside-diphosphate Kinase 3 6e-19
1be4_A151 Nucleoside Diphosphate Kinase Isoform B From Bovine 6e-19
1lwx_A155 Azt Diphosphate Binding To Nucleoside Diphosphate K 7e-19
1k44_A136 Mycobacterium Tuberculosis Nucleoside Diphosphate K 7e-19
1leo_A150 P100s Nucleoside Diphosphate Kinase Length = 150 9e-19
1hlw_A155 Structure Of The H122a Mutant Of The Nucleoside Dip 1e-18
1ndk_A155 X-Ray Structure Of Nucleoside Diphosphate Kinase Le 1e-18
1b4s_A155 Structure Of Nucleoside Diphosphate Kinase H122g Mu 1e-18
1nsp_A155 Mechanism Of Phosphate Transfer By Nucleoside Dipho 1e-18
2cwk_A160 Crystal Structure Of Nucleotide Diphosphate Kinase 2e-18
3bbc_A151 Crystal Structure Of R88a Mutant Of The Nm23-H2 Tra 2e-18
1ucn_A152 X-Ray Structure Of Human Nucleoside Diphosphate Kin 2e-18
1nsq_A153 Mechanism Of Phosphate Transfer By Nucleoside Dipho 3e-18
1pae_X155 Nucleoside Diphosphate Kinase Length = 155 3e-18
1w7w_A182 Structure And Mutational Analysis Of A Plant Mitoch 3e-18
3emt_A146 Crystal Structure Of The Mimivirus Ndk +kpn-R107g D 3e-18
3ejm_A146 Crystal Structure Of The Mimivirus Ndk +kpn Mutant 5e-18
1s57_A153 Crystal Structure Of Nucleoside Diphosphate Kinase 7e-18
3prv_A157 Nucleoside Diphosphate Kinase B From Trypanosoma Cr 1e-17
1xzp_A482 Structure Of The Gtp-Binding Protein Trme From Ther 2e-17
1mn7_A155 Ndp Kinase Mutant (H122g;n119s;f64w) In Complex Wit 2e-17
1pku_A150 Crystal Structure Of Nucleoside Diphosphate Kinase 2e-17
1ehw_A162 Human Nucleoside Diphosphate Kinase 4 Length = 162 3e-17
3ngr_A151 Crystal Structure Of Leishmania Nucleoside Diphosph 1e-16
4fkx_A161 Crystal Structure Of Nucleoside Diphosphate Kinase 5e-16
4f36_A157 Crystal Structure Of Nucleoside Diphosphate Kinase 5e-16
1u8w_A149 Crystal Structure Of Arabidopsis Thaliana Nucleosid 5e-16
3mpd_A151 Crystal Structure Of Nucleoside Diphosphate Kinase 1e-15
3hrk_A456 Histidyl-Trna Synthetase From Trypanosoma Cruzi (Hi 2e-15
3geh_A462 Crystal Structure Of Mnme From Nostoc In Complex Wi 1e-14
3od1_A400 The Crystal Structure Of An Atp Phosphoribosyltrans 1e-14
3fbe_A142 Crystal Structure Of The Mimivirus Ndk N62l-R107g D 1e-14
3fbf_A142 Crystal Structure Of The Mimivirus Ndk N62l Mutant 2e-14
3net_A465 Crystal Structure Of Histidyl-Trna Synthetase From 3e-14
3hri_A456 Histidyl-Trna Synthetase (Apo) From Trypanosoma Bru 5e-14
3gee_A476 Crystal Structure Of Mnme From Chlorobium Tepidum I 9e-14
3evw_A142 Crystal Structure Of The Mimivirus Ndk R107g Mutant 1e-13
2b8p_A157 Crystal Structure Of Acanthamoeba Polyphaga Mimivir 1e-13
2b8q_A142 X-Ray Structure Of Acanthamoeba Ployphaga Mimivirus 2e-13
1nb2_A150 Crystal Structure Of Nucleoside Diphosphate Kinase 2e-13
3iev_A308 Crystal Structure Of Era In Complex With Mggnp And 1e-11
3r9w_A307 Crystal Structure Of Era In Complex With Mggdpnp An 1e-11
4di6_A190 Crystal Structure Of Nucleoside-Diphosphate Kinase 3e-10
1rfl_A172 Nmr Data Driven Structural Model Of G-Domain Of Mnm 6e-10
1xqi_A195 Crystal Structure Analysis Of An Ndp Kinase From Py 6e-10
2gj9_A172 Structure Of The Mnme G-Domain In Complex With GdpA 1e-09
2gj8_A172 Structure Of The Mnme G-domain In Complex With Gdp* 3e-09
4g85_A517 Crystal Structure Of Human Hisrs Length = 517 6e-09
4g84_A464 Crystal Structure Of Human Hisrs Length = 464 7e-09
1wf3_A301 Crystal Structure Of Gtp-Binding Protein Tt1341 Fro 7e-09
1x18_X292 Contact Sites Of Era Gtpase On The Thermus Thermoph 8e-08
1ega_A301 Crystal Structure Of A Widely Conserved Gtpase Era 8e-08
2wjg_A188 Structure And Function Of The Feob G-Domain From Me 9e-08
2wjh_A166 Structure And Function Of The Feob G-Domain From Me 1e-07
2wji_A165 Structure And Function Of The Feob G-Domain From Me 1e-07
2wjj_A168 Structure And Function Of The Feob G-Domain From Me 3e-07
1z7m_A344 Atp Phosphoribosyl Transferase (hiszg Atp-prtase) F 4e-07
3iby_A256 Structure Of Cytosolic Domain Of L. Pneumophila Feo 1e-05
3k53_A271 Crystal Structure Of Nfeob From P. Furiosus Length 1e-05
3k53_A271 Crystal Structure Of Nfeob From P. Furiosus Length 4e-05
3qq5_A423 Crystal Structure Of The [fefe]-Hydrogenase Maturat 1e-05
2dwq_A368 Thermus Thermophilus Ychf Gtp-Binding Protein Lengt 1e-04
2dby_A368 Crystal Structure Of The Gtp-Binding Protein Ychf I 1e-04
3a1w_A168 Crystal Structue Of The G Domain Of T. Maritima Feo 3e-04
2e87_A357 Crystal Structure Of Hypothetical Gtp-Binding Prote 4e-04
3a1t_A258 Crystal Structue Of The Cytosolic Domain Of T. Mari 5e-04
3a1s_A258 Crystal Structue Of The Cytosolic Domain Of T. Mari 5e-04
3hyt_A270 Structural Basis Of Gdp Release And Gating In G Pro 7e-04
3hyr_A270 Structural Insight Into G Protein Coupling And Regu 7e-04
3i8s_A274 Structure Of The Cytosolic Domain Of E. Coli Feob, 7e-04
>pdb|4E51|A Chain A, Crystal Structure Of A Histidyl-Trna Synthetase Hisrs From Burkholderia Thailandensis Bound To Histidine Length = 467 Back     alignment and structure

Iteration: 1

Score = 396 bits (1017), Expect = e-110, Method: Compositional matrix adjust. Identities = 181/325 (55%), Positives = 241/325 (74%), Gaps = 7/325 (2%) Query: 868 GEETDIVKKEMYSFIDELNGDNLSLRPEGTASVIRSVIENNLIYDGPKRLWYSGPMFRHE 927 GE TDIV+KEMYSF+D LNG+NL+LRPE TA+V+R+ IE+N++YDGPKRLWY GPMFRHE Sbjct: 84 GEVTDIVEKEMYSFVDALNGENLTLRPENTAAVVRAAIEHNMLYDGPKRLWYIGPMFRHE 143 Query: 928 RPQYGRYRQFYQIGVEAIGFPGPDIDAELIIMCSRLWKNLNLKNICLELNSIGNFNERKK 987 RPQ GRYRQF+Q+GVEA+GF GPD DAE+++MC RLW++L L I LE+NS+G ER Sbjct: 144 RPQRGRYRQFHQVGVEALGFAGPDADAEIVMMCQRLWEDLGLTGIKLEINSLGLAEERAA 203 Query: 988 YCIDLINYIKKHKDSKWFCEDIKHSLYLNSLRVLDSKNLIIREILINAPKLLDYLEKDSL 1047 + ++LI Y+++H D +D + LY N LRVLD+KN ++EI+ NAPKL+D+L S Sbjct: 204 HRVELIKYLEQHADK--LDDDAQRRLYTNPLRVLDTKNPALQEIVRNAPKLIDFLGDVSR 261 Query: 1048 DHFYGIQKILNYNNISYKINTKLVRGMDYYNRTVFEWTTDKLGSQNSICGGGRYDFLIKK 1107 HF G+Q++L NN+ + IN +LVRG+DYYN TVFEW TDKLG+Q ++ GGRYD LI++ Sbjct: 262 AHFEGLQRLLKANNVPFTINPRLVRGLDYYNLTVFEWVTDKLGAQGTVAAGGRYDPLIEQ 321 Query: 1108 FSNKFVPASGFAIGIERLIELIKKININHNFSHQ--CDIYIVHVGKEAELKAFVLSENLR 1165 K A G+A+GIER++EL+K+ H Q D+Y+VH G A +AF+++E LR Sbjct: 322 LGGKPTAACGWAMGIERILELLKE---EHLVPEQEGVDVYVVHQGDAAREQAFIVAERLR 378 Query: 1166 TLGLKVILNCVFNNIHESFKSQMKR 1190 GL VIL+C + SFKSQMKR Sbjct: 379 DTGLDVILHCSADGAGASFKSQMKR 403
>pdb|3RF9|A Chain A, X-Ray Structure Of Rlmn From Escherichia Coli Length = 404 Back     alignment and structure
>pdb|1HTT|A Chain A, Histidyl-Trna Synthetase Length = 423 Back     alignment and structure
>pdb|2EL9|A Chain A, Crystal Structure Of E.Coli Histidyl-Trna Synthetase Complexed With A Histidyl-Adenylate Analogue Length = 431 Back     alignment and structure
>pdb|1KMM|A Chain A, Histidyl-Trna Synthetase Complexed With Histidyl-Adenylate Length = 424 Back     alignment and structure
>pdb|3RFA|A Chain A, X-Ray Structure Of Rlmn From Escherichia Coli In Complex With S- Adenosylmethionine Length = 404 Back     alignment and structure
>pdb|4DCS|A Chain A, Crystal Structure Of B. Subtilis Enga In Complex With Sulfate Ion And Gdp Length = 456 Back     alignment and structure
>pdb|2HJG|A Chain A, The Crystal Structure Of The B. Subtilis Yphc Gtpase In Complex With Gdp Length = 436 Back     alignment and structure
>pdb|1ADJ|A Chain A, Histidyl-Trna Synthetase In Complex With Histidine Length = 421 Back     alignment and structure
>pdb|1QE0|A Chain A, Crystal Structure Of Apo S. Aureus Histidyl-Trna Synthetase Length = 420 Back     alignment and structure
>pdb|1MKY|A Chain A, Structural Analysis Of The Domain Interactions In Der, A Switch Protein Containing Two Gtpase Domains Length = 439 Back     alignment and structure
>pdb|4DUT|A Chain A, The Structure Of Nucleoside Diphosphate Kinase (Ndk) From Burkholderia Thailandensis Length = 145 Back     alignment and structure
>pdb|3VGU|A Chain A, E134a Mutant Nucleoside Diphosphate Kinase Derived From Halomonas Sp. 593 Length = 141 Back     alignment and structure
>pdb|3VGS|A Chain A, Wild-Type Nucleoside Diphosphate Kinase Derived From Halomonas Sp. 593 Length = 141 Back     alignment and structure
>pdb|2NCK|R Chain R, Crystal Structure Of Myxococcus Xanthus Nucleoside Diphosphate Kinase And Its Interaction With A Nucleotide Substrate At 2.0 Angstroms Resolution Length = 144 Back     alignment and structure
>pdb|3PJ9|A Chain A, Crystal Structure Of A Nucleoside Diphosphate Kinase From Campylobacter Jejuni Length = 140 Back     alignment and structure
>pdb|2HUR|A Chain A, Escherichia Coli Nucleoside Diphosphate Kinase Length = 142 Back     alignment and structure
>pdb|2ZUA|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Haloarcula Quadrata Length = 174 Back     alignment and structure
>pdb|3Q83|A Chain A, Crystal Structure Of Staphylococcus Aureus Nucleoside Diphosphate Kinase Length = 157 Back     alignment and structure
>pdb|1WU7|A Chain A, Crystal Structure Of Histidyl-Trna Synthetase From Thermoplasma Acidophilum Length = 434 Back     alignment and structure
>pdb|3JS9|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase Family Protein From Babesia Bovis Length = 156 Back     alignment and structure
>pdb|1WKJ|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Thermus Thermophilus Hb8 Length = 137 Back     alignment and structure
>pdb|3R9L|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Giardia Lamblia Featuring A Disordered Dinucleotide Binding Site Length = 155 Back     alignment and structure
>pdb|3B54|A Chain A, Saccharomyces Cerevisiae Nucleoside Diphosphate Kinase Length = 161 Back     alignment and structure
>pdb|3L7U|A Chain A, Crystal Structure Of Human Nm23-H1 Length = 172 Back     alignment and structure
>pdb|1JXV|A Chain A, Crystal Structure Of Human Nucleoside Diphosphate Kinase A Length = 152 Back     alignment and structure
>pdb|2HVE|A Chain A, S120g Mutant Of Human Nucleoside Diphosphate Kinase A Complexed With Adp Length = 152 Back     alignment and structure
>pdb|1BHN|A Chain A, Nucleoside Diphosphate Kinase Isoform A From Bovine Retina Length = 152 Back     alignment and structure
>pdb|2VU5|A Chain A, Crystal Structure Of Pndk From Bacillus Anthracis Length = 148 Back     alignment and structure
>pdb|1HHQ|A Chain A, Role Of Active Site Resiude Lys16 In Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1NDP|A Chain A, Adenosine 5'-Diphosphate Binding And The Active Site Of Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1NPK|A Chain A, Refined X-Ray Structure Of Dictyostelium Nucleoside Diphosphate Kinase At 1,8 Angstroms Resolution Length = 154 Back     alignment and structure
>pdb|1NCL|A Chain A, Thermal Stability Of Hexameric And Tetrameric Nucleoside, Diphosphate Kinases Length = 150 Back     alignment and structure
>pdb|1XIQ|A Chain A, Plasmodium Falciparum Nucleoside Diphosphate Kinase B Length = 157 Back     alignment and structure
>pdb|3ZTQ|A Chain A, Hexagonal Crystal Form P61 Of The Aquifex Aeolicus Nucleoside Diphosphate Kinase Length = 142 Back     alignment and structure
>pdb|2AZ1|A Chain A, Structure Of A Halophilic Nucleoside Diphosphate Kinase From Halobacterium Salinarum Length = 181 Back     alignment and structure
>pdb|2AZ3|A Chain A, Structure Of A Halophilic Nucleoside Diphosphate Kinase From Halobacterium Salinarum In Complex With Cdp Length = 164 Back     alignment and structure
>pdb|1NDL|A Chain A, The Awd Nucleotide Diphosphate Kinase From Drosophila Length = 153 Back     alignment and structure
>pdb|1NSK|R Chain R, The Crystal Structure Of A Human Nucleoside Diphosphate Kinase, Nm23-H2 Length = 152 Back     alignment and structure
>pdb|2DYK|A Chain A, Crystal Structure Of N-Terminal Gtp-Binding Domain Of Enga From Thermus Thermophilus Hb8 Length = 161 Back     alignment and structure
>pdb|2DYK|A Chain A, Crystal Structure Of N-Terminal Gtp-Binding Domain Of Enga From Thermus Thermophilus Hb8 Length = 161 Back     alignment and structure
>pdb|1NUE|A Chain A, X-ray Structure Of Nm23 Human Nucleoside Diphosphate Kinase B Complexed With Gdp At 2 Angstroms Resolution Length = 151 Back     alignment and structure
>pdb|3DDI|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-N62l-R107g Triple Mutant Complexed With Tdp Length = 146 Back     alignment and structure
>pdb|3EM1|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-N62l Double Mutant Complexed With Dtdp Length = 146 Back     alignment and structure
>pdb|1ZS6|A Chain A, Structure Of Human Nucleoside-diphosphate Kinase 3 Length = 169 Back     alignment and structure
>pdb|1BE4|A Chain A, Nucleoside Diphosphate Kinase Isoform B From Bovine Retina Length = 151 Back     alignment and structure
>pdb|1LWX|A Chain A, Azt Diphosphate Binding To Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1K44|A Chain A, Mycobacterium Tuberculosis Nucleoside Diphosphate Kinase Length = 136 Back     alignment and structure
>pdb|1LEO|A Chain A, P100s Nucleoside Diphosphate Kinase Length = 150 Back     alignment and structure
>pdb|1HLW|A Chain A, Structure Of The H122a Mutant Of The Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1NDK|A Chain A, X-Ray Structure Of Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1B4S|A Chain A, Structure Of Nucleoside Diphosphate Kinase H122g Mutant Length = 155 Back     alignment and structure
>pdb|1NSP|A Chain A, Mechanism Of Phosphate Transfer By Nucleoside Diphosphate Kinase: X- Ray Structures Of A Phospho-Histidine Intermediate Of The Enzymes From Drosophila And Dictyostelium Length = 155 Back     alignment and structure
>pdb|2CWK|A Chain A, Crystal Structure Of Nucleotide Diphosphate Kinase From Pyrococcus Horikoshii Length = 160 Back     alignment and structure
>pdb|3BBC|A Chain A, Crystal Structure Of R88a Mutant Of The Nm23-H2 Transcription Factor Length = 151 Back     alignment and structure
>pdb|1UCN|A Chain A, X-Ray Structure Of Human Nucleoside Diphosphate Kinase A Complexed With Adp At 2 A Resolution Length = 152 Back     alignment and structure
>pdb|1NSQ|A Chain A, Mechanism Of Phosphate Transfer By Nucleoside Diphosphate Kinase: X- Ray Structures Of A Phospho-Histidine Intermediate Of The Enzymes From Drosophila And Dictyostelium Length = 153 Back     alignment and structure
>pdb|1PAE|X Chain X, Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1W7W|A Chain A, Structure And Mutational Analysis Of A Plant Mitochondrial Nucleoside Diphosphate Kinase: Identification Of Residues Involved In Serine Phosphorylation And Oligomerization. Length = 182 Back     alignment and structure
>pdb|3EMT|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-R107g Double Mutant Complexed With Dgdp Length = 146 Back     alignment and structure
>pdb|3EJM|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn Mutant Complexed With Gdp Length = 146 Back     alignment and structure
>pdb|1S57|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From Arabidopsis Length = 153 Back     alignment and structure
>pdb|3PRV|A Chain A, Nucleoside Diphosphate Kinase B From Trypanosoma Cruzi Length = 157 Back     alignment and structure
>pdb|1XZP|A Chain A, Structure Of The Gtp-Binding Protein Trme From Thermotoga Maritima Length = 482 Back     alignment and structure
>pdb|1MN7|A Chain A, Ndp Kinase Mutant (H122g;n119s;f64w) In Complex With Abazttp Length = 155 Back     alignment and structure
>pdb|1PKU|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Rice Length = 150 Back     alignment and structure
>pdb|1EHW|A Chain A, Human Nucleoside Diphosphate Kinase 4 Length = 162 Back     alignment and structure
>pdb|3NGR|A Chain A, Crystal Structure Of Leishmania Nucleoside Diphosphate Kinase B With Unordered Nucleotide-Binding Loop. Length = 151 Back     alignment and structure
>pdb|4FKX|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase B From Trypanosoma Brucei Bound To Cdp Length = 161 Back     alignment and structure
>pdb|4F36|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase B From Trypanosoma Brucei, Apo Form Length = 157 Back     alignment and structure
>pdb|1U8W|A Chain A, Crystal Structure Of Arabidopsis Thaliana Nucleoside Diphosphate Kinase 1 Length = 149 Back     alignment and structure
>pdb|3MPD|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Encephalitozoon Cuniculi, Cubic Form, Apo Length = 151 Back     alignment and structure
>pdb|3HRK|A Chain A, Histidyl-Trna Synthetase From Trypanosoma Cruzi (Histidyl-Adenylate Complex) Length = 456 Back     alignment and structure
>pdb|3GEH|A Chain A, Crystal Structure Of Mnme From Nostoc In Complex With Gdp, Folinic Acid And Zn Length = 462 Back     alignment and structure
>pdb|3OD1|A Chain A, The Crystal Structure Of An Atp Phosphoribosyltransferase Regulatory SubunitHISTIDYL-Trna Synthetase From Bacillus Halodurans C Length = 400 Back     alignment and structure
>pdb|3FBE|A Chain A, Crystal Structure Of The Mimivirus Ndk N62l-R107g Double Mutant Complexed With Gdp Length = 142 Back     alignment and structure
>pdb|3FBF|A Chain A, Crystal Structure Of The Mimivirus Ndk N62l Mutant Complexed With Dtdp Length = 142 Back     alignment and structure
>pdb|3NET|A Chain A, Crystal Structure Of Histidyl-Trna Synthetase From Nostoc Sp. Pcc 7120 Length = 465 Back     alignment and structure
>pdb|3HRI|A Chain A, Histidyl-Trna Synthetase (Apo) From Trypanosoma Brucei Length = 456 Back     alignment and structure
>pdb|3GEE|A Chain A, Crystal Structure Of Mnme From Chlorobium Tepidum In Complex With Gdp And Folinic Acid Length = 476 Back     alignment and structure
>pdb|3EVW|A Chain A, Crystal Structure Of The Mimivirus Ndk R107g Mutant Complexed With Dtdp Length = 142 Back     alignment and structure
>pdb|2B8P|A Chain A, Crystal Structure Of Acanthamoeba Polyphaga Mimivirus Ndk, The First Viral Nucleoside Diphosphate Kinase Length = 157 Back     alignment and structure
>pdb|2B8Q|A Chain A, X-Ray Structure Of Acanthamoeba Ployphaga Mimivirus Nucleoside Diphosphate Kinase Complexed With Tdp Length = 142 Back     alignment and structure
>pdb|1NB2|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Bacillus Halodenitrificans Length = 150 Back     alignment and structure
>pdb|3IEV|A Chain A, Crystal Structure Of Era In Complex With Mggnp And The 3' End Of 16s Rrna Length = 308 Back     alignment and structure
>pdb|3R9W|A Chain A, Crystal Structure Of Era In Complex With Mggdpnp And Nucleotides 1506- 1542 Of 16s Ribosomal Rna Length = 307 Back     alignment and structure
>pdb|4DI6|A Chain A, Crystal Structure Of Nucleoside-Diphosphate Kinase From Borrelia Burgdorferi Length = 190 Back     alignment and structure
>pdb|1RFL|A Chain A, Nmr Data Driven Structural Model Of G-Domain Of Mnme Protein Length = 172 Back     alignment and structure
>pdb|1XQI|A Chain A, Crystal Structure Analysis Of An Ndp Kinase From Pyrobaculum Aerophilum Length = 195 Back     alignment and structure
>pdb|2GJ9|A Chain A, Structure Of The Mnme G-Domain In Complex With GdpAlf4-, Mg2+ And Rb+ Length = 172 Back     alignment and structure
>pdb|2GJ8|A Chain A, Structure Of The Mnme G-domain In Complex With Gdp*alf4-, Mg2+ And K+ Length = 172 Back     alignment and structure
>pdb|4G85|A Chain A, Crystal Structure Of Human Hisrs Length = 517 Back     alignment and structure
>pdb|4G84|A Chain A, Crystal Structure Of Human Hisrs Length = 464 Back     alignment and structure
>pdb|1WF3|A Chain A, Crystal Structure Of Gtp-Binding Protein Tt1341 From Thermus Thermophilus Hb8 Length = 301 Back     alignment and structure
>pdb|1X18|X Chain X, Contact Sites Of Era Gtpase On The Thermus Thermophilus 30s Subunit Length = 292 Back     alignment and structure
>pdb|1EGA|A Chain A, Crystal Structure Of A Widely Conserved Gtpase Era Length = 301 Back     alignment and structure
>pdb|2WJG|A Chain A, Structure And Function Of The Feob G-Domain From Methanococcus Jannaschii Length = 188 Back     alignment and structure
>pdb|2WJH|A Chain A, Structure And Function Of The Feob G-Domain From Methanococcus Jannaschii Length = 166 Back     alignment and structure
>pdb|2WJI|A Chain A, Structure And Function Of The Feob G-Domain From Methanococcus Jannaschii Length = 165 Back     alignment and structure
>pdb|2WJJ|A Chain A, Structure And Function Of The Feob G-Domain From Methanococcus Jannaschii Length = 168 Back     alignment and structure
>pdb|1Z7M|A Chain A, Atp Phosphoribosyl Transferase (hiszg Atp-prtase) From Lactococcus Lactis Length = 344 Back     alignment and structure
>pdb|3IBY|A Chain A, Structure Of Cytosolic Domain Of L. Pneumophila Feob Length = 256 Back     alignment and structure
>pdb|3K53|A Chain A, Crystal Structure Of Nfeob From P. Furiosus Length = 271 Back     alignment and structure
>pdb|3K53|A Chain A, Crystal Structure Of Nfeob From P. Furiosus Length = 271 Back     alignment and structure
>pdb|3QQ5|A Chain A, Crystal Structure Of The [fefe]-Hydrogenase Maturation Protein Hydf Length = 423 Back     alignment and structure
>pdb|2DWQ|A Chain A, Thermus Thermophilus Ychf Gtp-Binding Protein Length = 368 Back     alignment and structure
>pdb|2DBY|A Chain A, Crystal Structure Of The Gtp-Binding Protein Ychf In Complexed With Gdp Length = 368 Back     alignment and structure
>pdb|3A1W|A Chain A, Crystal Structue Of The G Domain Of T. Maritima Feob Iron Iransporter Length = 168 Back     alignment and structure
>pdb|2E87|A Chain A, Crystal Structure Of Hypothetical Gtp-Binding Protein Ph1320 From Pyrococcus Horikoshii Ot3, In Complex With Gdp Length = 357 Back     alignment and structure
>pdb|3A1T|A Chain A, Crystal Structue Of The Cytosolic Domain Of T. Maritima Feob Iron Iransporter In Gdp Form Ii Length = 258 Back     alignment and structure
>pdb|3A1S|A Chain A, Crystal Structue Of The Cytosolic Domain Of T. Maritima Feob Iron Iransporter In Gdp Form I Length = 258 Back     alignment and structure
>pdb|3HYT|A Chain A, Structural Basis Of Gdp Release And Gating In G Protein Coupled Fe2+ Transport Length = 270 Back     alignment and structure
>pdb|3HYR|A Chain A, Structural Insight Into G Protein Coupling And Regulation Of Fe2+ Membrane Transport Length = 270 Back     alignment and structure
>pdb|3I8S|A Chain A, Structure Of The Cytosolic Domain Of E. Coli Feob, Nucleotide-Free Form Length = 274 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1250
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 0.0
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 0.0
4e51_A467 Histidine--tRNA ligase; seattle structural genomic 0.0
1htt_A423 Histidyl-tRNA synthetase; complex (tRNA synthetase 1e-175
1qe0_A420 Histidyl-tRNA synthetase; class II tRNA synthetase 1e-173
3rfa_A404 Ribosomal RNA large subunit methyltransferase N; r 1e-173
1h4v_B421 Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA 1e-172
1wu7_A434 Histidyl-tRNA synthetase; ligase, structural genom 1e-128
1z7m_A344 ATP phosphoribosyltransferase regulatory subunit; 1e-121
3od1_A400 ATP phosphoribosyltransferase regulatory subunit; 8e-95
3lc0_A456 Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-t 2e-91
3rac_A373 Histidine-tRNA ligase; structural genomics, PSI-bi 4e-75
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 1e-69
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 2e-31
3net_A465 Histidyl-tRNA synthetase; aminoacyl-tRNA synthetas 1e-58
4ek2_A145 Nucleoside diphosphate kinase; seattle structural 2e-50
1usy_A275 ATP phosphoribosyltransferase regulatory subunit; 3e-50
2hur_A142 NDK, nucleoside diphosphate kinase, NDP kinase; ty 4e-50
1nhk_R144 Nucleoside diphosphate kinase; phosphotransferase; 5e-50
1wkj_A137 Nucleoside diphosphate kinase; thermus thermophilu 1e-49
3mpd_A151 Nucleoside diphosphate kinase; ssgcid, NIH, niaid, 3e-49
1nb2_A150 Nucleoside diphosphate kinase; bacillus halodenitr 3e-49
2az3_A164 Nucleoside diphosphate kinase; halophilic, transfe 3e-49
3q8u_A157 Nucleoside diphosphate kinase; ferridoxin fold, al 4e-49
3fkb_A155 NDP kinase, NDK, nucleoside diphosphate kinase, cy 5e-49
1ehw_A162 NDPK H4, nucleoside diphosphate kinase; NM23, mito 5e-49
2vu5_A148 Nucleoside diphosphate kinase; nucleotide-binding, 7e-49
3r9l_A155 Nucleoside diphosphate kinase; structural genomics 7e-49
4fkx_A161 NDK B, nucleoside diphosphate kinase; structural g 1e-48
1w7w_A182 Nucleoside diphosphate kinase; NDPK3, transferase; 1e-48
1k44_A136 Nucleoside diphosphate kinase; nucleoside triphosp 1e-48
1pku_A150 Nucleoside diphosphate kinase I; RICE, transferase 1e-48
1s57_A153 Nucleoside diphosphate kinase II; transferase; HET 2e-48
3evo_A146 NDP kinase, NDK, nucleoside diphosphate kinase; ph 2e-48
3js9_A156 Nucleoside diphosphate kinase family protein; niai 2e-48
3ztp_A142 Nucleoside diphosphate kinase; transferase; HET: G 3e-48
3bbb_A151 Nucleoside diphosphate kinase B; transcription fac 3e-48
1u8w_A149 Nucleoside diphosphate kinase I; nucleotide diphos 3e-48
1zs6_A169 Nucleoside diphosphate kinase 3; nucleotide metabo 3e-48
3b54_A161 NDK, NDP kinase, nucleoside diphosphate kinase; al 3e-48
1xiq_A157 Nucleoside diphosphate kinase B; protein structure 5e-48
3l7u_A172 Nucleoside diphosphate kinase A; ATP-binding, nucl 5e-48
2dxe_A160 Nucleoside diphosphate kinase; nucleoside binding, 3e-47
4dz6_A190 Nucleoside diphosphate kinase; ssgcid, niaid, vana 8e-44
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 1e-37
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 7e-27
1xqi_A195 Nucleoside diphosphate kinase; alpha/beta sandwich 2e-35
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 9e-34
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 3e-22
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 3e-32
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 5e-28
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 6e-31
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 8e-22
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 1e-30
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 1e-23
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 1e-30
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 1e-22
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 3e-27
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 1e-12
3qtc_A290 Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthet 4e-27
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 2e-24
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 2e-05
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 1e-21
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 3e-20
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 2e-21
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 3e-20
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 3e-21
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 1e-19
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 6e-20
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 1e-08
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 5e-18
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 7e-10
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-15
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
2wji_A165 Ferrous iron transport protein B homolog; membrane 2e-15
2wji_A165 Ferrous iron transport protein B homolog; membrane 5e-08
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 6e-15
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 2e-07
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 7e-15
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 7e-08
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 1e-14
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 8e-08
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 4e-14
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 5e-06
3iby_A256 Ferrous iron transport protein B; G protein, G dom 4e-13
3iby_A256 Ferrous iron transport protein B; G protein, G dom 9e-09
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 6e-13
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 1e-06
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 7e-13
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 9e-07
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 9e-13
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 2e-04
3cnl_A262 YLQF, putative uncharacterized protein; circular p 2e-12
3cnl_A262 YLQF, putative uncharacterized protein; circular p 4e-07
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 1e-11
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 3e-07
3lxx_A239 GTPase IMAP family member 4; structural genomics c 1e-11
3lxx_A239 GTPase IMAP family member 4; structural genomics c 5e-08
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 7e-11
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 9e-06
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 9e-11
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 2e-07
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 2e-10
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 2e-07
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 4e-10
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 4e-06
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 5e-10
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 2e-09
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 1e-07
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 2e-09
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 1e-05
3lxw_A247 GTPase IMAP family member 1; immunity, structural 2e-09
3lxw_A247 GTPase IMAP family member 1; immunity, structural 3e-04
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 1e-07
1wxq_A397 GTP-binding protein; structural genomics, riken st 3e-07
1wxq_A397 GTP-binding protein; structural genomics, riken st 1e-04
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 5e-07
1jal_A363 YCHF protein; nucleotide-binding fold, structural 2e-06
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 3e-06
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 5e-06
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 6e-04
3dsq_A288 Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-t 8e-06
2j69_A695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 6e-05
2j69_A695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 7e-04
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 8e-04
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Length = 436 Back     alignment and structure
 Score =  552 bits (1425), Expect = 0.0
 Identities = 148/430 (34%), Positives = 257/430 (59%), Gaps = 12/430 (2%)

Query: 2   KPVLVLVGRPNVGKSTLFNRLTNSRDALVANYPGLTRDRHYGEGYIGKKSFIIIDTGGFE 61
           KPV+ +VGRPNVGKST+FNR+   R ++V + PG+TRDR Y         F +IDTGG +
Sbjct: 3   KPVVAIVGRPNVGKSTIFNRIAGERISIVEDTPGVTRDRIYSSAEWLNYDFNLIDTGGID 62

Query: 62  PEVKKGIMHEMTKQTKQAIIESDIIIFIVDGRQGLVEQDKLITNFLRKSGQPIVLVINKS 121
               +  + ++ +Q + A+ E+D+IIF+V+GR+G+   D+ +   L ++ +P+VL +NK 
Sbjct: 63  IG-DEPFLAQIRQQAEIAMDEADVIIFMVNGREGVTAADEEVAKILYRTKKPVVLAVNKL 121

Query: 122 ENINSSISL-DFYELGIGNPHIISALYGNGIKNFLENILTIELPYKKFFKKKEFTNIHSI 180
           +N     ++ DFY LG G P+ IS  +G G+ + L+ +        + FK    T  +  
Sbjct: 122 DNTEMRANIYDFYSLGFGEPYPISGTHGLGLGDLLDAVA-------EHFKNIPETKYNE- 173

Query: 181 EYIKVAIVGKPNVGKSTLINSLLGENRVITYDTPGTTRDSIKSLFEYNNKKYILIDTAGI 240
           E I+  ++G+PNVGKS+L+N++LGE RVI  +  GTTRD++ + F YN ++++++DTAG+
Sbjct: 174 EVIQFCLIGRPNVGKSSLVNAMLGEERVIVSNVAGTTRDAVDTSFTYNQQEFVIVDTAGM 233

Query: 241 RRRNKTFEVIEKFSVIKTLKSILEANVVILLLDAQQNISAQDINIANFIYESGRSLIVCV 300
           R++ K +E  EK+SV++ LK+I  + VV ++LD ++ I  QD  IA + +E+G+++++ V
Sbjct: 234 RKKGKVYETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGYAHEAGKAVVIVV 293

Query: 301 NKWDSIIHNQRKI--IKNNIKKKLNFLSFAMFNFISAIKLNNINSFMESINHVYDSSIIH 358
           NKWD++  ++  +   + NI+    FL +A   F+SA+    I++ M +I    ++  + 
Sbjct: 294 NKWDAVDKDESTMKEFEENIRDHFQFLDYAPILFMSALTKKRIHTLMPAIIKASENHSLR 353

Query: 359 LSTSRITRALISAIKNHPPCRKKLIRPKLRYAHQGGKNPPIIVIHGNRLKYIGNDYKRYL 418
           + T+ +   ++ A+  +P       R K+ YA Q    PP  V+  N  + +   Y+R+L
Sbjct: 354 VQTNVLNDVIMDAVAMNPTPTHNGSRLKIYYATQVSVKPPSFVVFVNDPELMHFSYERFL 413

Query: 419 EKYFYRTFSL 428
           E      F  
Sbjct: 414 ENRIRDAFGF 423


>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Length = 439 Back     alignment and structure
>4e51_A Histidine--tRNA ligase; seattle structural genomics center for infectious disease, S aminoacylation, tRNA activation, charged tRNA; HET: HIS; 2.65A {Burkholderia thailandensis} Length = 467 Back     alignment and structure
>1htt_A Histidyl-tRNA synthetase; complex (tRNA synthetase/His-adenylate), aminoacyl-tRNA synthase, ligase; HET: HIS AMP; 2.60A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1kmm_A* 1kmn_A* 2el9_A* Length = 423 Back     alignment and structure
>1qe0_A Histidyl-tRNA synthetase; class II tRNA synthetase, beta sheet, ligase; 2.70A {Staphylococcus aureus} SCOP: c.51.1.1 d.104.1.1 Length = 420 Back     alignment and structure
>3rfa_A Ribosomal RNA large subunit methyltransferase N; radical SAM, S-adenosylmethionine, iron sulfur cluster, oxidoreductase; HET: SAM; 2.05A {Escherichia coli} PDB: 3rf9_A* Length = 404 Back     alignment and structure
>1h4v_B Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA synthetase, ATP + L-histidine tRNA(His)-> AMP + PPI + L-histidyl-tRNA(His); 2.4A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1ady_A* 1adj_A Length = 421 Back     alignment and structure
>1wu7_A Histidyl-tRNA synthetase; ligase, structural genomics, dimer; 2.40A {Thermoplasma acidophilum} SCOP: c.51.1.1 d.104.1.1 Length = 434 Back     alignment and structure
>1z7m_A ATP phosphoribosyltransferase regulatory subunit; ATP-PRT, histidine biosynthesis, hiszg, alloste evolution; 2.90A {Lactococcus lactis} SCOP: d.104.1.1 PDB: 1z7n_A* Length = 344 Back     alignment and structure
>3od1_A ATP phosphoribosyltransferase regulatory subunit; structural genomics, PSI-2, protein structure initiative; 1.97A {Bacillus halodurans} Length = 400 Back     alignment and structure
>3lc0_A Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-tRNA synthetase, ligase, structural G medical structural genomics of pathogenic protozoa; HET: HIS; 1.80A {Trypanosoma cruzi} PDB: 3hrk_A* 3hri_A Length = 456 Back     alignment and structure
>3rac_A Histidine-tRNA ligase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, PSI-BIO; 2.30A {Alicyclobacillus acidocaldarius subsp} Length = 373 Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Length = 161 Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Length = 161 Back     alignment and structure
>3net_A Histidyl-tRNA synthetase; aminoacyl-tRNA synthetase, ligase, structural genomics, PSI- nostoc, protein structure initiative; 2.70A {Nostoc SP} Length = 465 Back     alignment and structure
>4ek2_A Nucleoside diphosphate kinase; seattle structural genomics center for infectious disease, S DAMP, niaid; HET: DA; 2.00A {Burkholderia thailandensis} PDB: 4dut_A* Length = 145 Back     alignment and structure
>1usy_A ATP phosphoribosyltransferase regulatory subunit; aminoacyl-tRNA synthetase; HET: HIS; 2.52A {Thermotoga maritima} SCOP: d.104.1.1 PDB: 1usy_C* Length = 275 Back     alignment and structure
>2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} Length = 142 Back     alignment and structure
>1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R 3pj9_A Length = 144 Back     alignment and structure
>1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* Length = 137 Back     alignment and structure
>3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} Length = 151 Back     alignment and structure
>1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 Length = 150 Back     alignment and structure
>2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A Length = 164 Back     alignment and structure
>3q8u_A Nucleoside diphosphate kinase; ferridoxin fold, alpha-beta protein family; HET: ADP; 2.22A {Staphylococcus aureus subsp} PDB: 3q83_A* 3q89_A* 3q86_A* 3q8v_A* 3q8y_A* Length = 157 Back     alignment and structure
>3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, magnesium, metal- nucleotide metabolism; HET: TNM TNV; 1.65A {Dictyostelium discoideum} PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... Length = 155 Back     alignment and structure
>1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer-O transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 Length = 162 Back     alignment and structure
>2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} Length = 148 Back     alignment and structure
>3r9l_A Nucleoside diphosphate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, giardiasis; 2.65A {Giardia lamblia} Length = 155 Back     alignment and structure
>4fkx_A NDK B, nucleoside diphosphate kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CDP; 1.70A {Trypanosoma brucei brucei} PDB: 4fky_A* 4f4a_A* 4f36_A* 3prv_A 3ngs_A 3ngr_A 3ngt_A* 3ngu_A* Length = 161 Back     alignment and structure
>1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 Length = 182 Back     alignment and structure
>1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 Length = 136 Back     alignment and structure
>1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 Length = 150 Back     alignment and structure
>1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* Length = 153 Back     alignment and structure
>3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... Length = 146 Back     alignment and structure
>3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, babesiosis; 2.50A {Babesia bovis} Length = 156 Back     alignment and structure
>3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A Length = 142 Back     alignment and structure
>3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* Length = 151 Back     alignment and structure
>1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 Length = 149 Back     alignment and structure
>1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, struc genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 Length = 169 Back     alignment and structure
>3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, magnesium, metal-B mitochondrion; 3.10A {Saccharomyces cerevisiae} Length = 161 Back     alignment and structure
>1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP; 3.05A {Plasmodium falciparum} SCOP: d.58.6.1 Length = 157 Back     alignment and structure
>3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} Length = 172 Back     alignment and structure
>2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* Length = 160 Back     alignment and structure
>4dz6_A Nucleoside diphosphate kinase; ssgcid, niaid, vanada transition state mimic, transition state analog, transferas; HET: ADP; 2.20A {Borrelia burgdorferi} PDB: 4di6_A* Length = 190 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Length = 190 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Length = 190 Back     alignment and structure
>1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 Length = 195 Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Length = 482 Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Length = 482 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Length = 423 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Length = 423 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Length = 476 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Length = 476 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Length = 172 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Length = 172 Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Length = 462 Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Length = 462 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Length = 262 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Length = 262 Back     alignment and structure
>3qtc_A Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP B O-methyl tyrosine binding, magnesium binding, aminoacylatio esterification; HET: 0A1 ANP; 1.75A {Methanosarcina mazei} PDB: 2q7e_A* 2q7g_A* 2q7h_A* 2zim_A* 2zin_A* 2e3c_A* 2zcd_A* 2zce_A* 2zio_A* Length = 290 Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Length = 368 Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Length = 368 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Length = 301 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Length = 301 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Length = 308 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Length = 308 Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Length = 301 Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Length = 301 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Length = 270 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Length = 270 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Length = 413 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Length = 413 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Length = 165 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Length = 165 Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Length = 274 Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Length = 274 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Length = 258 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Length = 258 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Length = 188 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Length = 188 Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Length = 282 Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Length = 282 Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Length = 256 Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Length = 256 Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Length = 272 Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Length = 272 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Length = 271 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Length = 271 Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Length = 369 Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Length = 369 Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Length = 262 Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Length = 262 Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Length = 195 Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Length = 195 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Length = 239 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Length = 239 Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Length = 195 Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Length = 195 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Length = 228 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Length = 228 Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Length = 364 Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Length = 364 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Length = 210 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Length = 210 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Length = 357 Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Length = 223 Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Length = 223 Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Length = 260 Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Length = 260 Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Length = 392 Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Length = 397 Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Length = 397 Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Length = 368 Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Length = 363 Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Length = 396 Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 434 Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 434 Back     alignment and structure
>3dsq_A Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-tRNA synthetase, ligase; 2.10A {Desulfitobacterium hafniense} PDB: 2znj_A 2zni_A Length = 288 Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Length = 695 Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Length = 695 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Length = 550 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1250
3rfa_A404 Ribosomal RNA large subunit methyltransferase N; r 100.0
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 100.0
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 100.0
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 100.0
4e51_A467 Histidine--tRNA ligase; seattle structural genomic 100.0
3lc0_A456 Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-t 100.0
1h4v_B421 Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA 100.0
3net_A465 Histidyl-tRNA synthetase; aminoacyl-tRNA synthetas 100.0
1htt_A423 Histidyl-tRNA synthetase; complex (tRNA synthetase 100.0
4g85_A517 Histidine-tRNA ligase, cytoplasmic; synthetase; 3. 100.0
1wu7_A434 Histidyl-tRNA synthetase; ligase, structural genom 100.0
4g84_A464 Histidine--tRNA ligase, cytoplasmic; synthetase; 2 100.0
1qe0_A420 Histidyl-tRNA synthetase; class II tRNA synthetase 100.0
3od1_A400 ATP phosphoribosyltransferase regulatory subunit; 100.0
3rac_A373 Histidine-tRNA ligase; structural genomics, PSI-bi 100.0
1z7m_A344 ATP phosphoribosyltransferase regulatory subunit; 100.0
2j3l_A572 Prolyl-tRNA synthetase; class II aminoacyl- T synt 100.0
1evl_A401 Threonyl-tRNA synthetase; amino acid recognition, 100.0
1usy_A275 ATP phosphoribosyltransferase regulatory subunit; 100.0
2i4l_A458 Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseud 100.0
1nyr_A645 Threonyl-tRNA synthetase 1; ATP, threonine, ligase 100.0
1qf6_A642 THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, m 100.0
3a32_A471 Probable threonyl-tRNA synthetase 1; aeropyrum per 100.0
3uh0_A460 Threonyl-tRNA synthetase, mitochondrial; threonine 100.0
1hc7_A477 Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, 100.0
1nj8_A459 Proline-tRNA synthetase, proline--tRNA ligase; cla 100.0
2zt5_A693 Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP 100.0
1nj1_A501 PROR, proline-tRNA synthetase, proline--tRNA ligas 100.0
4hr2_A145 Nucleoside diphosphate kinase; ssgcid, seattle str 99.97
3evo_A146 NDP kinase, NDK, nucleoside diphosphate kinase; ph 99.96
3mpd_A151 Nucleoside diphosphate kinase; ssgcid, NIH, niaid, 99.96
4fkx_A161 NDK B, nucleoside diphosphate kinase; structural g 99.96
3q8u_A157 Nucleoside diphosphate kinase; ferridoxin fold, al 99.96
1wkj_A137 Nucleoside diphosphate kinase; thermus thermophilu 99.96
3fkb_A155 NDP kinase, NDK, nucleoside diphosphate kinase, cy 99.96
1k44_A136 Nucleoside diphosphate kinase; nucleoside triphosp 99.96
1nhk_R144 Nucleoside diphosphate kinase; phosphotransferase; 99.96
3ztp_A142 Nucleoside diphosphate kinase; transferase; HET: G 99.96
3l7u_A172 Nucleoside diphosphate kinase A; ATP-binding, nucl 99.96
2hur_A142 NDK, nucleoside diphosphate kinase, NDP kinase; ty 99.96
2vu5_A148 Nucleoside diphosphate kinase; nucleotide-binding, 99.96
1pku_A150 Nucleoside diphosphate kinase I; RICE, transferase 99.96
1u8w_A149 Nucleoside diphosphate kinase I; nucleotide diphos 99.96
1xiq_A157 Nucleoside diphosphate kinase B; protein structure 99.96
2yx0_A342 Radical SAM enzyme; predicted tRNA modification en 99.96
1ehw_A162 NDPK H4, nucleoside diphosphate kinase; NM23, mito 99.96
3js9_A156 Nucleoside diphosphate kinase family protein; niai 99.96
1nb2_A150 Nucleoside diphosphate kinase; bacillus halodenitr 99.96
3r9l_A155 Nucleoside diphosphate kinase; structural genomics 99.96
3bbb_A151 Nucleoside diphosphate kinase B; transcription fac 99.96
1s57_A153 Nucleoside diphosphate kinase II; transferase; HET 99.96
1zs6_A169 Nucleoside diphosphate kinase 3; nucleotide metabo 99.95
1w7w_A182 Nucleoside diphosphate kinase; NDPK3, transferase; 99.95
2az3_A164 Nucleoside diphosphate kinase; halophilic, transfe 99.95
3b54_A161 NDK, NDP kinase, nucleoside diphosphate kinase; al 99.95
1ati_A505 Glycyl-tRNA synthetase; protein biosynthesis, liga 99.95
2dxe_A160 Nucleoside diphosphate kinase; nucleoside binding, 99.95
4hvc_A 519 Bifunctional glutamate/proline--tRNA ligase; ligas 99.95
4dz6_A190 Nucleoside diphosphate kinase; ssgcid, niaid, vana 99.95
3ial_A 518 Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, 99.94
1xqi_A195 Nucleoside diphosphate kinase; alpha/beta sandwich 99.93
2z2u_A311 UPF0026 protein MJ0257; metal binding protein; 2.4 99.9
3c8f_A245 Pyruvate formate-lyase 1-activating enzyme; adoMet 99.87
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.87
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 99.87
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.86
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.86
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 99.85
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.85
3ikl_A459 DNA polymerase subunit gamma-2, mitochondrial; tra 99.85
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.85
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.84
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.84
1g5h_A454 Mitochondrial DNA polymerase accessory subunit; in 99.84
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 99.83
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.83
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.83
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.83
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.83
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.83
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.83
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.82
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.82
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 99.82
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.82
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 99.82
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.81
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.81
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.8
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.8
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.8
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 99.8
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 99.8
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.79
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.79
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 99.79
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.79
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.79
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 99.79
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.78
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.78
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 99.78
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.78
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.78
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.78
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.78
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.78
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.78
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.77
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.77
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.77
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.77
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.77
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.77
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.77
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.76
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.76
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.76
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.76
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.76
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.76
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.76
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.76
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.76
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.76
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.76
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.76
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.75
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.75
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 99.75
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.75
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.75
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.75
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.75
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.75
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.75
3can_A182 Pyruvate-formate lyase-activating enzyme; structur 99.75
1wb1_A482 Translation elongation factor SELB; selenocysteine 99.75
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.75
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.75
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.75
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.74
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.74
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 99.74
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.74
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 99.74
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.74
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.74
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.74
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.74
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.74
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.74
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.74
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.74
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.74
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.74
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.74
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.74
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.74
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.74
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.74
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.73
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.73
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.73
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.73
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.73
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.73
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.73
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.73
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.73
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.73
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 99.73
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.73
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.73
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.73
1f60_A458 Elongation factor EEF1A; protein-protein complex, 99.73
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.73
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.73
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.73
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.73
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.73
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.73
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 99.73
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.73
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.73
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.72
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.72
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.72
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.72
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.72
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.72
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.72
3lxx_A239 GTPase IMAP family member 4; structural genomics c 99.72
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.72
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.72
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.72
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.72
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.72
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.72
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.72
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.72
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.72
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.72
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.72
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.72
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.72
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.72
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.72
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.71
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 99.71
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.71
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.71
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.71
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.71
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.71
2elf_A370 Protein translation elongation factor 1A; tRNA, py 99.71
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.71
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.71
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.71
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.71
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.71
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.71
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.71
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.71
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.71
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.71
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.71
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.71
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.71
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.71
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.71
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.71
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.71
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.71
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.71
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.71
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.71
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.71
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.71
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.71
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.71
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.7
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.7
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.7
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.7
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.7
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.7
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.7
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.7
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.7
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.7
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.7
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.7
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.7
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.7
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 99.7
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.7
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.7
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.7
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.7
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.7
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.7
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.7
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.7
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.7
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 99.7
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 99.7
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.7
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.69
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.69
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.69
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.69
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.69
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.69
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.69
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.69
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 99.69
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.69
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.69
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.69
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 99.69
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.69
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.69
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.69
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.69
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.69
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.69
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.69
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.69
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.69
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.68
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 99.68
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 99.68
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.68
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.68
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.68
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.68
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.68
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 99.68
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.68
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.68
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.68
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.68
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.67
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.67
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.67
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 99.67
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 99.67
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.67
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.67
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.67
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 99.67
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.67
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 99.67
2ywe_A600 GTP-binding protein LEPA; G domain, beta-barrel, f 99.67
3cb4_D599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.67
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.67
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.67
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.66
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.66
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.66
3izy_P537 Translation initiation factor IF-2, mitochondrial; 99.66
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.66
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.66
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.66
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.66
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.66
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.47
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.65
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.65
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.65
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.65
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.65
3cb4_D599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.65
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.65
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.65
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.65
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.65
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.65
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.65
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.65
3cnl_A262 YLQF, putative uncharacterized protein; circular p 99.65
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.65
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.65
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.65
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.65
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.64
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.64
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.64
3zvr_A772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 99.64
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.64
3izy_P537 Translation initiation factor IF-2, mitochondrial; 99.64
3avx_A1289 Elongation factor TS, elongation factor TU, linke 99.64
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 99.64
1wb1_A482 Translation elongation factor SELB; selenocysteine 99.64
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.64
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.64
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.64
3bh7_B352 Protein XRP2; protein-protein complex, GTPase acti 99.63
3lxx_A239 GTPase IMAP family member 4; structural genomics c 99.63
1wxq_A397 GTP-binding protein; structural genomics, riken st 99.62
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.62
2h5e_A529 Peptide chain release factor RF-3; beta barrel, tr 99.62
1g7s_A594 Translation initiation factor IF2/EIF5B; translati 99.61
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 99.61
1zo1_I501 IF2, translation initiation factor 2; E. coli, rib 99.61
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 99.61
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.61
2j69_A695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.6
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 99.6
2xex_A693 Elongation factor G; GTPase, translation, biosynth 99.59
1wxq_A397 GTP-binding protein; structural genomics, riken st 99.59
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.59
3vqt_A548 RF-3, peptide chain release factor 3; translation, 99.59
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 99.59
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 99.59
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.37
2ywe_A600 GTP-binding protein LEPA; G domain, beta-barrel, f 99.58
2a5h_A416 L-lysine 2,3-aminomutase; radical SAM, four-iron-f 99.58
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 99.58
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 99.58
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 99.58
1dar_A691 EF-G, elongation factor G; ribosomal translocase, 99.57
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.57
2elf_A370 Protein translation elongation factor 1A; tRNA, py 99.57
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.57
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 99.57
3iix_A348 Biotin synthetase, putative; adoMet radical, SAM r 99.56
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 99.56
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 99.56
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.56
1zo1_I501 IF2, translation initiation factor 2; E. coli, rib 99.56
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.56
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.56
2rdo_7704 EF-G, elongation factor G; elongation factor G, EF 99.55
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 99.55
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.55
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 99.54
3t7v_A350 Methylornithine synthase PYLB; TIM-barrel fold, mu 99.54
3dpu_A535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.54
3zvr_A772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 99.53
2dy1_A665 Elongation factor G; translocation, GTP complex, s 99.53
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 99.53
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.52
2www_A349 Methylmalonic aciduria type A protein, mitochondri 99.52
1g7s_A594 Translation initiation factor IF2/EIF5B; translati 99.52
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.52
1f60_A458 Elongation factor EEF1A; protein-protein complex, 99.52
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.51
3avx_A1289 Elongation factor TS, elongation factor TU, linke 99.5
2h5e_A529 Peptide chain release factor RF-3; beta barrel, tr 99.5
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 99.49
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.49
2j69_A695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.49
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.49
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 99.48
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 99.48
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 99.48
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.48
3j25_A638 Tetracycline resistance protein TETM; antibiotic r 99.48
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 99.48
3dpu_A535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.48
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.47
1tv8_A340 MOAA, molybdenum cofactor biosynthesis protein A; 99.47
1nrj_B218 SR-beta, signal recognition particle receptor beta 99.47
1dar_A691 EF-G, elongation factor G; ribosomal translocase, 99.47
2xex_A693 Elongation factor G; GTPase, translation, biosynth 99.47
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 99.45
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 99.45
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 99.45
2ged_A193 SR-beta, signal recognition particle receptor beta 99.45
1n0u_A842 EF-2, elongation factor 2; G-protein, CIS-proline, 99.44
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 99.43
1jal_A363 YCHF protein; nucleotide-binding fold, structural 99.43
2rdo_7704 EF-G, elongation factor G; elongation factor G, EF 99.43
1jal_A363 YCHF protein; nucleotide-binding fold, structural 99.43
1nrj_B218 SR-beta, signal recognition particle receptor beta 99.42
4fn5_A709 EF-G 1, elongation factor G 1; translation, transl 99.42
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 99.41
2dy1_A665 Elongation factor G; translocation, GTP complex, s 99.41
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 99.4
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 99.39
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 99.38
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 99.38
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 99.37
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 99.36
3vqt_A548 RF-3, peptide chain release factor 3; translation, 99.36
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 99.35
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 99.35
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 99.34
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 99.34
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 99.33
2ged_A193 SR-beta, signal recognition particle receptor beta 99.32
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 99.32
1v95_A130 Nuclear receptor coactivator 5; coactivator indepe 99.31
2www_A349 Methylmalonic aciduria type A protein, mitochondri 99.31
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 99.28
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 99.28
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 99.26
2dq3_A425 Seryl-tRNA synthetase; coiled-coil, homodimer, str 99.25
1r30_A369 Biotin synthase; SAM radical protein, TIM barrel, 99.23
3j25_A638 Tetracycline resistance protein TETM; antibiotic r 99.22
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 99.22
3dsq_A288 Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-t 99.21
2qgq_A304 Protein TM_1862; alpha-beta protein, structural ge 99.2
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 99.18
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 99.17
2dq0_A455 Seryl-tRNA synthetase; coiled-coil, homodimer, str 99.13
1n0u_A842 EF-2, elongation factor 2; G-protein, CIS-proline, 99.12
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 99.12
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 99.11
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 99.1
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 99.1
4fn5_A709 EF-G 1, elongation factor G 1; translation, transl 99.1
2hf9_A226 Probable hydrogenase nickel incorporation protein 99.09
1ses_A421 Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A 99.08
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 99.07
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 99.06
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 99.05
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 99.05
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 99.01
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 99.01
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 98.99
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 98.99
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 98.93
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 98.92
3qtc_A290 Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthet 98.92
1nnh_A294 Asparaginyl-tRNA synthetase-related peptide; struc 98.91
2cja_A522 Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE 98.91
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 98.88
3vbb_A522 Seryl-tRNA synthetase, cytoplasmic; coiled-coil, l 98.87
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 98.86
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 98.85
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 98.82
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 98.82
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 98.81
1wle_A501 Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo 98.81
3lss_A484 Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, 98.79
2hf9_A226 Probable hydrogenase nickel incorporation protein 98.74
1olt_A457 Oxygen-independent coproporphyrinogen III oxidase; 98.69
>3rfa_A Ribosomal RNA large subunit methyltransferase N; radical SAM, S-adenosylmethionine, iron sulfur cluster, oxidoreductase; HET: SAM; 2.05A {Escherichia coli} PDB: 3rf9_A* Back     alignment and structure
Probab=100.00  E-value=5.2e-83  Score=739.27  Aligned_cols=357  Identities=46%  Similarity=0.798  Sum_probs=310.0

Q ss_pred             hhCCCCcccc-ccCCccchhhcchhhhhhhhcCChhHHHHHHHHHHHhcCCCCchhhcccCHHHHHHHhhcCccCCCeee
Q psy17091        506 LIGDTDPIKA-AKGTIRADFAESIDKNIVHELGEMPFRAKQLQKWIHKFGVSDFNKMTDLSMSLRKKLKNSVYIKAPHIM  584 (1250)
Q Consensus       506 l~G~~~~~~a-~p~siR~~~g~~~~~n~~~~~g~~~~ra~qi~~w~~~~~~~~~~~~~~~~~~~r~~l~~~~~~~~~~~~  584 (1250)
                      ++-|.+.... .+..|.+ +..+.+++++.+.|+|+|||+|||+|||++++.+|++||||||++|++|++.|.+..++++
T Consensus         5 ~~~~~~~~~~~~~~~l~~-~~~~~l~~~~~~~g~~~fra~qi~~w~~~~~~~~~~~mt~l~k~~r~~l~~~~~~~~~~~~   83 (404)
T 3rfa_A            5 LVTPENVTTKDGKINLLD-LNRQQMREFFKDLGEKPFRADQVMKWMYHYCCDNFDEMTDINKVLRGKLKEVAEIRAPEVV   83 (404)
T ss_dssp             ------------CEEGGG-CCHHHHHHHHHHTTCCHHHHHHHHHHHHHSCCCCGGGCTTSCHHHHHHHHHHEECCCCEEE
T ss_pred             ccCcccCcCccCCCCccc-CCHHHHHHHHHHcCCcchHHHHHHHHHHhcCCCChHHhcccCHHHHHHHHhcCCCCCCceE
Confidence            4444443222 3444543 3345788999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEcCCCceEEEEEeCCCeEEEEEeccCCCceeeeecccCCcccccccccCCCCcccCCChhhhHHHHHHHHHHhhhhh
Q psy17091        585 SDQISFDGTRKWIFHVKKNIIETVFIPEKNRNTLCISTQVGCAINCIFCSTGRQGFVRNLTVGEIIGQLWVTEFKLRREK  664 (1250)
Q Consensus       585 ~~~~~~d~t~k~l~~~~~~~ve~v~~~~~~~~t~c~ssq~GC~~~C~fC~t~~~~~~r~l~~~ei~~q~~~~~~~~~~~~  664 (1250)
                      ..+.|.|||+||||+|+|+.||||+||+++|.|+|||||+||+|+|.||+||.+++.||||++||++|++.+..+++.. 
T Consensus        84 ~~~~s~dgt~K~l~~ldg~~iEtV~i~~~~r~tlcVSsq~GCnl~C~fC~tg~~g~~r~Lt~eEIv~qv~~~~~~~~~~-  162 (404)
T 3rfa_A           84 EEQRSSDGTIKWAIAVGDQRVETVYIPEDDRATLCVSSQVGCALECKFCSTAQQGFNRNLRVSEIIGQVWRAAKIVGAA-  162 (404)
T ss_dssp             EEEECTTSCEEEEEEETTEEEEEEEEECSSCEEEECCCEEECSSCCTTCGGGTTCEEEECCHHHHHHHHHHHHHHHCCH-
T ss_pred             EEEECCCCCEEEEEEcCCceEEEEEEecCCCceEEEEeCCCCCCcCCCCCCCCCCCCCcCCHHHHHHHHHHHHHHhhhc-
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999998877410 


Q ss_pred             hccccCCCCCCcceeeecccCccCCCHHHHHHHHHHhhcCCCCCCCCceEEEEecCchhHHHHhhhhCCCeEEEEccCCC
Q psy17091        665 NIKINSQGKRQITNIVMMGMGEPLLNYKSTIGALKLILSDHAYGLSRRHVILSTSGIIPMIDKLAQECPVELAVSLHASN  744 (1250)
Q Consensus       665 ~~~~~~~~~~~~~~ivfmg~GEpl~n~~~v~~~~~~~~~~~~~~~~~~~itvsT~g~~~~i~~~~~~~~~~la~sl~~~~  744 (1250)
                      +    .+|+..++|||||||||||+||++|.++++.++++.|++||.|+|||||||++|.+++|+++.++.||+||||+|
T Consensus       163 g----~~gg~~i~~Ivf~GgGEPLln~d~v~~~i~~lk~~~Gl~~s~r~itlsTnG~~p~i~~L~~~~d~~LaiSLka~d  238 (404)
T 3rfa_A          163 K----VTGQRPITNVVMMGMGEPLLNLNNVVPAMEIMLDDFGFGLSKRRVTLSTSGVVPALDKLGDMIDVALAISLHAPN  238 (404)
T ss_dssp             H----HHSSCSCSEEEECSSSCGGGCHHHHHHHHHHHHSTTTTCCCGGGEEEEESCCHHHHHHHHHHCCCEEEEECCCSS
T ss_pred             c----cccCCCccEEEEeCCCCcccCHHHHHHHHHHHHhhcCcCcCCCceEEECCCcHHHHHHHHHhhcceEEecccCCC
Confidence            0    013467999999999999999999999999999988999999999999999999999999999999999999999


Q ss_pred             hhhhhccCCCCCCCCHHHHHHHHHHHHhhCCC--ceEEEEEEEeccCCCCHHHHHHHHHHhhcCCCccceeEeeeccCCC
Q psy17091        745 NNLRNKLVPISKKYPLKELILACHRYITYSPR--HMITFEYCMLHGINDTDIHAIELISLMRKNKILTSCKINLIPFNCF  822 (1250)
Q Consensus       745 ~~~r~~~~p~~~~~~~~~l~~~~~~~~~~~~~--~~v~~e~~li~g~nd~~~~~~~l~~~~~~~~~~~~~~vnlip~n~~  822 (1250)
                      ++.|++|||++++|+++++++++++|...+++  ++|+|||+||||+||+++++++|++|+++    ++++||||||||+
T Consensus       239 ~e~~~~i~pv~~~~~le~vl~ai~~~~~~~g~~~~~V~ie~vLI~GvNDs~e~~~~La~ll~~----l~~~VnLIpynP~  314 (404)
T 3rfa_A          239 DEIRDEIVPINKKYNIETFLAAVRRYLEKSNANQGRVTIEYVMLDHVNDGTEHAHQLAELLKD----TPCKINLIPWNPF  314 (404)
T ss_dssp             HHHHHHHSGGGGTSCHHHHHHHHHHHHHHCTTTTTCEEEEEEEBTTTTCSHHHHHHHHHHTTT----SCEEEEEEECCCC
T ss_pred             HHHHHHhcCCccCCCHHHHHHHHHHHHHHhCCCcccEEEEEEEecCCCCCHHHHHHHHHHHHc----CCCcEEEEeccCC
Confidence            99999999999999999999999999877642  28999999999999999999999999999    8899999999999


Q ss_pred             CCCCCCCCcHHHHHHHHHHHHhCCCeEEEeccCccchHHhhhhcCCcccc
Q psy17091        823 PNSNLICSKNSRIKIFAKILMNSGIFVTIRKIRGNDINAACGQLSGEETD  872 (1250)
Q Consensus       823 ~~~~~~~p~~e~i~~f~~iL~~~G~~~~ir~~~g~~i~~acgql~~~~~~  872 (1250)
                      ++.+|++|+.+++++|+++|+++|+.++||.++|.||+||||||+.+..+
T Consensus       315 ~~~~~~~ps~e~i~~f~~iL~~~Gi~vtiR~~~G~di~aaCGQL~~~~~~  364 (404)
T 3rfa_A          315 PGAPYGRSSNSRIDRFSKVLMSYGFTTIVRKTRGDDIDAACGQLAGDVID  364 (404)
T ss_dssp             TTCCCCBCCHHHHHHHHHHHHHTTCEEEECCCCCC---------------
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHcCCcEEEcCCCCcccccccccchhhhhh
Confidence            99999999999999999999999999999999999999999999877644



>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>4e51_A Histidine--tRNA ligase; seattle structural genomics center for infectious disease, S aminoacylation, tRNA activation, charged tRNA; HET: HIS; 2.65A {Burkholderia thailandensis} Back     alignment and structure
>3lc0_A Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-tRNA synthetase, ligase, structural G medical structural genomics of pathogenic protozoa; HET: HIS; 1.80A {Trypanosoma cruzi} PDB: 3hrk_A* 3hri_A Back     alignment and structure
>1h4v_B Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA synthetase, ATP + L-histidine tRNA(His)-> AMP + PPI + L-histidyl-tRNA(His); 2.4A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1ady_A* 1adj_A Back     alignment and structure
>3net_A Histidyl-tRNA synthetase; aminoacyl-tRNA synthetase, ligase, structural genomics, PSI- nostoc, protein structure initiative; 2.70A {Nostoc SP} Back     alignment and structure
>1htt_A Histidyl-tRNA synthetase; complex (tRNA synthetase/His-adenylate), aminoacyl-tRNA synthase, ligase; HET: HIS AMP; 2.60A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1kmm_A* 1kmn_A* 2el9_A* Back     alignment and structure
>4g85_A Histidine-tRNA ligase, cytoplasmic; synthetase; 3.11A {Homo sapiens} Back     alignment and structure
>1wu7_A Histidyl-tRNA synthetase; ligase, structural genomics, dimer; 2.40A {Thermoplasma acidophilum} SCOP: c.51.1.1 d.104.1.1 Back     alignment and structure
>4g84_A Histidine--tRNA ligase, cytoplasmic; synthetase; 2.40A {Homo sapiens} Back     alignment and structure
>1qe0_A Histidyl-tRNA synthetase; class II tRNA synthetase, beta sheet, ligase; 2.70A {Staphylococcus aureus} SCOP: c.51.1.1 d.104.1.1 Back     alignment and structure
>3od1_A ATP phosphoribosyltransferase regulatory subunit; structural genomics, PSI-2, protein structure initiative; 1.97A {Bacillus halodurans} Back     alignment and structure
>3rac_A Histidine-tRNA ligase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, PSI-BIO; 2.30A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1z7m_A ATP phosphoribosyltransferase regulatory subunit; ATP-PRT, histidine biosynthesis, hiszg, alloste evolution; 2.90A {Lactococcus lactis} SCOP: d.104.1.1 PDB: 1z7n_A* Back     alignment and structure
>2j3l_A Prolyl-tRNA synthetase; class II aminoacyl- T synthetase, editing, translation; HET: P5A; 2.3A {Enterococcus faecalis} PDB: 2j3m_A* Back     alignment and structure
>1evl_A Threonyl-tRNA synthetase; amino acid recognition, zinc ION, adenylate analog, deletion mutant, ligase; HET: TSB; 1.55A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1evk_A* 1fyf_A* 1kog_A* Back     alignment and structure
>1usy_A ATP phosphoribosyltransferase regulatory subunit; aminoacyl-tRNA synthetase; HET: HIS; 2.52A {Thermotoga maritima} SCOP: d.104.1.1 PDB: 1usy_C* Back     alignment and structure
>2i4l_A Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseudomonas palustris} PDB: 2i4m_A* 2i4n_A* 2i4o_A* Back     alignment and structure
>1nyr_A Threonyl-tRNA synthetase 1; ATP, threonine, ligase; HET: ATP; 2.80A {Staphylococcus aureus} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 PDB: 1nyq_A* Back     alignment and structure
>1qf6_A THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, mRNA, aminoacylati translational regulation, protein/RNA, ligase-RNA complex; HET: H2U AET G7M 5MU PSU AMP; 2.90A {Escherichia coli} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 Back     alignment and structure
>3a32_A Probable threonyl-tRNA synthetase 1; aeropyrum pernix K1, protein biosynthesis, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; 2.30A {Aeropyrum pernix} PDB: 3a31_A Back     alignment and structure
>3uh0_A Threonyl-tRNA synthetase, mitochondrial; threonine tRNA, threonyl ADE threonyl sulfamoyl adenylate; HET: TSB; 2.00A {Saccharomyces cerevisiae} PDB: 3ugt_A 3ugq_A* 4eo4_A* Back     alignment and structure
>1hc7_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP + L-proline + tRNA(Pro) AMP + PPI + L-prolyl-tRNA(Pro); 2.43A {Thermus thermophilus} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1h4q_A* 1h4t_A 1h4s_A Back     alignment and structure
>1nj8_A Proline-tRNA synthetase, proline--tRNA ligase; class-II tRNA synthetase; 3.20A {Methanocaldococcus jannaschii} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 Back     alignment and structure
>2zt5_A Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP, Gly-AMP, aminoacyl-tRNA synthetase, ATP-binding, charcot-marie-tooth disease, disease mutation; HET: B4P; 2.50A {Homo sapiens} PDB: 2pme_A* 2zt6_A* 2zt7_A* 2zt8_A* 2zxf_A* 2pmf_A 2q5h_A 2q5i_A Back     alignment and structure
>1nj1_A PROR, proline-tRNA synthetase, proline--tRNA ligase; protein-aminoacyladenylate complex class-II tRNA synthetase,; HET: 5CA; 2.55A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1nj2_A 1nj5_A* 1nj6_A* Back     alignment and structure
>4hr2_A Nucleoside diphosphate kinase; ssgcid, seattle structural genomics center for infectious DI niaid; HET: ADP; 1.95A {Burkholderia thailandensis} PDB: 4dut_A* 4ek2_A* Back     alignment and structure
>3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} SCOP: d.58.6.1 PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... Back     alignment and structure
>3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} SCOP: d.58.6.0 Back     alignment and structure
>4fkx_A NDK B, nucleoside diphosphate kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CDP; 1.70A {Trypanosoma brucei brucei} PDB: 4fky_A* 4f4a_A* 4f36_A* 3prv_A 3ngs_A 3ngr_A 3ngt_A* 3ngu_A* Back     alignment and structure
>3q8u_A Nucleoside diphosphate kinase; ferridoxin fold, alpha-beta protein family; HET: ADP; 2.22A {Staphylococcus aureus subsp} PDB: 3q83_A* 3q89_A* 3q86_A* 3q8v_A* 3q8y_A* Back     alignment and structure
>1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* Back     alignment and structure
>3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, magnesium, metal- nucleotide metabolism; HET: TNM TNV; 1.65A {Dictyostelium discoideum} SCOP: d.58.6.1 PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... Back     alignment and structure
>1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 Back     alignment and structure
>1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R 3pj9_A Back     alignment and structure
>3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A Back     alignment and structure
>3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} Back     alignment and structure
>2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} Back     alignment and structure
>2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} Back     alignment and structure
>1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 Back     alignment and structure
>1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 Back     alignment and structure
>1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP; 3.05A {Plasmodium falciparum} SCOP: d.58.6.1 Back     alignment and structure
>2yx0_A Radical SAM enzyme; predicted tRNA modification enzyme, metal binding protein, structural genomics, NPPSFA; 2.21A {Pyrococcus horikoshii} Back     alignment and structure
>1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer-O transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 Back     alignment and structure
>3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, babesiosis; 2.50A {Babesia bovis} SCOP: d.58.6.0 Back     alignment and structure
>1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 Back     alignment and structure
>3r9l_A Nucleoside diphosphate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, giardiasis; 2.65A {Giardia lamblia} SCOP: d.58.6.1 Back     alignment and structure
>3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* Back     alignment and structure
>1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* Back     alignment and structure
>1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, struc genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 Back     alignment and structure
>1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 Back     alignment and structure
>2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A Back     alignment and structure
>3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, magnesium, metal-B mitochondrion; 3.10A {Saccharomyces cerevisiae} Back     alignment and structure
>1ati_A Glycyl-tRNA synthetase; protein biosynthesis, ligase, aminoacyl-tRNA SYN; 2.75A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1b76_A* 1ggm_A* Back     alignment and structure
>2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* Back     alignment and structure
>4hvc_A Bifunctional glutamate/proline--tRNA ligase; ligase-ligase inhibitor complex; HET: ANP HFG; 2.00A {Homo sapiens} Back     alignment and structure
>4dz6_A Nucleoside diphosphate kinase; ssgcid, niaid, vanada transition state mimic, transition state analog, transferas; HET: ADP; 2.20A {Borrelia burgdorferi} PDB: 4di6_A* Back     alignment and structure
>3ial_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, prors, cysrs, RS, translation, ATP-binding, nucleotide-binding; HET: PR8; 2.20A {Giardia lamblia atcc 50803} Back     alignment and structure
>1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 Back     alignment and structure
>2z2u_A UPF0026 protein MJ0257; metal binding protein; 2.40A {Methanocaldococcus jannaschii} Back     alignment and structure
>3c8f_A Pyruvate formate-lyase 1-activating enzyme; adoMet radical, SAM radical, activase, glycyl radical, 4Fe- 4S, carbohydrate metabolism, cytoplasm; HET: MT2 PGE; 2.25A {Escherichia coli} PDB: 3cb8_A* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3ikl_A DNA polymerase subunit gamma-2, mitochondrial; transferase; HET: DNA; 3.10A {Homo sapiens} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1g5h_A Mitochondrial DNA polymerase accessory subunit; intermolecular four helix bundle, DNA binding protein; 1.95A {Mus musculus} SCOP: c.51.1.1 d.104.1.1 PDB: 1g5i_A 2g4c_A* 3ikm_B* Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>3can_A Pyruvate-formate lyase-activating enzyme; structural genomics, pyruvate-formate lyase-activating enzym MCSG, APC20359.1; 1.80A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>3bh7_B Protein XRP2; protein-protein complex, GTPase activating protein and GTPase, retinitis pigmentosa, GTP-binding, lipoprotein, myristate; HET: GDP; 1.90A {Homo sapiens} PDB: 3bh6_B* 2bx6_A Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>2a5h_A L-lysine 2,3-aminomutase; radical SAM, four-iron-four-sulfur cluster, 4Fe4S, FS4, SAM, adenosylmethionine, alpha-beta channel; HET: SAM LYS PLP; 2.10A {Clostridium subterminale} Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3iix_A Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>3t7v_A Methylornithine synthase PYLB; TIM-barrel fold, mutase, [4Fe-4S]-cluster, SAM, lysine, transferase; HET: SAM MD0; 1.50A {Methanosarcina barkeri} Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1tv8_A MOAA, molybdenum cofactor biosynthesis protein A; TIM barrel, ligand binding protein; HET: SAM; 2.20A {Staphylococcus aureus} SCOP: c.1.28.3 PDB: 1tv7_A* 2fb3_A* 2fb2_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1v95_A Nuclear receptor coactivator 5; coactivator independent of AF-2 function (CIA), structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: c.51.1.1 Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2dq3_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, nationa on protein structural and functional analyses; HET: SSA; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1r30_A Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli} SCOP: c.1.28.1 Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3dsq_A Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-tRNA synthetase, ligase; 2.10A {Desulfitobacterium hafniense} PDB: 2znj_A 2zni_A Back     alignment and structure
>2qgq_A Protein TM_1862; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; HET: CXS; 2.00A {Thermotoga maritima MSB8} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1ses_A Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A {Thermus thermophilus} SCOP: a.2.7.1 d.104.1.1 PDB: 1ser_A* 1set_A* 1sry_A Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3qtc_A Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP B O-methyl tyrosine binding, magnesium binding, aminoacylatio esterification; HET: 0A1 ANP; 1.75A {Methanosarcina mazei} PDB: 2q7e_A* 2q7g_A* 2q7h_A* 2zim_A* 2zin_A* 2e3c_A* 2zcd_A* 2zce_A* 2zio_A* 3vqv_A* 3vqw_A* 3vqx_A* 3vqy_A* Back     alignment and structure
>1nnh_A Asparaginyl-tRNA synthetase-related peptide; structural genomics, PSI, protein structure initiative, southeast COLL for structural genomics; 1.65A {Pyrococcus furiosus} SCOP: d.104.1.1 PDB: 3p8t_A 3p8v_A 3p8y_A 3reu_A* 3rex_A* 3rl6_A* Back     alignment and structure
>2cja_A Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE ATP; 2.2A {Methanosarcina barkeri} PDB: 2cim_A* 2cj9_A* 2cjb_A Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>3vbb_A Seryl-tRNA synthetase, cytoplasmic; coiled-coil, ligase; 2.89A {Homo sapiens} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} Back     alignment and structure
>3lss_A Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, serrs, translation, ATP-binding, nucleotide-binding, structural genomics; HET: ATP; 1.95A {Trypanosoma brucei} PDB: 3lsq_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1olt_A Oxygen-independent coproporphyrinogen III oxidase; heme biosynthesis, decarboxylase, radical SAM enzyme, 4Fe- 4 cluster; HET: SAM; 2.07A {Escherichia coli} SCOP: c.1.28.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1250
d1kmma2322 d.104.1.1 (A:4-325) Histidyl-tRNA synthetase (HisR 2e-54
d1qe0a2325 d.104.1.1 (A:1-325) Histidyl-tRNA synthetase (HisR 5e-51
d1h4vb2324 d.104.1.1 (B:2-325) Histidyl-tRNA synthetase (HisR 9e-50
d1usya_275 d.104.1.1 (A:) ATP phosphoribosyltransferase regul 3e-41
d1z7ma1318 d.104.1.1 (A:6-323) ATP phosphoribosyltransferase 8e-37
d1wu7a2327 d.104.1.1 (A:3-329) Histidyl-tRNA synthetase (HisR 2e-33
d1wkja1137 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, 7e-30
d3bbba1150 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, 1e-29
d1xqia1182 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, 7e-29
d1k44a_135 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 9e-29
d1nhkl_143 d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK { 1e-28
d1zs6a1152 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, 9e-28
d2az3a1152 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, 2e-27
d1ehwa_143 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 3e-27
d1w7wa_151 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 3e-27
d1s57a_153 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 3e-27
d1xiqa_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 2e-26
d1u8wa_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 4e-26
d1puja_273 c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subti 6e-26
d1hlwa_150 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 2e-25
d2dyaa1153 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, 1e-23
d1nb2a_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 2e-23
d1mkya2186 c.37.1.8 (A:173-358) Probable GTPase Der, N-termin 2e-22
d1mkya2186 c.37.1.8 (A:173-358) Probable GTPase Der, N-termin 1e-16
d2b8qa1128 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, 3e-22
d1xzpa2160 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotog 5e-22
d1xzpa2160 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotog 5e-22
d1bifa1213 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fruct 7e-21
d1tq4a_400 c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( 8e-20
d1tq4a_400 c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( 2e-12
d1udxa2180 c.37.1.8 (A:157-336) Obg GTP-binding protein middl 9e-20
d1udxa2180 c.37.1.8 (A:157-336) Obg GTP-binding protein middl 1e-14
d1egaa1179 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain { 2e-19
d1egaa1179 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain { 2e-16
d1mkya1171 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal 4e-17
d1mkya1171 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal 1e-13
d2cxxa1184 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyroc 2e-16
d2cxxa1184 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyroc 1e-14
d1lnza2185 c.37.1.8 (A:158-342) Obg GTP-binding protein middl 7e-16
d1lnza2185 c.37.1.8 (A:158-342) Obg GTP-binding protein middl 7e-16
d1puia_188 c.37.1.8 (A:) Probable GTPase EngB {Escherichia co 2e-14
d1puia_188 c.37.1.8 (A:) Probable GTPase EngB {Escherichia co 3e-09
d1h65a_257 c.37.1.8 (A:) Chloroplast protein translocon GTPas 6e-14
d1h65a_257 c.37.1.8 (A:) Chloroplast protein translocon GTPas 2e-11
d1mkya381 d.52.5.1 (A:359-439) Probable GTPase Der, C-termin 5e-13
d2gj8a1161 c.37.1.8 (A:216-376) Probable tRNA modification GT 9e-13
d2gj8a1161 c.37.1.8 (A:216-376) Probable tRNA modification GT 1e-12
d1svia_195 c.37.1.8 (A:) Probable GTPase EngB {Bacillus subti 2e-12
d1svia_195 c.37.1.8 (A:) Probable GTPase EngB {Bacillus subti 3e-08
d1nrjb_209 c.37.1.8 (B:) Signal recognition particle receptor 4e-12
d1nrjb_209 c.37.1.8 (B:) Signal recognition particle receptor 8e-10
d1wf3a1178 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain { 6e-12
d1wf3a1178 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain { 1e-11
d1kmma199 c.51.1.1 (A:326-424) Histidyl-tRNA synthetase (His 1e-11
d2c78a3204 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N 1e-10
d2c78a3204 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N 9e-07
d1qe0a195 c.51.1.1 (A:326-420) Histidyl-tRNA synthetase (His 4e-10
d1wxqa1319 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyr 7e-10
d1wxqa1319 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyr 2e-04
d1ni3a1296 c.37.1.8 (A:11-306) YchF GTP-binding protein N-ter 3e-09
d1ni3a1296 c.37.1.8 (A:11-306) YchF GTP-binding protein N-ter 2e-05
d1wu7a197 c.51.1.1 (A:330-426) Histidyl-tRNA synthetase (His 8e-09
d1h4vb196 c.51.1.1 (B:326-421) Histidyl-tRNA synthetase (His 1e-08
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 2e-08
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 4e-04
d2fh5b1207 c.37.1.8 (B:63-269) Signal recognition particle re 1e-07
d2fh5b1207 c.37.1.8 (B:63-269) Signal recognition particle re 2e-06
d1jala1278 c.37.1.8 (A:1-278) YchF GTP-binding protein N-term 3e-07
d1jala1278 c.37.1.8 (A:1-278) YchF GTP-binding protein N-term 9e-04
d1g7sa4227 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N- 4e-07
d1g7sa4227 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N- 8e-05
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 9e-07
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 4e-05
d1b8aa2335 d.104.1.1 (A:104-438) Aspartyl-tRNA synthetase (As 1e-06
d1fzqa_176 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 1e-06
d1fzqa_176 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 1e-04
d1f60a3239 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N 2e-06
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 3e-06
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 5e-04
d1ksha_165 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 4e-06
d1ksha_165 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 7e-04
d1zj6a1177 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human 4e-06
d1upta_169 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 7e-06
d1upta_169 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 1e-04
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 1e-05
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 8e-05
d2ew1a1171 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta 1e-05
d2bv3a2276 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-t 1e-04
d1r8sa_160 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 1e-04
d1r8sa_160 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 0.003
d1ky3a_175 c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y 2e-04
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 2e-04
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 0.002
d2g6ba1170 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T 2e-04
d1zd9a1164 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human 3e-04
d2qtvb1166 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom 3e-04
d2qtvb1166 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom 6e-04
d2bcgy1194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 4e-04
d1moza_182 c.37.1.8 (A:) ADP-ribosylation factor {Baker's yea 5e-04
d2f9la1175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 0.001
d2f9la1175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 0.002
d1u8za_168 c.37.1.8 (A:) Ras-related protein RalA {Cotton-top 0.001
d1n0ua2341 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N- 0.001
d1r5ba3245 c.37.1.8 (A:215-459) Eukaryotic peptide chain rele 0.001
d2qn6a3205 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma su 0.001
d1ctqa_166 c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapi 0.002
d2erxa1171 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [ 0.002
d1wb1a4179 c.37.1.8 (A:1-179) Elongation factor SelB, N-termi 0.003
d1wb1a4179 c.37.1.8 (A:1-179) Elongation factor SelB, N-termi 0.003
d1vg8a_184 c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId 0.004
>d1kmma2 d.104.1.1 (A:4-325) Histidyl-tRNA synthetase (HisRS) {Escherichia coli [TaxId: 562]} Length = 322 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Class II aaRS and biotin synthetases
superfamily: Class II aaRS and biotin synthetases
family: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain
domain: Histidyl-tRNA synthetase (HisRS)
species: Escherichia coli [TaxId: 562]
 Score =  191 bits (484), Expect = 2e-54
 Identities = 138/269 (51%), Positives = 191/269 (71%), Gaps = 4/269 (1%)

Query: 867  SGEETDIVKKEMYSFIDELNGDNLSLRPEGTASVIRSVIENNLIYDGPKRLWYSGPMFRH 926
             GE TD+V+KEMY+F D  NGD+L+LRPEGTA  +R+ IE+ L+Y+  +RLWY GPMFRH
Sbjct: 53   IGEVTDVVEKEMYTFEDR-NGDSLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRH 111

Query: 927  ERPQYGRYRQFYQIGVEAIGFPGPDIDAELIIMCSRLWKNLNLKNICLEL-NSIGNFNER 985
            ERPQ GRYRQF+Q+G E  G  GPDIDAELI++ +R W+ L +        NSIG+   R
Sbjct: 112  ERPQKGRYRQFHQLGCEVFGLQGPDIDAELIMLTARWWRALGISEHVTLELNSIGSLEAR 171

Query: 986  KKYCIDLINYIKKHKDSKWFCEDIKHSLYLNSLRVLDSKNLIIREILINAPKLLDYLEKD 1045
              Y   L+ ++++HK+     ED K  +Y N LRVLDSKN  ++ +L +AP L DYL+++
Sbjct: 172  ANYRDALVAFLEQHKE--KLDEDCKRRMYTNPLRVLDSKNPEVQALLNDAPALGDYLDEE 229

Query: 1046 SLDHFYGIQKILNYNNISYKINTKLVRGMDYYNRTVFEWTTDKLGSQNSICGGGRYDFLI 1105
            S +HF G+ K+L    I+Y +N +LVRG+DYYNRTVFEW T+ LGSQ ++C GGRYD L+
Sbjct: 230  SREHFAGLCKLLESAGIAYTVNQRLVRGLDYYNRTVFEWVTNSLGSQGTVCAGGRYDGLV 289

Query: 1106 KKFSNKFVPASGFAIGIERLIELIKKINI 1134
            ++   +  PA GFA+G+ERL+ L++ +N 
Sbjct: 290  EQLGGRATPAVGFAMGLERLVLLVQAVNP 318


>d1qe0a2 d.104.1.1 (A:1-325) Histidyl-tRNA synthetase (HisRS) {Staphylococcus aureus [TaxId: 1280]} Length = 325 Back     information, alignment and structure
>d1h4vb2 d.104.1.1 (B:2-325) Histidyl-tRNA synthetase (HisRS) {Thermus thermophilus [TaxId: 274]} Length = 324 Back     information, alignment and structure
>d1usya_ d.104.1.1 (A:) ATP phosphoribosyltransferase regulatory subunit HisZ {Thermotoga maritima [TaxId: 2336]} Length = 275 Back     information, alignment and structure
>d1z7ma1 d.104.1.1 (A:6-323) ATP phosphoribosyltransferase regulatory subunit HisZ {Lactococcus lactis [TaxId: 1358]} Length = 318 Back     information, alignment and structure
>d1wu7a2 d.104.1.1 (A:3-329) Histidyl-tRNA synthetase (HisRS) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 327 Back     information, alignment and structure
>d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} Length = 137 Back     information, alignment and structure
>d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 182 Back     information, alignment and structure
>d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} Length = 135 Back     information, alignment and structure
>d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} Length = 143 Back     information, alignment and structure
>d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} Length = 152 Back     information, alignment and structure
>d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} Length = 143 Back     information, alignment and structure
>d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} Length = 151 Back     information, alignment and structure
>d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} Length = 153 Back     information, alignment and structure
>d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 149 Back     information, alignment and structure
>d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 149 Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Length = 273 Back     information, alignment and structure
>d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} Length = 150 Back     information, alignment and structure
>d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 153 Back     information, alignment and structure
>d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} Length = 149 Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 186 Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 186 Back     information, alignment and structure
>d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} Length = 128 Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Length = 160 Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Length = 160 Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 213 Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Length = 180 Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Length = 180 Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 171 Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 171 Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Length = 184 Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Length = 184 Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Length = 185 Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Length = 185 Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 257 Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 257 Back     information, alignment and structure
>d1mkya3 d.52.5.1 (A:359-439) Probable GTPase Der, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 81 Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Length = 195 Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Length = 195 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 178 Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 178 Back     information, alignment and structure
>d1kmma1 c.51.1.1 (A:326-424) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Escherichia coli [TaxId: 562]} Length = 99 Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 204 Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 204 Back     information, alignment and structure
>d1qe0a1 c.51.1.1 (A:326-420) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Length = 95 Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Length = 319 Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Length = 319 Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 296 Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 296 Back     information, alignment and structure
>d1wu7a1 c.51.1.1 (A:330-426) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 97 Back     information, alignment and structure
>d1h4vb1 c.51.1.1 (B:326-421) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 96 Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Length = 278 Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Length = 278 Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 227 Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 227 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d1b8aa2 d.104.1.1 (A:104-438) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis [TaxId: 311400]} Length = 335 Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 239 Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 276 Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Length = 182 Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Length = 168 Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 341 Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 245 Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 205 Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Length = 179 Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Length = 179 Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 184 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1250
d1h4vb2324 Histidyl-tRNA synthetase (HisRS) {Thermus thermoph 100.0
d1z7ma1318 ATP phosphoribosyltransferase regulatory subunit H 100.0
d1kmma2322 Histidyl-tRNA synthetase (HisRS) {Escherichia coli 100.0
d1qe0a2325 Histidyl-tRNA synthetase (HisRS) {Staphylococcus a 100.0
d1wu7a2327 Histidyl-tRNA synthetase (HisRS) {Archaeon Thermop 100.0
d1usya_275 ATP phosphoribosyltransferase regulatory subunit H 100.0
d1wkja1137 Nucleoside diphosphate kinase, NDK {Thermus thermo 99.95
d3bbba1150 Nucleoside diphosphate kinase, NDK {Human (Homo sa 99.95
d1ehwa_143 Nucleoside diphosphate kinase, NDK {Human (Homo sa 99.95
d1u8wa_149 Nucleoside diphosphate kinase, NDK {Thale cress (A 99.95
d1zs6a1152 Nucleoside diphosphate kinase, NDK {Human(Homo sap 99.95
d1nhkl_143 Nucleoside diphosphate kinase, NDK {Myxococcus xan 99.95
d1w7wa_151 Nucleoside diphosphate kinase, NDK {Pea (Pisum sat 99.95
d1xiqa_149 Nucleoside diphosphate kinase, NDK {Plasmodium fal 99.95
d1s57a_153 Nucleoside diphosphate kinase, NDK {Thale cress (A 99.95
d1nb2a_149 Nucleoside diphosphate kinase, NDK {Bacillus halod 99.95
d1hlwa_150 Nucleoside diphosphate kinase, NDK {Dictyostelium 99.95
d1k44a_135 Nucleoside diphosphate kinase, NDK {Mycobacterium 99.95
d2az3a1152 Nucleoside diphosphate kinase, NDK {Archaeon Halob 99.95
d2dyaa1153 Nucleoside diphosphate kinase, NDK {Archaeon Pyroc 99.94
d1xqia1182 Nucleoside diphosphate kinase, NDK {Archaeon Pyrob 99.94
d2b8qa1128 Nucleoside diphosphate kinase, NDK {Mimivirus [Tax 99.92
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.9
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.89
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.89
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.88
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.87
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.87
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.86
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.85
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.84
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.84
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.84
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.83
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.82
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 99.82
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.82
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.82
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.81
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.81
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.8
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.8
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.8
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.8
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.78
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.77
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.77
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.76
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.76
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.75
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.75
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.74
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.74
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.74
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.74
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.74
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.73
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.73
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.73
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.73
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.73
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 99.72
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.72
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 99.72
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.72
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.72
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.72
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 99.72
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.71
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.71
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.71
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.71
d1qf6a1110 Threonyl-tRNA synthetase (ThrRS), C-terminal domai 99.71
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.71
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.71
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.71
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.7
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.7
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.7
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.69
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.69
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.69
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.69
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.69
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.69
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.69
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.69
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.69
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.69
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.69
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.68
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.68
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.68
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.68
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.68
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.68
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1nyra1113 Threonyl-tRNA synthetase (ThrRS), C-terminal domai 99.68
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.68
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.68
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.67
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.67
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 99.67
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.67
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.67
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.67
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.67
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.66
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.66
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.66
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.66
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.65
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.65
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.65
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.65
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.65
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.64
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.64
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.64
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.64
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.63
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.63
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.63
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.63
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 99.63
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.62
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.62
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.62
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.62
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 99.62
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.61
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.6
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.59
d1kmma199 Histidyl-tRNA synthetase (HisRS), C-terminal domai 99.58
d1wu7a197 Histidyl-tRNA synthetase (HisRS), C-terminal domai 99.58
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.58
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 99.57
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.57
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.56
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 99.56
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.55
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.55
d1h4vb196 Histidyl-tRNA synthetase (HisRS), C-terminal domai 99.54
d1nj1a1127 Prolyl-tRNA synthetase (ProRS) domain {Arhaeon (Me 99.54
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.54
d1qe0a195 Histidyl-tRNA synthetase (HisRS), C-terminal domai 99.54
d1mkya381 Probable GTPase Der, C-terminal domain {Thermotoga 99.52
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.52
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.52
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.51
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 99.51
d1g5ha1127 The aaRS-like accessory subunit of mitochondrial p 99.5
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.5
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 99.49
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.49
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.48
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 99.46
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.45
d1nj8a1126 Prolyl-tRNA synthetase (ProRS) domain {Archaeon (M 99.44
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 99.43
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.43
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.42
d1atia1111 Glycyl-tRNA synthetase (GlyRS), C-terminal domain 99.41
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 99.38
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.38
d1hc7a1127 Prolyl-tRNA synthetase (ProRS) domain {Thermus the 99.38
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.38
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 99.36
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 99.33
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 99.31
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.31
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 99.3
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 99.28
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.27
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.25
d1qf6a4291 Threonyl-tRNA synthetase (ThrRS) {Escherichia coli 99.24
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 99.23
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.2
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 99.2
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.2
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 99.13
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 99.09
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 99.08
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 99.07
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 99.07
d1nyra4291 Threonyl-tRNA synthetase (ThrRS) {Staphylococcus a 99.07
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 99.06
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 99.06
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 99.03
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 98.91
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 98.9
d1nj8a3268 Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanoc 98.89
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 98.82
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 98.77
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 98.72
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 98.7
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 98.69
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 98.67
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 98.66
d1nj1a3265 Prolyl-tRNA synthetase (ProRS) {Arhaeon (Methanoth 98.62
d1b76a2331 Glycyl-tRNA synthetase (GlyRS) {Thermus thermophil 98.5
d1tv8a_327 Molybdenum cofactor biosynthesis protein A MoaA {S 98.48
d1hc7a2272 Prolyl-tRNA synthetase (ProRS) {Thermus thermophil 98.45
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 98.39
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.93
d1r30a_312 Biotin synthase {Escherichia coli [TaxId: 562]} 97.91
d1vmaa2213 GTPase domain of the signal recognition particle r 97.68
d1v95a_130 Nuclear receptor coactivator 5 (KIAA1637) {Human ( 97.65
d1seta2311 Seryl-tRNA synthetase (SerRS) {Thermus thermophilu 97.59
d2qy9a2211 GTPase domain of the signal recognition particle r 97.58
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.5
d1okkd2207 GTPase domain of the signal recognition particle r 97.47
d1vmaa2213 GTPase domain of the signal recognition particle r 97.44
d1g5ha2290 The aaRS-like accessory subunit of mitochondrial p 97.42
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.41
d2qy9a2211 GTPase domain of the signal recognition particle r 97.29
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.27
d1olta_441 Oxygen-independent coproporphyrinogen III oxidase 97.19
d1okkd2207 GTPase domain of the signal recognition particle r 97.13
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.06
d1atia2394 Glycyl-tRNA synthetase (GlyRS) {Thermus thermophil 97.05
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 96.96
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 96.94
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.78
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.57
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.41
d1jjca_266 Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS 96.38
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 96.32
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 96.19
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.18
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 96.16
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.35
d1c0aa3346 Aspartyl-tRNA synthetase (AspRS) {Escherichia coli 95.15
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 95.08
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 94.74
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 94.72
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 94.39
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 94.2
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 93.98
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 93.58
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 93.54
d1l0wa3356 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 93.48
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 93.44
d1e1oa2342 Lysyl-tRNA synthetase (LysRS) {Escherichia coli, g 93.42
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 93.18
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 93.15
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 93.06
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 93.0
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 92.96
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 92.95
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 92.89
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 92.79
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 92.74
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 92.72
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 92.59
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 92.59
d1nnha_293 Hypothetical protein PF1951 {Archaeon Pyrococcus f 92.53
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 92.52
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 92.3
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 92.16
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 92.02
d1b8aa2335 Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococ 91.98
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 91.91
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 91.84
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 91.8
d1eova2353 Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (S 91.79
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 91.77
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 91.76
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 91.74
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 91.72
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 91.58
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 91.54
d1g2912240 Maltose transport protein MalK, N-terminal domain 91.51
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 91.5
d2awna2232 Maltose transport protein MalK, N-terminal domain 91.4
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 91.3
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 91.27
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 91.24
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 91.21
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 91.2
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 91.13
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 91.12
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 91.1
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 91.09
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 91.01
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 90.98
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 90.93
d1g2912240 Maltose transport protein MalK, N-terminal domain 90.92
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 90.9
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 90.9
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 90.88
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 90.78
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 90.68
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 90.66
d2awna2232 Maltose transport protein MalK, N-terminal domain 90.66
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 90.59
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 90.49
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 90.47
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 90.45
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 90.32
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 90.28
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 90.23
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 90.22
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 90.14
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 90.09
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 90.08
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 90.08
d2hyda1255 Putative multidrug export ATP-binding/permease pro 90.04
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 90.03
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 90.01
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 89.86
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 89.83
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 89.73
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 89.5
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 89.43
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 89.41
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 89.38
d2hyda1255 Putative multidrug export ATP-binding/permease pro 89.33
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 89.27
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 89.27
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 89.26
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 89.26
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 89.22
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 89.22
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 88.86
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 88.78
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 88.75
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 88.72
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 88.71
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 88.61
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 88.4
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 88.31
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 88.31
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 88.25
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 88.22
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 88.15
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 88.08
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 87.95
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 87.74
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 87.68
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 87.67
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 87.48
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 87.36
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 87.25
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 87.15
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 86.93
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 86.92
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 86.89
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 86.48
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 86.42
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 86.34
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 86.31
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 86.3
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 86.08
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 86.07
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 85.94
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 85.67
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 85.08
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 85.0
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 84.96
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 84.78
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 84.64
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 84.53
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 84.5
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 84.13
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 83.6
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 83.56
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 83.06
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 82.99
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 82.78
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 82.64
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 81.79
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 81.69
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 81.62
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 81.51
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 81.31
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 81.25
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 81.22
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 81.16
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 81.05
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 80.93
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 80.62
d1n9wa2304 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 80.39
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 80.32
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 80.07
>d1h4vb2 d.104.1.1 (B:2-325) Histidyl-tRNA synthetase (HisRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Class II aaRS and biotin synthetases
superfamily: Class II aaRS and biotin synthetases
family: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain
domain: Histidyl-tRNA synthetase (HisRS)
species: Thermus thermophilus [TaxId: 274]
Probab=100.00  E-value=1.7e-41  Score=389.00  Aligned_cols=295  Identities=36%  Similarity=0.645  Sum_probs=221.1

Q ss_pred             HHHHHHHHHhCCCeEEEeccCccchHHhhhhcCCccccccccceeeeccccCCcccccCCCCcHHHHHHHHHcCC-CCCC
Q psy17091        835 IKIFAKILMNSGIFVTIRKIRGNDINAACGQLSGEETDIVKKEMYSFIDELNGDNLSLRPEGTASVIRSVIENNL-IYDG  913 (1250)
Q Consensus       835 i~~f~~iL~~~G~~~~ir~~~g~~i~~acgql~~~~~~~~~~~~~~~~D~~~g~~l~LRpD~T~~iaR~~a~~~~-~~~~  913 (1250)
                      .+.+.+++++|||. .|.+|..++.+.+-.. .+...+...++||+|.|. +|+.++||||+|+|+||+++.+.. ..+.
T Consensus        23 ~~~l~~~f~~~Gy~-~I~tP~lE~~d~l~~~-~g~~~~~~~~~~~~~~d~-~g~~l~LRpD~T~~iar~~~~~~~~~~~~   99 (324)
T d1h4vb2          23 VATARKVLEAAGAL-ELVTPIFEETQVFEKG-VGAATDIVRKEMFTFQDR-GGRSLTLRPEGTAAMVRAYLEHGMKVWPQ   99 (324)
T ss_dssp             HHHHHHHHHHTTCE-ECCCCSEEEGGGGCCC-SCC------CCSCEEECT-TSCEEEECCCSHHHHHHHHHHTTGGGSSS
T ss_pred             HHHHHHHHHHcCCe-EeeCCccccHHHhhcc-cCCchhHHHHHHhhhhcc-CCcccccccccccHHHHHHHHhhhhhhch
Confidence            34578888999999 7999999999875411 123334467889999999 999999999999999998886543 3367


Q ss_pred             CeeEEEEeceeecCCCCCCCCCceEEeeEEEecCCCchhchHHHHHHHHHHHHCCCCceEEEeCCCcChhhHHHHHHHHH
Q psy17091        914 PKRLWYSGPMFRHERPQYGRYRQFYQIGVEAIGFPGPDIDAELIIMCSRLWKNLNLKNICLELNSIGNFNERKKYCIDLI  993 (1250)
Q Consensus       914 P~r~yy~g~VfR~e~~~~gr~REf~Q~g~eiig~~~~~adaEvi~l~~~~l~~lgl~~~~i~i~~~~i~~~~~~~~~~~~  993 (1250)
                      |+|+||+|+|||+++++.||.|||+|+|+|+||.++..+|+|++.++.++++.+|++++.+.|+|.++............
T Consensus       100 p~r~~Y~g~VfR~~~~~~gr~re~~Q~g~EiiG~~~~~ad~Eii~l~~~~l~~l~~~~~~~~i~~~~~~~~~~~~~~~~~  179 (324)
T d1h4vb2         100 PVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEAVVLLYECLKELGLRRLKVKLSSVGDPEDRARYNAYLR  179 (324)
T ss_dssp             SEEEEEEEEEECCCCC----CCEEEEEEEEEESCCCHHHHHHHHHHHHHHHHHTTCCSCEEEEEECCCHHHHHHHHHHHH
T ss_pred             hhhheeeCcccccCcccCCCcceeccccccccCCCChHHHHHHHHHHHHHHHHhcccCcceeeeccCchhHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999998887654443333


Q ss_pred             HHHHhccCchhhhHHHHHHhhhccccccccccHHHHHHHhh--hhhHHHHHHHhHHHHHHHHHHHHhhCCceEEEeCCCC
Q psy17091        994 NYIKKHKDSKWFCEDIKHSLYLNSLRVLDSKNLIIREILIN--APKLLDYLEKDSLDHFYGIQKILNYNNISYKINTKLV 1071 (1250)
Q Consensus       994 ~~l~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~--~~~~~~~l~~~~~~~l~~l~~~l~~~gi~i~~D~~~~ 1071 (1250)
                      ..+......  ...+....+....+............++..  .+..++.+..++...+..+...++..++.+.+||+++
T Consensus       180 ~~~~~~~~~--~~~~~~~~l~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~i~iD~~~~  257 (324)
T d1h4vb2         180 EVLSPHREA--LSEDSKERLEENPMRILDSKSERDQALLKELGVRPMLDFLGEEARAHLKEVERHLERLSVPYELEPALV  257 (324)
T ss_dssp             HHHGGGGGG--SCHHHHHHHHHCGGGGGGCCCHHHHHHHHHHCCCCGGGGCCHHHHHHHHHHHHHHHHTTCCEEECTTCC
T ss_pred             HHHHHHHHh--hhHHHHHHHHhhhhhhhhhhhHHHHHHHHhhcCchHHHHHhHHHHHHHHHHHHHHhhcceEEEEccccc
Confidence            323222211  222333333333333333333333333322  2334445556667777778888888899999999999


Q ss_pred             CCCCCCcceEEEEEECCCCCCcceeecccchHHHHhcCCCCCCeEEEEEeHHHHHHHHHHccC
Q psy17091       1072 RGMDYYNRTVFEWTTDKLGSQNSICGGGRYDFLIKKFSNKFVPASGFAIGIERLIELIKKINI 1134 (1250)
Q Consensus      1072 ~~~~YYtG~vFe~~~~~~~~~~~i~~GGRYD~L~~~fg~~~~pavGfsi~lerl~~~l~~~~~ 1134 (1250)
                      |+++||||++||+|.++.+...+||+|||||+|++.||++..||||||+++|||+.+|.++|.
T Consensus       258 rg~~YYtG~vFe~~~~~~g~~~~i~~GGRYD~L~~~f~~~~~pAvGfsi~ld~l~~~l~~~g~  320 (324)
T d1h4vb2         258 RGLDYYVRTAFEVHHEEIGAQSALGGGGRYDGLSELLGGPRVPGVGFAFGVERVALALEAEGF  320 (324)
T ss_dssp             CCSTTCEEEEEEEEC------CEEEEEEECTTHHHHTTCCCCCEEEEEEEHHHHHHHHHHTTC
T ss_pred             cCCccccCeEEEEEECCCCccCeeecCCccHHHHHhcCCCCCCeEEEEeeHHHHHHHHHhcCC
Confidence            999999999999999877766799999999999999998889999999999999999998874



>d1z7ma1 d.104.1.1 (A:6-323) ATP phosphoribosyltransferase regulatory subunit HisZ {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1kmma2 d.104.1.1 (A:4-325) Histidyl-tRNA synthetase (HisRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qe0a2 d.104.1.1 (A:1-325) Histidyl-tRNA synthetase (HisRS) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1wu7a2 d.104.1.1 (A:3-329) Histidyl-tRNA synthetase (HisRS) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1usya_ d.104.1.1 (A:) ATP phosphoribosyltransferase regulatory subunit HisZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} Back     information, alignment and structure
>d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} Back     information, alignment and structure
>d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} Back     information, alignment and structure
>d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} Back     information, alignment and structure
>d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} Back     information, alignment and structure
>d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qf6a1 c.51.1.1 (A:533-642) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyra1 c.51.1.1 (A:533-645) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kmma1 c.51.1.1 (A:326-424) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wu7a1 c.51.1.1 (A:330-426) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1h4vb1 c.51.1.1 (B:326-421) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nj1a1 c.51.1.1 (A:284-410) Prolyl-tRNA synthetase (ProRS) domain {Arhaeon (Methanothermobacter thermautotrophicus) [TaxId: 145262]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1qe0a1 c.51.1.1 (A:326-420) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1mkya3 d.52.5.1 (A:359-439) Probable GTPase Der, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1g5ha1 c.51.1.1 (A:343-469) The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nj8a1 c.51.1.1 (A:268-393) Prolyl-tRNA synthetase (ProRS) domain {Archaeon (Methanocaldococcus jannaschii) [TaxId: 2190]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1atia1 c.51.1.1 (A:395-505) Glycyl-tRNA synthetase (GlyRS), C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hc7a1 c.51.1.1 (A:277-403) Prolyl-tRNA synthetase (ProRS) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qf6a4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nyra4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1nj8a3 d.104.1.1 (A:0-267) Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanocaldococcus jannaschii) [TaxId: 2190]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nj1a3 d.104.1.1 (A:19-283) Prolyl-tRNA synthetase (ProRS) {Arhaeon (Methanothermobacter thermautotrophicus) [TaxId: 145262]} Back     information, alignment and structure
>d1b76a2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tv8a_ c.1.28.3 (A:) Molybdenum cofactor biosynthesis protein A MoaA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1hc7a2 d.104.1.1 (A:5-276) Prolyl-tRNA synthetase (ProRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1r30a_ c.1.28.1 (A:) Biotin synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v95a_ c.51.1.1 (A:) Nuclear receptor coactivator 5 (KIAA1637) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1seta2 d.104.1.1 (A:111-421) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g5ha2 d.104.1.1 (A:41-330) The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1atia2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1jjca_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c0aa3 d.104.1.1 (A:107-287,A:421-585) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1l0wa3 d.104.1.1 (A:105-294,A:415-580) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e1oa2 d.104.1.1 (A:161-502) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1nnha_ d.104.1.1 (A:) Hypothetical protein PF1951 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1b8aa2 d.104.1.1 (A:104-438) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1eova2 d.104.1.1 (A:205-557) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1n9wa2 d.104.1.1 (A:111-414) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure