Psyllid ID: psy17185


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-
IAAKRNPEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSGGQFKFMENINKGLTFIAITPQVFSNDSITIHSGTGSHLTQPEWGREKPAACDCPDGHPSGY
ccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHcHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHcccccccccEEEEcccccccccccccccccccccccccccccc
ccccccHHHHHHHHHHHHHHHcccccccccHHHHHHccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHccccccccccEEEEEEccccccccccccccccccccccccccccc
iaakrnpeqdKEAQAWIETVtgqkfpagvlyedaiKDGQILCHLINklkpgsvakinssggqfkFMENINKGLTFiaitpqvfsndsitihsgtgshltqpewgrekpaacdcpdghpsgy
iaakrnpeqdkeaQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSGGQFKFMENINKGLTFIAITPQVFSNDSITIHSGTGSHLTQPEWGREKPAACDCPDGHPSGY
IAAKRNPEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSGGQFKFMENINKGLTFIAITPQVFSNDSITIHSGTGSHLTQPEWGREKPAACDCPDGHPSGY
**************AWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSGGQFKFMENINKGLTFIAITPQVFSNDSITIH******************************
*AAKRNPEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSGGQFKFMENINKGLTFIAITPQVFSNDSITIHSGTGSHLTQP********************
************AQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSGGQFKFMENINKGLTFIAITPQVFSNDSITIHSGTGSHLTQPEWGREKPAACDC********
**AKRNPEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSGGQFKFMENINKGLTFIAITPQVFSNDSITIHSGTG************PAACDCPDG*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IAAKRNPEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSGGQFKFMENINKGLTFIAITPQVFSNDSITIHSGTGSHLTQPEWGREKPAACDCPDGHPSGY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query121 2.2.26 [Sep-21-2011]
P14318184 Muscle-specific protein 2 yes N/A 0.578 0.380 0.714 1e-24
Q24799190 Myophilin OS=Echinococcus N/A N/A 0.603 0.384 0.472 3e-13
Q08092 297 Calponin-1 OS=Sus scrofa yes N/A 0.644 0.262 0.421 2e-10
Q08290 297 Calponin-1 OS=Rattus norv yes N/A 0.644 0.262 0.409 3e-10
P51911 297 Calponin-1 OS=Homo sapien yes N/A 0.644 0.262 0.421 3e-10
Q9GK38 297 Calponin-1 OS=Mustela put N/A N/A 0.644 0.262 0.409 3e-10
Q08091 297 Calponin-1 OS=Mus musculu yes N/A 0.644 0.262 0.409 4e-10
Q2HJ38 297 Calponin-1 OS=Bos taurus yes N/A 0.644 0.262 0.409 4e-10
Q7YRL2 297 Calponin-1 OS=Ovis aries N/A N/A 0.644 0.262 0.409 4e-10
P26932 292 Calponin-1 OS=Gallus gall no N/A 0.611 0.253 0.421 7e-10
>sp|P14318|MP20_DROME Muscle-specific protein 20 OS=Drosophila melanogaster GN=Mp20 PE=2 SV=2 Back     alignment and function desciption
 Score =  111 bits (278), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 57/70 (81%)

Query: 1  IAAKRNPEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSG 60
          IA+KRNPE DKEAQ WIE +  +KFPAG  YED +KDGQ+LC LIN L P +V K+NSSG
Sbjct: 11 IASKRNPEMDKEAQEWIEAIIAEKFPAGQSYEDVLKDGQVLCKLINVLSPNAVPKVNSSG 70

Query: 61 GQFKFMENIN 70
          GQFKFMENIN
Sbjct: 71 GQFKFMENIN 80





Drosophila melanogaster (taxid: 7227)
>sp|Q24799|MYPH_ECHGR Myophilin OS=Echinococcus granulosus PE=2 SV=1 Back     alignment and function description
>sp|Q08092|CNN1_PIG Calponin-1 OS=Sus scrofa GN=CNN1 PE=2 SV=1 Back     alignment and function description
>sp|Q08290|CNN1_RAT Calponin-1 OS=Rattus norvegicus GN=Cnn1 PE=2 SV=1 Back     alignment and function description
>sp|P51911|CNN1_HUMAN Calponin-1 OS=Homo sapiens GN=CNN1 PE=1 SV=2 Back     alignment and function description
>sp|Q9GK38|CNN1_MUSPF Calponin-1 OS=Mustela putorius furo GN=CNN1 PE=2 SV=1 Back     alignment and function description
>sp|Q08091|CNN1_MOUSE Calponin-1 OS=Mus musculus GN=Cnn1 PE=2 SV=1 Back     alignment and function description
>sp|Q2HJ38|CNN1_BOVIN Calponin-1 OS=Bos taurus GN=CNN1 PE=2 SV=1 Back     alignment and function description
>sp|Q7YRL2|CNN1_SHEEP Calponin-1 OS=Ovis aries GN=CNN1 PE=2 SV=1 Back     alignment and function description
>sp|P26932|CNN1_CHICK Calponin-1 OS=Gallus gallus GN=CNN1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query121
195379924184 GJ21167 [Drosophila virilis] gi|19414351 0.578 0.380 0.771 3e-26
328793950190 PREDICTED: muscle-specific protein 20-li 0.619 0.394 0.72 4e-26
242019570184 Muscle-specific protein, putative [Pedic 0.578 0.380 0.8 5e-26
380020769184 PREDICTED: muscle-specific protein 20-li 0.578 0.380 0.757 8e-26
307213390 1392 Alpha-N-acetylgalactosaminidase [Harpegn 0.578 0.050 0.742 1e-25
332025551 934 Alpha-N-acetylgalactosaminidase [Acromyr 0.578 0.074 0.728 2e-25
350418262184 PREDICTED: muscle-specific protein 20-li 0.578 0.380 0.757 2e-25
238655501155 muscular protein 20 [Stenosis syrensis] 0.578 0.451 0.771 3e-25
340726638184 PREDICTED: muscle-specific protein 20-li 0.578 0.380 0.742 5e-25
66514697184 PREDICTED: muscle-specific protein 20 [A 0.578 0.380 0.742 5e-25
>gi|195379924|ref|XP_002048722.1| GJ21167 [Drosophila virilis] gi|194143519|gb|EDW59915.1| GJ21167 [Drosophila virilis] Back     alignment and taxonomy information
 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%)

Query: 1  IAAKRNPEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSG 60
          IA KRNPE DKEAQ WIE + G+KFPAG +YED +KDGQ+LC+LINKL+PG+VAKINSSG
Sbjct: 11 IAGKRNPEMDKEAQEWIEAILGEKFPAGQVYEDVLKDGQVLCNLINKLQPGAVAKINSSG 70

Query: 61 GQFKFMENIN 70
          GQFKFMEN+N
Sbjct: 71 GQFKFMENLN 80




Source: Drosophila virilis

Species: Drosophila virilis

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328793950|ref|XP_001120602.2| PREDICTED: muscle-specific protein 20-like [Apis mellifera] Back     alignment and taxonomy information
>gi|242019570|ref|XP_002430233.1| Muscle-specific protein, putative [Pediculus humanus corporis] gi|212515333|gb|EEB17495.1| Muscle-specific protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|380020769|ref|XP_003694251.1| PREDICTED: muscle-specific protein 20-like [Apis florea] Back     alignment and taxonomy information
>gi|307213390|gb|EFN88826.1| Alpha-N-acetylgalactosaminidase [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332025551|gb|EGI65714.1| Alpha-N-acetylgalactosaminidase [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|350418262|ref|XP_003491803.1| PREDICTED: muscle-specific protein 20-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|238655501|emb|CAT00502.1| muscular protein 20 [Stenosis syrensis] gi|238655503|emb|CAT00503.1| muscular protein 20 [Stenosis syrensis] gi|269944611|emb|CBA65988.1| muscular protein 20 [Stenosis syrensis] gi|269944613|emb|CBA65990.1| muscular protein 20 [Stenosis syrensis] gi|269944615|emb|CBA65992.1| muscular protein 20 [Stenosis syrensis] gi|269944617|emb|CBA65995.1| muscular protein 20 [Stenosis syrensis] gi|269944619|emb|CBA66000.1| muscular protein 20 [Stenosis syrensis] gi|269944623|emb|CBA66006.1| muscular protein 20 [Stenosis syrensis] gi|269944625|emb|CBA66008.1| muscular protein 20 [Stenosis syrensis] gi|269944627|emb|CBA66011.1| muscular protein 20 [Stenosis syrensis] Back     alignment and taxonomy information
>gi|340726638|ref|XP_003401662.1| PREDICTED: muscle-specific protein 20-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|66514697|ref|XP_392501.2| PREDICTED: muscle-specific protein 20 [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query121
FB|FBgn0002789184 Mp20 "Muscle protein 20" [Dros 0.578 0.380 0.714 5.3e-24
ZFIN|ZDB-GENE-091118-54 296 cnn1b "calponin 1, basic, smoo 0.553 0.226 0.449 2e-14
UNIPROTKB|B4DUX6 277 CNN1 "cDNA FLJ59763, highly si 0.694 0.303 0.417 3e-14
UNIPROTKB|P51911 297 CNN1 "Calponin-1" [Homo sapien 0.694 0.282 0.417 5.2e-14
FB|FBgn0038774169 CG5023 [Drosophila melanogaste 0.561 0.402 0.521 1.6e-13
ZFIN|ZDB-GENE-090312-141 287 cnn1a "calponin 1, basic, smoo 0.553 0.233 0.391 3.7e-13
ZFIN|ZDB-GENE-030131-5130 329 cnn3a "calponin 3, acidic a" [ 0.694 0.255 0.406 9.9e-13
UNIPROTKB|F1NQT1 292 CNN3 "Uncharacterized protein" 0.628 0.260 0.435 1.3e-12
ZFIN|ZDB-GENE-050522-263 331 cnn3b "calponin 3, acidic b" [ 0.694 0.253 0.406 2.1e-12
UNIPROTKB|E1BSX2 331 CNN3 "Uncharacterized protein" 0.628 0.229 0.435 2.8e-12
FB|FBgn0002789 Mp20 "Muscle protein 20" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 275 (101.9 bits), Expect = 5.3e-24, P = 5.3e-24
 Identities = 50/70 (71%), Positives = 57/70 (81%)

Query:     1 IAAKRNPEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSG 60
             IA+KRNPE DKEAQ WIE +  +KFPAG  YED +KDGQ+LC LIN L P +V K+NSSG
Sbjct:    11 IASKRNPEMDKEAQEWIEAIIAEKFPAGQSYEDVLKDGQVLCKLINVLSPNAVPKVNSSG 70

Query:    61 GQFKFMENIN 70
             GQFKFMENIN
Sbjct:    71 GQFKFMENIN 80




GO:0005509 "calcium ion binding" evidence=ISS
GO:0043292 "contractile fiber" evidence=NAS
GO:0003779 "actin binding" evidence=ISS
GO:0008360 "regulation of cell shape" evidence=IMP
GO:0007155 "cell adhesion" evidence=IMP
GO:0007520 "myoblast fusion" evidence=IMP
ZFIN|ZDB-GENE-091118-54 cnn1b "calponin 1, basic, smooth muscle, b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|B4DUX6 CNN1 "cDNA FLJ59763, highly similar to Calponin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P51911 CNN1 "Calponin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0038774 CG5023 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090312-141 cnn1a "calponin 1, basic, smooth muscle, a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5130 cnn3a "calponin 3, acidic a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NQT1 CNN3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050522-263 cnn3b "calponin 3, acidic b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BSX2 CNN3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P14318MP20_DROMENo assigned EC number0.71420.57850.3804yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
cd00014107 cd00014, CH, Calponin homology domain; actin-bindi 1e-13
smart00033101 smart00033, CH, Calponin homology domain 4e-11
pfam00307104 pfam00307, CH, Calponin homology (CH) domain 6e-10
COG5199178 COG5199, SCP1, Calponin [Cytoskeleton] 3e-09
COG5261 1054 COG5261, IQG1, Protein involved in regulation of c 3e-06
>gnl|CDD|237981 cd00014, CH, Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) Back     alignment and domain information
 Score = 61.6 bits (150), Expect = 1e-13
 Identities = 25/71 (35%), Positives = 34/71 (47%), Gaps = 2/71 (2%)

Query: 8  EQDKEAQAWIETVTGQKFPAGVL-YEDAIKDGQILCHLINKLKPGSVAKINS-SGGQFKF 65
           Q +E   WI  V G+  P  +  +   +KDG  LC L+N L P  + K       +FK 
Sbjct: 1  SQKEELLRWINKVLGEYGPVTINNFSTDLKDGIALCKLLNSLSPDLIDKKKINPLSRFKR 60

Query: 66 MENINKGLTFI 76
          +ENIN  L F 
Sbjct: 61 LENINLALNFA 71


The CH domain is found in cytoskeletal and signal transduction proteins, including actin-binding proteins like spectrin, alpha-actinin, dystrophin, utrophin, and fimbrin, proteins essential for regulation of cell shape (cortexillins), and signaling proteins (Vav). Length = 107

>gnl|CDD|214479 smart00033, CH, Calponin homology domain Back     alignment and domain information
>gnl|CDD|215849 pfam00307, CH, Calponin homology (CH) domain Back     alignment and domain information
>gnl|CDD|227526 COG5199, SCP1, Calponin [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|227586 COG5261, IQG1, Protein involved in regulation of cellular morphogenesis/cytokinesis [Cell division and chromosome partitioning / Signal transduction mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 121
KOG2046|consensus193 100.0
COG5199178 SCP1 Calponin [Cytoskeleton] 99.93
cd00014107 CH Calponin homology domain; actin-binding domain 99.77
smart00033103 CH Calponin homology domain. Actin binding domains 99.7
KOG2128|consensus 1401 99.7
PF00307108 CH: Calponin homology (CH) domain; InterPro: IPR00 99.58
COG5261 1054 IQG1 Protein involved in regulation of cellular mo 99.57
KOG2996|consensus 865 99.46
KOG0532|consensus722 99.27
KOG0046|consensus 627 99.08
PF1197185 CAMSAP_CH: CAMSAP CH domain; InterPro: IPR022613 T 98.31
KOG0046|consensus 627 98.21
KOG0517|consensus 2473 97.5
COG5069 612 SAC6 Ca2+-binding actin-bundling protein fimbrin/p 96.54
PF0639589 CDC24: CDC24 Calponin; InterPro: IPR010481 This is 94.87
KOG3631|consensus 365 93.03
PF06294158 DUF1042: Domain of Unknown Function (DUF1042); Int 92.48
PF05622 713 HOOK: HOOK protein; InterPro: IPR008636 This famil 87.14
COG5069 612 SAC6 Ca2+-binding actin-bundling protein fimbrin/p 80.39
>KOG2046|consensus Back     alignment and domain information
Probab=100.00  E-value=9.6e-33  Score=206.12  Aligned_cols=106  Identities=36%  Similarity=0.497  Sum_probs=95.6

Q ss_pred             CCCcCCHHHHHHHHHHHHHHhCCCCCCcchHHHHhhhHHHHHHHHHhhcCCCcccccCCCCchhHHHHHHHHHHhhh---
Q psy17185          1 IAAKRNPEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSGGQFKFMENINKGLTFIA---   77 (121)
Q Consensus         1 ~~~k~d~~~e~~~~~WIe~vl~~~~~~~~~~~~~LrDGviLC~L~N~l~P~~v~ki~~~~~~f~~~eNI~~FL~ac~---   77 (121)
                      |++|||++++.++++||+.+.....+...+|.+.|+||+|||+|+|+|+|++++++++|++.|+|||||++|+++|+   
T Consensus        18 ~~~k~~~~~~~el~~WI~~~~~~~~~~~~~f~~~LKDG~iLCkl~N~l~p~~~~~~~~s~~~f~qmEnIs~Fi~a~~~yg   97 (193)
T KOG2046|consen   18 IESKYDDELEKELREWIENVVLTELPARGDFQDLLKDGVILCKLINKLYPGVVKKINESKMAFVQMENISNFIKAAKKYG   97 (193)
T ss_pred             hhcccCHHHHHHHHHHHHHhhccCCCcccCHHHHHcchHHHHHHHHHhCcCcccccccccccHHHHHHHHHHHHHHHhcC
Confidence            57999999999999999998666666555899999999999999999999999999999999999999999999998   


Q ss_pred             -------hccceecCCCh-----hHHHHHHhhhcCCCCCCc
Q psy17185         78 -------ITPQVFSNDSI-----TIHSGTGSHLTQPEWGRE  106 (121)
Q Consensus        78 -------~~~DLfe~kn~-----~L~aL~~~a~~~~~~~gp  106 (121)
                             |++||||++|+     ||++|++.|++...+.||
T Consensus        98 v~~~d~FqtvDLfE~kd~~~V~vtL~aLa~~a~~~~~~~~~  138 (193)
T KOG2046|consen   98 VPEVDLFQTVDLFEGKDMAQVQVTLLALARKAQKKGLFSGP  138 (193)
T ss_pred             CChhhcccccccccCCCHHHHHHHHHHHHHHHhhccccCCC
Confidence                   99999999999     999999999976433333



>COG5199 SCP1 Calponin [Cytoskeleton] Back     alignment and domain information
>cd00014 CH Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) Back     alignment and domain information
>smart00033 CH Calponin homology domain Back     alignment and domain information
>KOG2128|consensus Back     alignment and domain information
>PF00307 CH: Calponin homology (CH) domain; InterPro: IPR001715 The calponin homology domain (also known as CH-domain) is a superfamily of actin-binding domains found in both cytoskeletal proteins and signal transduction proteins [] Back     alignment and domain information
>COG5261 IQG1 Protein involved in regulation of cellular morphogenesis/cytokinesis [Cell division and chromosome partitioning / Signal transduction mechanisms] Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>PF11971 CAMSAP_CH: CAMSAP CH domain; InterPro: IPR022613 This domain is the N-terminal CH domain from calmodulin-regulated spectrin-associated proteins - CAMSAP proteins Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>KOG0517|consensus Back     alignment and domain information
>COG5069 SAC6 Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton] Back     alignment and domain information
>PF06395 CDC24: CDC24 Calponin; InterPro: IPR010481 This is a calponin homology domain Back     alignment and domain information
>KOG3631|consensus Back     alignment and domain information
>PF06294 DUF1042: Domain of Unknown Function (DUF1042); InterPro: IPR010441 This is a family of proteins of unknown function Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>COG5069 SAC6 Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
1wyp_A136 Solution Structure Of The Ch Domain Of Human Calpon 3e-11
1wyn_A146 Solution Structure Of The Ch Domain Of Human Calpon 4e-10
1h67_A108 Nmr Structure Of The Ch Domain Of Calponin Length = 8e-10
1p2x_A159 Crystal Structure Of The Calponin-Homology Domain O 2e-06
1p5s_A203 Structure And Function Of The Calponin-Homology Dom 2e-06
>pdb|1WYP|A Chain A, Solution Structure Of The Ch Domain Of Human Calponin 1 Length = 136 Back     alignment and structure

Iteration: 1

Score = 63.2 bits (152), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 35/83 (42%), Positives = 51/83 (61%), Gaps = 5/83 (6%) Query: 1 IAAKRNPEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSG 60 +A K + ++++E + WIE VTG++ G + D +KDG ILC INKL+PGSV KIN S Sbjct: 10 LAQKYDHQREQELREWIEGVTGRRI--GNNFMDGLKDGIILCEFINKLQPGSVKKINEST 67 Query: 61 GQFKFMENIN---KGLTFIAITP 80 + +ENI K +T + P Sbjct: 68 QNWHQLENIGNFIKAITKYGVKP 90
>pdb|1WYN|A Chain A, Solution Structure Of The Ch Domain Of Human Calponin-2 Length = 146 Back     alignment and structure
>pdb|1H67|A Chain A, Nmr Structure Of The Ch Domain Of Calponin Length = 108 Back     alignment and structure
>pdb|1P2X|A Chain A, Crystal Structure Of The Calponin-Homology Domain Of Rng2 From Schizosaccharomyces Pombe Length = 159 Back     alignment and structure
>pdb|1P5S|A Chain A, Structure And Function Of The Calponin-Homology Domain Of An Iqgap Protein From Schizosaccharomyces Pombe Length = 203 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
1h67_A108 Calponin alpha; cytoskeleton, calponin homology do 2e-26
1wyp_A136 Calponin 1; CH domain, F-actin binding, all-alpha, 1e-24
1p5s_A203 RAS GTPase-activating-like protein RNG2; alpha-hel 6e-24
1p2x_A159 RNG2 protein, RAS GTPase-activating-like protein; 2e-22
1wyn_A146 Calponin-2; CH domain, F-actin binding, all alpha 1e-21
1wyr_A121 RHO guanine nucleotide exchange factor 6; CH domai 2e-21
1ujo_A144 Transgelin; CH domain, actin binding, structural g 3e-21
2rr8_A190 Iqgap1 protein; F-actin binding protein, protein b 3e-19
3i6x_A193 P195, RAS GTPase-activating-like protein iqgap1; a 9e-19
1wym_A155 Transgelin-2; CH domain, F-actin binding, all heli 4e-18
2l3g_A126 RHO guanine nucleotide exchange factor 7; structur 4e-17
2yrn_A129 Neuron navigator 2 isoform 4; calponin homolgy dom 7e-07
2wa7_A 245 Filamin-B; disease mutation, skeletal dysplasia, s 3e-06
1aoa_A 275 T-fimbrin; actin-binding protein, calcium-binding, 4e-06
1pxy_A 506 Fimbrin-like protein; calponin homology, F-actin-b 1e-05
1pxy_A 506 Fimbrin-like protein; calponin homology, F-actin-b 2e-05
3hoc_A 272 Filamin-A; calponin homology domain, actin binding 3e-05
1rt8_A 513 Fimbrin; filamentous actin binding domain (ABD), c 1e-04
1rt8_A 513 Fimbrin; filamentous actin binding domain (ABD), c 1e-04
3ky9_A 587 Proto-oncogene VAV; calponin homology domain, DBL 1e-04
1sh5_A 245 Plectin 1, PLTN, PCN; actin-binding domain, calpon 4e-04
1dxx_A 246 Dystrophin; structural protein, muscular dystrophy 8e-04
>1h67_A Calponin alpha; cytoskeleton, calponin homology domain, actin binding,; NMR {Gallus gallus} SCOP: a.40.1.1 Length = 108 Back     alignment and structure
 Score = 93.6 bits (233), Expect = 2e-26
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 2/70 (2%)

Query: 7  PEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSGGQFKFM 66
          P+ +++ + WIE  TG++      + D +KDG ILC LINKL+PGSV K+N     +  +
Sbjct: 2  PQTERQLRVWIEGATGRRIGDN--FMDGLKDGVILCELINKLQPGSVQKVNDPVQNWHKL 59

Query: 67 ENINKGLTFI 76
          ENI   L  I
Sbjct: 60 ENIGNFLRAI 69


>1wyp_A Calponin 1; CH domain, F-actin binding, all-alpha, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 136 Back     alignment and structure
>1p5s_A RAS GTPase-activating-like protein RNG2; alpha-helical bundle, cytokine; 2.22A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 203 Back     alignment and structure
>1p2x_A RNG2 protein, RAS GTPase-activating-like protein; helices, bundle, protein binding; 2.21A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 159 Back     alignment and structure
>1wyn_A Calponin-2; CH domain, F-actin binding, all alpha helix, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 146 Back     alignment and structure
>1wyr_A RHO guanine nucleotide exchange factor 6; CH domain, all-alpha, NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>1ujo_A Transgelin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: a.40.1.1 Length = 144 Back     alignment and structure
>2rr8_A Iqgap1 protein; F-actin binding protein, protein binding; NMR {Homo sapiens} Length = 190 Back     alignment and structure
>3i6x_A P195, RAS GTPase-activating-like protein iqgap1; all helical, calmodulin-binding, cell membrane, membrane, phosphoprotein, protein binding; 2.50A {Homo sapiens} Length = 193 Back     alignment and structure
>1wym_A Transgelin-2; CH domain, F-actin binding, all helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2l3g_A RHO guanine nucleotide exchange factor 7; structural genomics, northeast structural genomics consortiu PSI-biology, calponin-homology domain; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2yrn_A Neuron navigator 2 isoform 4; calponin homolgy domain, helicase, all alpha, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Length = 245 Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Length = 275 Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Length = 506 Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Length = 506 Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A 2wfn_A Length = 272 Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 513 Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 513 Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Length = 587 Back     alignment and structure
>1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Length = 245 Back     alignment and structure
>1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Length = 246 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query121
1wym_A155 Transgelin-2; CH domain, F-actin binding, all heli 100.0
1wyn_A146 Calponin-2; CH domain, F-actin binding, all alpha 100.0
1wyp_A136 Calponin 1; CH domain, F-actin binding, all-alpha, 100.0
1ujo_A144 Transgelin; CH domain, actin binding, structural g 100.0
1h67_A108 Calponin alpha; cytoskeleton, calponin homology do 99.98
1p2x_A159 RNG2 protein, RAS GTPase-activating-like protein; 99.97
2rr8_A190 Iqgap1 protein; F-actin binding protein, protein b 99.97
1p5s_A203 RAS GTPase-activating-like protein RNG2; alpha-hel 99.97
1wyr_A121 RHO guanine nucleotide exchange factor 6; CH domai 99.97
3i6x_A193 P195, RAS GTPase-activating-like protein iqgap1; a 99.96
2l3g_A126 RHO guanine nucleotide exchange factor 7; structur 99.96
3ky9_A 587 Proto-oncogene VAV; calponin homology domain, DBL 99.85
2yrn_A129 Neuron navigator 2 isoform 4; calponin homolgy dom 99.76
1pxy_A 506 Fimbrin-like protein; calponin homology, F-actin-b 99.65
1aoa_A 275 T-fimbrin; actin-binding protein, calcium-binding, 99.64
1wku_A 254 Alpha-actinin 3; calponin homology domain, actin b 99.62
1rt8_A 513 Fimbrin; filamentous actin binding domain (ABD), c 99.55
2wa7_A 245 Filamin-B; disease mutation, skeletal dysplasia, s 99.53
2qjz_A123 Microtubule-associated protein RP/EB family member 99.5
1wyo_A159 Protein EB3, microtubule-associated protein RP/EB 99.5
1dxx_A 246 Dystrophin; structural protein, muscular dystrophy 99.43
1sh5_A 245 Plectin 1, PLTN, PCN; actin-binding domain, calpon 99.42
3f7p_A 296 Plectin-1; plakin, hemidesmosome, cell adhesion, e 99.4
1sjj_A 863 Actinin; 3-helix bundle, calponin homology domain, 99.27
1rt8_A513 Fimbrin; filamentous actin binding domain (ABD), c 99.19
3hoc_A 272 Filamin-A; calponin homology domain, actin binding 99.1
2vzc_A131 Alpha-parvin; membrane, cytoplasm, cytoskeleton, c 99.04
1pxy_A 506 Fimbrin-like protein; calponin homology, F-actin-b 98.93
4b7l_A 347 Filamin-B; structural protein, FR 1 filamin hinge 98.78
1wjo_A124 T-plastin; CH domain, actin binding, structural ge 98.25
2r8u_A 268 Microtubule-associated protein RP/EB family member 97.72
2d87_A128 Smoothelin splice isoform L2; all alpha, calponin 97.62
4abo_I145 MAL3, microtubule integrity protein MAL3; structur 97.51
2d89_A119 EHBP1 protein; all alpha, calponin homology domain 97.42
2qjx_A127 Protein BIM1; calponin homology domain, protein bi 97.2
4b7l_A347 Filamin-B; structural protein, FR 1 filamin hinge 97.06
2d88_A121 Protein mical-3; all alpha, calponin homology doma 97.0
1wyq_A127 Spectrin beta chain, brain 2; NPPSFA, structural g 96.98
1wyl_A116 NEDD9 interacting protein with calponin homology a 96.88
1dxx_A246 Dystrophin; structural protein, muscular dystrophy 96.76
1wku_A254 Alpha-actinin 3; calponin homology domain, actin b 96.73
1bkr_A109 Spectrin beta chain; filamentous actin-binding dom 96.58
1bhd_A118 Utrophin; calponin homology, actin binding, struct 96.52
1sh5_A245 Plectin 1, PLTN, PCN; actin-binding domain, calpon 96.52
2wa7_A245 Filamin-B; disease mutation, skeletal dysplasia, s 96.32
1aoa_A275 T-fimbrin; actin-binding protein, calcium-binding, 96.24
3f7p_A296 Plectin-1; plakin, hemidesmosome, cell adhesion, e 95.94
3hoc_A272 Filamin-A; calponin homology domain, actin binding 95.91
2ee7_A127 Sperm flagellar protein 1; all alpha protein, CH d 95.01
1sjj_A 863 Actinin; 3-helix bundle, calponin homology domain, 93.8
1wix_A164 HOOK homolog 1, RSGI RUH-026; structural genomics, 93.32
>1wym_A Transgelin-2; CH domain, F-actin binding, all helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=2.3e-37  Score=224.34  Aligned_cols=116  Identities=23%  Similarity=0.318  Sum_probs=106.3

Q ss_pred             CCCcCCHHHHHHHHHHHHHHhCCCCCCc----chHHHHhhhHHHHHHHHHhhcC---CCcccccCCCCchhHHHHHHHHH
Q psy17185          1 IAAKRNPEQDKEAQAWIETVTGQKFPAG----VLYEDAIKDGQILCHLINKLKP---GSVAKINSSGGQFKFMENINKGL   73 (121)
Q Consensus         1 ~~~k~d~~~e~~~~~WIe~vl~~~~~~~----~~~~~~LrDGviLC~L~N~l~P---~~v~ki~~~~~~f~~~eNI~~FL   73 (121)
                      +++|||+++++++++||+++++++++.+    ++|+++||||||||+|+|.++|   ++|++|+.++++|+++|||+.||
T Consensus        10 ~~~ky~~~~e~e~~~WIe~~l~~~l~~~~~~~~~~~~~LkDGvvLCkL~N~l~P~~~~~i~kIn~~~~~F~~~eNI~~FL   89 (155)
T 1wym_A           10 IEKQYDADLEQILIQWITTQCRKDVGRPQPGRENFQNWLKDGTVLCELINALYPEGQAPVKKIQASTMAFKQMEQISQFL   89 (155)
T ss_dssp             CCCSCCHHHHHHHHHHHHHHSSSCCCCCCSSHHHHHHHHHTSHHHHHHHHHHSCTTTCSCCCCCCCCCHHHHHHHHHHHH
T ss_pred             HHccCCHHHHHHHHHHHHHHhCCCCCCCcccHHHHHHHHcchHHHHHHHHHhccccCCCcCcccCCCccccHHHHHHHHH
Confidence            5799999999999999999999999863    5899999999999999999999   99999999999999999999999


Q ss_pred             Hhhh----------hccceecCCCh-----hHHHHHHhhhcCCCCCCcccC----CCCCCCCCC
Q psy17185         74 TFIA----------ITPQVFSNDSI-----TIHSGTGSHLTQPEWGREKPA----ACDCPDGHP  118 (121)
Q Consensus        74 ~ac~----------~~~DLfe~kn~-----~L~aL~~~a~~~~~~~gp~~~----~~~~~~~~~  118 (121)
                      ++|+          +++||||++|+     ||++|+++|++++.  ||.++    .|+..++|+
T Consensus        90 ~ac~~~Gv~~~~lF~t~DL~e~kn~~~Vi~cL~aL~~~a~~~~~--gp~~g~p~~~~k~a~~n~  151 (155)
T 1wym_A           90 QAAERYGINTTDIFQTVDLWEGKNMACVQRTLMNLGGLAVARDD--GLFSGDPNWFPKKSKESG  151 (155)
T ss_dssp             HHHHHHTCCTTTCCCHHHHHTCSCHHHHHHHHHHHHHHHTTCSS--SCCCSCSSSSCCCCCCCC
T ss_pred             HHHHHcCCCccccCChHHHHhcCCHHHHHHHHHHHHHHHHHCCC--CCcCCCCCCCCcccccCC
Confidence            9999          89999999998     99999999998864  77766    467777776



>1wyn_A Calponin-2; CH domain, F-actin binding, all alpha helix, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1wyp_A Calponin 1; CH domain, F-actin binding, all-alpha, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1ujo_A Transgelin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: a.40.1.1 Back     alignment and structure
>1h67_A Calponin alpha; cytoskeleton, calponin homology domain, actin binding,; NMR {Gallus gallus} SCOP: a.40.1.1 Back     alignment and structure
>1p2x_A RNG2 protein, RAS GTPase-activating-like protein; helices, bundle, protein binding; 2.21A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>2rr8_A Iqgap1 protein; F-actin binding protein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1p5s_A RAS GTPase-activating-like protein RNG2; alpha-helical bundle, cytokine; 2.22A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>1wyr_A RHO guanine nucleotide exchange factor 6; CH domain, all-alpha, NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>3i6x_A P195, RAS GTPase-activating-like protein iqgap1; all helical, calmodulin-binding, cell membrane, membrane, phosphoprotein, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>2l3g_A RHO guanine nucleotide exchange factor 7; structural genomics, northeast structural genomics consortiu PSI-biology, calponin-homology domain; NMR {Homo sapiens} Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>2yrn_A Neuron navigator 2 isoform 4; calponin homolgy domain, helicase, all alpha, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Back     alignment and structure
>1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Back     alignment and structure
>2qjz_A Microtubule-associated protein RP/EB family member 1; calponin homology domain, microtubule plus END, +TIP, protein binding; 1.25A {Homo sapiens} SCOP: a.40.1.1 PDB: 1pa7_A 1ueg_A 3co1_A 1v5k_A Back     alignment and structure
>1wyo_A Protein EB3, microtubule-associated protein RP/EB family member 3; CH domain, microtubule-binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Back     alignment and structure
>1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Back     alignment and structure
>3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A Back     alignment and structure
>2vzc_A Alpha-parvin; membrane, cytoplasm, cytoskeleton, cell junction, alternative splicing, calponin homology domain, actin-binding, cell membrane; 1.05A {Homo sapiens} PDB: 2vzd_A* 2vzg_B* 2vzi_B* 2k2r_A 3kmu_B 3kmw_B* 3rep_B* Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Back     alignment and structure
>4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A Back     alignment and structure
>1wjo_A T-plastin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: a.40.1.1 PDB: 2d85_A Back     alignment and structure
>2r8u_A Microtubule-associated protein RP/EB family member 1; cytoskeleton, acetylation, cell cycle, cell division, cytoplasm, mitosis, phosphorylation; 1.35A {Homo sapiens} SCOP: a.40.1.1 PDB: 1vka_A 1txq_B 1wu9_A 2hkq_A 2hl5_A 3tq7_A 3gjo_A 1yib_A 1yig_A Back     alignment and structure
>2d87_A Smoothelin splice isoform L2; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2jv9_A 2k3s_A Back     alignment and structure
>4abo_I MAL3, microtubule integrity protein MAL3; structural protein, cytoskeleton, GTPase, END binding; HET: GTP GSP; 8.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2d89_A EHBP1 protein; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qjx_A Protein BIM1; calponin homology domain, protein binding; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A Back     alignment and structure
>2d88_A Protein mical-3; all alpha, calponin homology domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2e9k_A Back     alignment and structure
>1wyq_A Spectrin beta chain, brain 2; NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1wyl_A NEDD9 interacting protein with calponin homology and LIM domains; CH domain, mical, structural genomics; NMR {Homo sapiens} PDB: 2dk9_A Back     alignment and structure
>1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Back     alignment and structure
>1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K Back     alignment and structure
>1bkr_A Spectrin beta chain; filamentous actin-binding domain, cytoskeleton; 1.10A {Homo sapiens} SCOP: a.40.1.1 PDB: 1aa2_A Back     alignment and structure
>1bhd_A Utrophin; calponin homology, actin binding, structural protein; 2.00A {Homo sapiens} SCOP: a.40.1.1 Back     alignment and structure
>1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Back     alignment and structure
>3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A Back     alignment and structure
>2ee7_A Sperm flagellar protein 1; all alpha protein, CH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1wix_A HOOK homolog 1, RSGI RUH-026; structural genomics, mouse cDNA, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.40.3.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 121
d1h67a_108 a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [T 9e-22
d1p2xa_159 a.40.1.1 (A:) Ras GTPase-activating-like protein r 4e-17
d1ujoa_144 a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [Ta 4e-16
d1pxya_ 500 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 2e-05
d1rt8a_ 505 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 3e-05
d1rt8a_ 505 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 9e-04
d1sh5a1120 a.40.1.1 (A:8-127) Actin binding domain of plectin 4e-05
d1dxxa1111 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens 6e-05
>d1h67a_ a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 108 Back     information, alignment and structure

class: All alpha proteins
fold: CH domain-like
superfamily: Calponin-homology domain, CH-domain
family: Calponin-homology domain, CH-domain
domain: Calponin
species: Chicken (Gallus gallus) [TaxId: 9031]
 Score = 80.7 bits (199), Expect = 9e-22
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 2/70 (2%)

Query: 7  PEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSGGQFKFM 66
          P+ +++ + WIE  TG++      + D +KDG ILC LINKL+PGSV K+N     +  +
Sbjct: 2  PQTERQLRVWIEGATGRRIGDN--FMDGLKDGVILCELINKLQPGSVQKVNDPVQNWHKL 59

Query: 67 ENINKGLTFI 76
          ENI   L  I
Sbjct: 60 ENIGNFLRAI 69


>d1p2xa_ a.40.1.1 (A:) Ras GTPase-activating-like protein rng2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 159 Back     information, alignment and structure
>d1ujoa_ a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [TaxId: 10090]} Length = 144 Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 500 Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 505 Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 505 Back     information, alignment and structure
>d1sh5a1 a.40.1.1 (A:8-127) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1dxxa1 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query121
d1h67a_108 Calponin {Chicken (Gallus gallus) [TaxId: 9031]} 100.0
d1ujoa_144 Transgelin {Mouse (Mus musculus) [TaxId: 10090]} 100.0
d1p2xa_159 Ras GTPase-activating-like protein rng2 {Fission y 99.95
d1aoaa1131 Fimbrin (Plastin), actin-crosslinking domain {Huma 99.43
d1sh5a1120 Actin binding domain of plectin {Human (Homo sapie 98.98
d1dxxa1111 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 98.93
d1wjoa_124 Fimbrin (Plastin), actin-crosslinking domain {Huma 98.92
d1pxya_ 500 Fimbrin (Plastin), actin-crosslinking domain {Thal 98.69
d1aoaa2116 Fimbrin (Plastin), actin-crosslinking domain {Huma 98.63
d1rt8a_ 505 Fimbrin (Plastin), actin-crosslinking domain {Fiss 98.59
d1rt8a_505 Fimbrin (Plastin), actin-crosslinking domain {Fiss 98.48
d2qjza1120 Microtubule-associated protein eb1, N-terminal mic 98.4
d1pxya_ 500 Fimbrin (Plastin), actin-crosslinking domain {Thal 98.27
d1dxxa2127 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 97.44
d1bkra_108 beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} 97.42
d1sh5a2110 Actin binding domain of plectin {Human (Homo sapie 97.39
d1bhda_108 Utrophin {Human (Homo sapiens) [TaxId: 9606]} 97.3
d1wixa_164 Hook homolog 1, Hook1 {Mouse (Mus musculus) [TaxId 93.53
>d1h67a_ a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
class: All alpha proteins
fold: CH domain-like
superfamily: Calponin-homology domain, CH-domain
family: Calponin-homology domain, CH-domain
domain: Calponin
species: Chicken (Gallus gallus) [TaxId: 9031]
Probab=100.00  E-value=3e-34  Score=195.56  Aligned_cols=92  Identities=36%  Similarity=0.603  Sum_probs=87.4

Q ss_pred             HHHHHHHHHHHHHHhCCCCCCcchHHHHhhhHHHHHHHHHhhcCCCcccccCCCCchhHHHHHHHHHHhhh---------
Q psy17185          7 PEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSGGQFKFMENINKGLTFIA---------   77 (121)
Q Consensus         7 ~~~e~~~~~WIe~vl~~~~~~~~~~~~~LrDGviLC~L~N~l~P~~v~ki~~~~~~f~~~eNI~~FL~ac~---------   77 (121)
                      |+.|++++.||++++|+++++  +|.++||||++||+|+|.|+||+|++++.++++|+++|||+.||++|+         
T Consensus         2 p~~e~e~~~Wie~~~~~~~~~--~~~~~L~dGv~LC~L~N~l~pg~i~ki~~~~~~f~~~eNI~~FL~~~~~~Gv~~~~l   79 (108)
T d1h67a_           2 PQTERQLRVWIEGATGRRIGD--NFMDGLKDGVILCELINKLQPGSVQKVNDPVQNWHKLENIGNFLRAIKHYGVKPHDI   79 (108)
T ss_dssp             CCSSHHHHHHHHHHHSCCCCS--CHHHHHHHCSHHHHHHHHHSTTSSTTCCCTTSSHHHHHHHHHHHHHHHHHTSCGGGS
T ss_pred             cHHHHHHHHHHHHHhCCCCch--HHHHHHcCchhHHHHHHHHHhcCCCccCCCcchhHHHHHHHHHHHHHHHhCCCcccC
Confidence            567899999999999999975  799999999999999999999999999999999999999999999999         


Q ss_pred             -hccceecCCCh-----hHHHHHHhhhcC
Q psy17185         78 -ITPQVFSNDSI-----TIHSGTGSHLTQ  100 (121)
Q Consensus        78 -~~~DLfe~kn~-----~L~aL~~~a~~~  100 (121)
                       ++.||||++|+     ||++||+.|+++
T Consensus        80 F~~~DL~e~kn~~~V~~cL~aL~r~a~~k  108 (108)
T d1h67a_          80 FEANDLFENTNHTQVQSTLIALASQAKTK  108 (108)
T ss_dssp             CCHHHHHHTCCSHHHHHHHHHHHHHHHHC
T ss_pred             CChHHHHhCCCHHHHHHHHHHHHHHhccC
Confidence             99999999999     999999999863



>d1ujoa_ a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p2xa_ a.40.1.1 (A:) Ras GTPase-activating-like protein rng2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1aoaa1 a.40.1.1 (A:121-251) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sh5a1 a.40.1.1 (A:8-127) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxxa1 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjoa_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1aoaa2 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2qjza1 a.40.1.1 (A:13-132) Microtubule-associated protein eb1, N-terminal microtubule binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dxxa2 a.40.1.1 (A:120-246) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bkra_ a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sh5a2 a.40.1.1 (A:128-237) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhda_ a.40.1.1 (A:) Utrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wixa_ a.40.3.1 (A:) Hook homolog 1, Hook1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure