Psyllid ID: psy17151

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80------
MKLSNVVISEVQGQLRITVKKSRPLLGMAIEGGANTKHPLPRIINIHDKLKISSMSQIPTPYHFTYRELKSDIRSSRATQDNSEEV
cccccEEEEcccccEEEEEEccccEEEEEEEccccccccccEEEEEcccEEEEcccccccccEEHHHHHHHHHHHccccccccccc
ccccEEEEEcccccEEEEEEccccEEEEEEEcccccccccccEEEEccccEEccccccccccccEHHHHHHHcHcccccccccccc
MKLSNVVISEVQGqlritvkksrpllgmaieggantkhplpriiNIHDklkissmsqiptpyhfTYRELKSdirssratqdnseev
mklsnvvisevqgqlritvkksrplLGMAIeggantkhplpRIINIHDKLKISSMSQIPTPYHFTYRELKsdirssratqdnseev
MKLSNVVISEVQGQLRITVKKSRPLLGMAIEGGANTKHPLPRIINIHDKLKISSMSQIPTPYHFTYRELKSDIRSSRATQDNSEEV
******VISEVQGQLRITVKKSRPLLGMAIEGGANTKHPLPRIINIHDKLKISSMSQIPTPYHFTYR*******************
****NVV*SEVQGQLRITVKKSRPLLGMAIEGGANTKHPLPRIINIHDKLKISSMSQIPTPYHFTYREL*****************
MKLSNVVISEVQGQLRITVKKSRPLLGMAIEGGANTKHPLPRIINIHDKLKISSMSQIPTPYHFTYRELKSD**************
*KLSNVVISEVQGQLRITVKKSRPLLGMAIEGGANTKHPLPRIINIHDKLKISSMSQIPTPYHFTYRELKSD**************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLSNVVISEVQGQLRITVKKSRPLLGMAIEGGANTKHPLPRIINIHDKLKISSMSQIPTPYHFTYRELKSDIRSSRATQDNSEEV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query86 2.2.26 [Sep-21-2011]
Q9P202907 Whirlin OS=Homo sapiens G no N/A 0.360 0.034 0.645 0.0001
Q810W9920 Whirlin OS=Rattus norvegi yes N/A 0.360 0.033 0.645 0.0001
Q80VW5918 Whirlin OS=Mus musculus G yes N/A 0.360 0.033 0.612 0.0002
>sp|Q9P202|WHRN_HUMAN Whirlin OS=Homo sapiens GN=DFNB31 PE=1 SV=3 Back     alignment and function desciption
 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/31 (64%), Positives = 24/31 (77%)

Query: 17  ITVKKSRPLLGMAIEGGANTKHPLPRIINIH 47
           + VKKS   LG+AIEGGANT+ PLPRI+ I 
Sbjct: 817 VRVKKSAATLGIAIEGGANTRQPLPRIVTIQ 847
Necessary for elongation and maintenance of inner and outer hair cell stereocilia in the organ of Corti in the inner ear.
Homo sapiens (taxid: 9606)
>sp|Q810W9|WHRN_RAT Whirlin OS=Rattus norvegicus GN=Dfnb31 PE=1 SV=1 Back     alignment and function description
>sp|Q80VW5|WHRN_MOUSE Whirlin OS=Mus musculus GN=Dfnb31 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query86
345495943 841 PREDICTED: whirlin-like [Nasonia vitripe 0.5 0.051 0.790 9e-12
322786098 190 hypothetical protein SINV_03961 [Solenop 0.5 0.226 0.744 4e-11
307173064125 Whirlin [Camponotus floridanus] 0.5 0.344 0.744 4e-11
383848652 862 PREDICTED: whirlin-like [Megachile rotun 0.5 0.049 0.744 5e-11
350404682 841 PREDICTED: whirlin-like isoform 1 [Bombu 0.5 0.051 0.744 5e-11
340721005 863 PREDICTED: whirlin-like isoform 2 [Bombu 0.5 0.049 0.744 5e-11
350404685 863 PREDICTED: whirlin-like isoform 2 [Bombu 0.5 0.049 0.744 5e-11
340721003 841 PREDICTED: whirlin-like isoform 1 [Bombu 0.5 0.051 0.744 5e-11
328787276 861 PREDICTED: whirlin-like [Apis mellifera] 0.5 0.049 0.744 5e-11
380027042 861 PREDICTED: whirlin-like [Apis florea] 0.5 0.049 0.744 5e-11
>gi|345495943|ref|XP_003427605.1| PREDICTED: whirlin-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score = 74.3 bits (181), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 38/43 (88%)

Query: 6   VVISEVQGQLRITVKKSRPLLGMAIEGGANTKHPLPRIINIHD 48
           VV+ + QG LRI VKKS+P LG+AIEGGANTKHPLPRIINIHD
Sbjct: 727 VVVPDHQGNLRIIVKKSKPTLGIAIEGGANTKHPLPRIINIHD 769

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|322786098|gb|EFZ12707.1| hypothetical protein SINV_03961 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307173064|gb|EFN64194.1| Whirlin [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383848652|ref|XP_003699962.1| PREDICTED: whirlin-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350404682|ref|XP_003487185.1| PREDICTED: whirlin-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340721005|ref|XP_003398918.1| PREDICTED: whirlin-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350404685|ref|XP_003487186.1| PREDICTED: whirlin-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340721003|ref|XP_003398917.1| PREDICTED: whirlin-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|328787276|ref|XP_393801.4| PREDICTED: whirlin-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380027042|ref|XP_003697245.1| PREDICTED: whirlin-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query86
FB|FBgn0264006990 dysc "dyschronic" [Drosophila 0.488 0.042 0.714 4.3e-11
UNIPROTKB|F1NVH8824 F1NVH8 "Uncharacterized protei 0.348 0.036 0.7 5.4e-05
UNIPROTKB|F1SMK0467 DFNB31 "Uncharacterized protei 0.348 0.064 0.666 6.9e-05
UNIPROTKB|E1B914918 LOC533033 "Uncharacterized pro 0.348 0.032 0.7 0.00013
UNIPROTKB|Q9P202907 DFNB31 "Whirlin" [Homo sapiens 0.348 0.033 0.666 0.00016
UNIPROTKB|E2R2H6927 DFNB31 "Uncharacterized protei 0.348 0.032 0.666 0.00017
RGD|631330920 Dfnb31 "deafness, autosomal re 0.348 0.032 0.666 0.00027
MGI|MGI:2682003918 Whrn "whirlin" [Mus musculus ( 0.348 0.032 0.633 0.00034
FB|FBgn0264006 dysc "dyschronic" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 166 (63.5 bits), Expect = 4.3e-11, P = 4.3e-11
 Identities = 30/42 (71%), Positives = 38/42 (90%)

Query:     7 VISEVQGQLRITVKKSRPLLGMAIEGGANTKHPLPRIINIHD 48
             V+ + +G L ITVKK++P+LG+AIEGGANTKHPLPRIINIH+
Sbjct:   877 VVPDHRGNLHITVKKTKPILGIAIEGGANTKHPLPRIINIHE 918
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0046716 "muscle cell homeostasis" evidence=IGI;IMP
GO:0042052 "rhabdomere development" evidence=IMP
GO:0072499 "photoreceptor cell axon guidance" evidence=IMP
GO:0045475 "locomotor rhythm" evidence=IMP
GO:0032414 "positive regulation of ion transmembrane transporter activity" evidence=IMP
UNIPROTKB|F1NVH8 F1NVH8 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SMK0 DFNB31 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1B914 LOC533033 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9P202 DFNB31 "Whirlin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2R2H6 DFNB31 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|631330 Dfnb31 "deafness, autosomal recessive 31" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2682003 Whrn "whirlin" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 86
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 96.26
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 89.61
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information 
Probab=96.26  E-value=0.0054  Score=36.20  Aligned_cols=60  Identities=13%  Similarity=0.221  Sum_probs=48.8

Q ss_pred             EEEEec-cCCceeeEEecCCCCCCCCceEEEEcCCCceeccCCCCCcee-----------eehhhhhhhhhhc
Q psy17151         16 RITVKK-SRPLLGMAIEGGANTKHPLPRIINIHDKLKISSMSQIPTPYH-----------FTYRELKSDIRSS   76 (86)
Q Consensus        16 ~i~V~K-~~~~LGIAIEGGaNTRqPLPRIitIq~gGsA~~cgqLkv~~~-----------~~~~~~~~~~~~~   76 (86)
                      +|++.| ...-||+.+.++.....+-..|..|.++|.|...| |++|-.           ++..+...-++++
T Consensus         1 ~v~l~k~~~~~lG~~l~~~~~~~~~~~~V~~v~~~~~a~~~g-l~~GD~Il~INg~~v~~~~~~~~~~~l~~~   72 (81)
T PF00595_consen    1 QVTLEKSGNGPLGFTLRGGSDNDEKGVFVSSVVPGSPAERAG-LKVGDRILEINGQSVRGMSHDEVVQLLKSA   72 (81)
T ss_dssp             EEEEEESTTSBSSEEEEEESTSSSEEEEEEEECTTSHHHHHT-SSTTEEEEEETTEESTTSBHHHHHHHHHHS
T ss_pred             CEEEEeCCCCCcCEEEEecCCCCcCCEEEEEEeCCChHHhcc-cchhhhhheeCCEeCCCCCHHHHHHHHHCC
Confidence            467777 88899999999999887788999999999999999 999875           4555655555554

PDZ domains can occur in one or multiple copies and are nearly always found in cytoplasmic proteins. They bind either the carboxyl-terminal sequences of proteins or internal peptide sequences []. In most cases, interaction between a PDZ domain and its target is constitutive, with a binding affinity of 1 to 10 microns. However, agonist-dependent activation of cell surface receptors is sometimes required to promote interaction with a PDZ protein. PDZ domain proteins are frequently associated with the plasma membrane, a compartment where high concentrations of phosphatidylinositol 4,5-bisphosphate (PIP2) are found. Direct interaction between PIP2 and a subset of class II PDZ domains (syntenin, CASK, Tiam-1) has been demonstrated. PDZ domains consist of 80 to 90 amino acids comprising six beta-strands (beta-A to beta-F) and two alpha-helices, A and B, compactly arranged in a globular structure. Peptide binding of the ligand takes place in an elongated surface groove as an anti-parallel beta-strand interacts with the beta-B strand and the B helix. The structure of PDZ domains allows binding to a free carboxylate group at the end of a peptide through a carboxylate-binding loop between the beta-A and beta-B strands.; GO: 0005515 protein binding; PDB: 3AXA_A 1WF8_A 1QAV_B 1QAU_A 1B8Q_A 1MC7_A 2KAW_A 1I16_A 1VB7_A 1WI4_A ....
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query86
1ufx_A103 Solution Structure Of The Third Pdz Domain Of Human 6e-06
>pdb|1UFX|A Chain A, Solution Structure Of The Third Pdz Domain Of Human Kiaa1526 Protein Length = 103 Back     alignment and structure 
Iteration: 1

 Score = 45.8 bits (107), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 20/31 (64%), Positives = 24/31 (77%)
Query: 17 ITVKKSRPLLGMAIEGGANTKHPLPRIINIH 47
          + VKKS   LG+AIEGGANT+ PLPRI+ I 
Sbjct: 10 VRVKKSAATLGIAIEGGANTRQPLPRIVTIQ 40

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query86
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 1e-04
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
 Score = 36.2 bits (84), Expect = 1e-04
 Identities = 20/32 (62%), Positives = 24/32 (75%)

Query: 17 ITVKKSRPLLGMAIEGGANTKHPLPRIINIHD 48
          + VKKS   LG+AIEGGANT+ PLPRI+ I  
Sbjct: 10 VRVKKSAATLGIAIEGGANTRQPLPRIVTIQR 41

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query86
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 97.9
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 96.99
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 96.63
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 96.58
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 96.56
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 96.47
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 96.31
2opg_A98 Multiple PDZ domain protein; structural protein, s 96.29
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 96.29
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 96.13
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 96.11
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 96.09
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 96.05
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 96.01
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 95.93
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 95.93
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 95.93
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 95.9
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 95.9
2awx_A105 Synapse associated protein 97; membrane protein, s 95.89
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 95.85
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 95.82
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 95.82
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 95.8
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 95.79
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 95.77
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 95.75
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 95.67
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 95.65
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 95.64
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 95.54
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 95.54
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 95.52
3r0h_A 206 INAD, inactivation-NO-after-potential D protein; p 95.5
2byg_A117 Channel associated protein of synapse-110; DLG2, P 95.45
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 95.36
3gsl_A 196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 95.34
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 95.27
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 95.18
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 95.11
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 95.1
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 95.08
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 94.98
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 94.97
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 94.94
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 94.91
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 94.9
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 94.9
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 94.88
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 94.82
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 94.8
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 94.8
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 94.79
2djt_A104 Unnamed protein product; PDZ domain, structural ge 94.78
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 94.76
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 94.72
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 94.64
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 94.6
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 94.5
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 94.49
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 94.46
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 94.42
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 94.34
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 94.26
2fne_A117 Multiple PDZ domain protein; structural protein, s 94.24
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 94.22
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 94.2
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 94.17
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 94.11
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 94.03
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 93.9
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 93.87
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 93.87
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 93.74
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 93.65
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 93.47
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 93.41
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 93.38
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 93.26
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 93.2
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 92.87
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 92.84
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 92.77
1p1d_A 196 PDZ45, glutamate receptor interacting protein; PDZ 92.6
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 92.43
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 92.39
4amh_A106 Disks large homolog 1; permutation, protein foldin 92.07
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 91.93
2o2t_A117 Multiple PDZ domain protein; structural protein, s 91.79
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 91.64
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 91.63
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 91.59
2ego_A96 General receptor for phosphoinositides 1- associat 91.58
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 91.56
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 91.4
1z87_A 263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 91.31
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 91.04
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 90.92
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 90.89
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 90.86
2qt5_A 200 Glutamate receptor-interacting protein 1; PDZ-pept 90.84
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 90.7
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 90.6
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 90.0
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 90.52
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 90.35
2v90_A96 PDZ domain-containing protein 3; membrane, protein 90.33
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 90.16
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 89.97
3k1r_A192 Harmonin; protein-protein complex, alternative spl 89.82
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 89.73
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 89.54
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 89.42
2eeh_A100 PDZ domain-containing protein 7; structural genomi 89.12
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 89.1
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 89.0
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 88.97
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 88.61
2d90_A102 PDZ domain containing protein 1; structural genomi 88.06
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 88.03
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 87.83
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 87.72
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 87.17
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 86.92
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 86.71
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 86.57
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 86.38
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 86.32
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 86.2
3khf_A99 Microtubule-associated serine/threonine-protein ki 86.15
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 85.58
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 85.37
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 85.05
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 85.01
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 84.94
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 84.37
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 84.23
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 84.21
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 83.78
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 83.07
2krg_A 216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 82.74
2eei_A106 PDZ domain-containing protein 1; regulatory factor 81.7
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 80.22
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
Probab=97.90  E-value=1.6e-05  Score=49.09  Aligned_cols=62  Identities=39%  Similarity=0.485  Sum_probs=53.7

Q ss_pred             eEEEEeccCCceeeEEecCCCCCCCCceEEEEcCCCceeccCCCCCcee-----------eehhhhhhhhhhc
Q psy17151         15 LRITVKKSRPLLGMAIEGGANTKHPLPRIINIHDKLKISSMSQIPTPYH-----------FTYRELKSDIRSS   76 (86)
Q Consensus        15 l~i~V~K~~~~LGIAIEGGaNTRqPLPRIitIq~gGsA~~cgqLkv~~~-----------~~~~~~~~~~~~~   76 (86)
                      -.|+++|...-||+.|.||....+|+|.|..|..++.|+.+|+|+.|-.           +++.|+..-|+++
T Consensus         8 ~~v~l~k~~~glG~~i~gg~~~~~~~~~I~~v~~~s~A~~aG~L~~GD~Il~Vng~~v~~~~~~~~~~~l~~~   80 (103)
T 1ufx_A            8 TLVRVKKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGHVILEVNGLTLRGKEHREAARIIAEA   80 (103)
T ss_dssp             EEEEEECCSSSCCEEEECBTTSSCSSCEEEEECTTSHHHHHCSSCTTCBCCEETTEECTTCBHHHHHHHHHHH
T ss_pred             EEEEEEcCCCcCCeEEECCCCCCCCcEEEEEeCCCChHHHCCCCCCCCEEEEECCEECCCCCHHHHHHHHHHh
Confidence            3577888888999999999999999999999999999999999988753           4677887777765
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 86
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 0.003
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure

class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: KIAA1526 protein
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 31.4 bits (71), Expect = 0.003
 Identities = 20/32 (62%), Positives = 24/32 (75%)

Query: 17 ITVKKSRPLLGMAIEGGANTKHPLPRIINIHD 48
          + VKKS   LG+AIEGGANT+ PLPRI+ I  
Sbjct: 10 VRVKKSAATLGIAIEGGANTRQPLPRIVTIQR 41

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query86
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.46
d1x45a185 Amyloid beta A4 precursor protein-binding family A 97.88
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 97.85
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 97.72
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 97.65
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 97.64
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 97.63
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 97.63
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 97.55
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 97.54
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 97.53
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 97.52
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 97.45
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 97.44
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 97.44
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 97.43
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 97.41
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 97.3
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 97.26
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 97.18
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 97.16
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 97.15
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 97.07
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 97.07
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 97.06
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 96.97
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 96.86
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 96.82
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 96.76
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 96.7
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 96.69
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 96.66
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 96.63
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 96.62
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 96.6
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 96.41
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 96.33
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 96.33
d1rzxa_98 GTPase-binding domain of the cell polarity protein 96.3
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 96.3
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 96.12
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 96.07
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 95.85
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 95.65
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 95.64
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 95.57
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 95.23
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 94.5
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 94.33
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 94.26
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 94.17
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 94.14
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 92.39
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 92.2
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 91.22
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 90.73
d1y7na179 Amyloid beta A4 precursor protein-binding family A 90.57
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 90.42
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 88.72
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 86.48
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 85.48
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: KIAA1526 protein
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.46  E-value=1.1e-07  Score=59.05  Aligned_cols=65  Identities=38%  Similarity=0.460  Sum_probs=58.0

Q ss_pred             eEEEEeccCCceeeEEecCCCCCCCCceEEEEcCCCceeccCCCCCce-----------eeehhhhhhhhhhcccc
Q psy17151         15 LRITVKKSRPLLGMAIEGGANTKHPLPRIINIHDKLKISSMSQIPTPY-----------HFTYRELKSDIRSSRAT   79 (86)
Q Consensus        15 l~i~V~K~~~~LGIAIEGGaNTRqPLPRIitIq~gGsA~~cgqLkv~~-----------~~~~~~~~~~~~~~~~~   79 (86)
                      .-|+++|...-|||.|.||...++|.+.|-.|..+|.|+.||.|++|-           ++++.|...-||.+..+
T Consensus         8 ~vv~~~k~~~~lG~~i~gg~~~~~~~~~I~~i~~gg~A~~~G~L~~GD~Il~VNg~~v~~~s~~e~~~~l~~a~~~   83 (103)
T d1ufxa_           8 TLVRVKKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGHVILEVNGLTLRGKEHREAARIIAEAFKT   83 (103)
T ss_dssp             EEEEEECCSSSCCEEEECBTTSSCSSCEEEEECTTSHHHHHCSSCTTCBCCEETTEECTTCBHHHHHHHHHHHHHC
T ss_pred             EEEEEEeCCCccCEEEeeecCCCCCCEEEEEEcCCcchhhcCCCCCCCEEEEECCEECCCCcHHHHHHHHHHccCC
Confidence            348899999999999999999999999999999999999999999985           47899999989886443
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure