Psyllid ID: psy17300

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150--
MIASSIFLRAIKDKNTVQVSKNSEVTKLCFDETKTKVTGVEFRNPQGKTIKVNANREVVLAANSINSVRILQQSGVGDAALLSKYNIPLVKNLPGVGKRLSLHPMFFGLSYTFTKTPVSSYTINEIIYEYLTQRTGKRRRKFTRKRGGRLEK
ccccHHcccccccccccEEEEccEEEEEEEEccccEEEEEEEEccccEEEEEEEccEEEEEccccccHHHHHHcccccHHHHHHcccccEEcccccccccccccccccEEEEEccccccHHcHHHHHHHHHHcccccccccccccccccccc
ccHHHHHHHHHHcccccEEEEEEEEEEEEEcccccEEEEEEEEEEccEEEEEEEEEEEEEccccccHHHHHHHHcEccHHHHHHHcccccEccccccHHHHHHHHHEEEEEHccccccccccHHHHHHHHHHHcccccccHHHHcccccccc
MIASSIFLRAIkdkntvqvsknsevtklcfdetktkvtgvefrnpqgktikvnaNREVVLAANSINSVRILQQsgvgdaallskyniplvknlpgvgkrlslhpmffglsytftktpvssyTINEIIYEYLTQRTGKRRRKFTRKRGGRLEK
miassiflraikdkntvqvsknsevtklcfdetktkvtgvefrnpqgktikvnanrEVVLAANSINSVRILQQSGVGDAALLSKYNIPLVKNLPGVGKRLSLHPMFFGLSYTFTKTPVSSYTINEIIYeyltqrtgkrrrkftrkrggrlek
MIASSIFLRAIKDKNTVQVSKNSEVTKLCFDETKTKVTGVEFRNPQGKTIKVNANREVVLAANSINSVRILQQSGVGDAALLSKYNIPLVKNLPGVGKRLSLHPMFFGLSYTFTKTPVSSYTINEIIYEYLtqrtgkrrrkftrkrggrLEK
*****IFLRAIKDKNTVQV**NSEVTKLCFDETKTKVTGVEFRNPQGKTIKVNANREVVLAANSINSVRILQQSGVGDAALLSKYNIPLVKNLPGVGKRLSLHPMFFGLSYTFTKTPVSSYTINEIIYEYLTQ*******************
MIASSIFLRAIKDKNTVQVSKNSEVTKLCFDETKTKVTGVEFRNPQGKTIKVNANREVVLAANSINSVRILQQSGVGDAALLSKYNIPLVKNLPGVGKRLSLHPMFFGLSYTFTKTPVSSYTINEIIYEYLTQRTGKRRRKFTRKRGGR***
MIASSIFLRAIKDKNTVQVSKNSEVTKLCFDETKTKVTGVEFRNPQGKTIKVNANREVVLAANSINSVRILQQSGVGDAALLSKYNIPLVKNLPGVGKRLSLHPMFFGLSYTFTKTPVSSYTINEIIYEYLTQRT*****************
*IASSIFLRAIKDKNTVQVSKNSEVTKLCFDETKTKVTGVEFRNPQGKTIKVNANREVVLAANSINSVRILQQSGVGDAALLSKYNIPLVKNLPGVGKRLSLHPMFFGLSYTFTKTPVSSYTINEIIYEYLTQRTGKRRR*F***R**RL**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIASSIFLRAIKDKNTVQVSKNSEVTKLCFDETKTKVTGVEFRNPQGKTIKVNANREVVLAANSINSVRILQQSGVGDAALLSKYNIPLVKNLPGVGKRLSLHPMFFGLSYTFTKTPVSSYTINEIIYEYLTQRTGKRRRKFTRKRGGRLEK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query152 2.2.26 [Sep-21-2011]
P18173 625 Glucose dehydrogenase [ac yes N/A 0.690 0.168 0.380 1e-12
B1LIJ7 562 Choline dehydrogenase OS= yes N/A 0.730 0.197 0.370 1e-11
A7MFA8 559 Choline dehydrogenase OS= yes N/A 0.730 0.198 0.362 2e-11
Q0T7N0 556 Choline dehydrogenase OS= yes N/A 0.730 0.199 0.370 3e-11
B6I074 556 Choline dehydrogenase OS= yes N/A 0.730 0.199 0.370 3e-11
B7N8L3 556 Choline dehydrogenase OS= yes N/A 0.730 0.199 0.370 3e-11
P17444 556 Choline dehydrogenase OS= N/A N/A 0.730 0.199 0.370 3e-11
B1J0W6 556 Choline dehydrogenase OS= yes N/A 0.730 0.199 0.370 3e-11
A7ZWV4 556 Choline dehydrogenase OS= yes N/A 0.730 0.199 0.370 3e-11
B1XE52 556 Choline dehydrogenase OS= yes N/A 0.730 0.199 0.370 3e-11
>sp|P18173|DHGL_DROME Glucose dehydrogenase [acceptor] OS=Drosophila melanogaster GN=Gld PE=3 SV=3 Back     alignment and function desciption
 Score = 72.0 bits (175), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 57/105 (54%)

Query: 3   ASSIFLRAIKDKNTVQVSKNSEVTKLCFDETKTKVTGVEFRNPQGKTIKVNANREVVLAA 62
           ++  FLR  + +N + +  N+  TK+        V GVE  +  G T K+   +EVVL+A
Sbjct: 261 SARAFLRPARMRNNLHILLNTTATKILIHPHTKNVLGVEVSDQFGSTRKILVKKEVVLSA 320

Query: 63  NSINSVRILQQSGVGDAALLSKYNIPLVKNLPGVGKRLSLHPMFF 107
            ++NS  IL  SGVG    L + N+  V NLPGVGK L  H  +F
Sbjct: 321 GAVNSPHILLLSGVGPKDELQQVNVRTVHNLPGVGKNLHNHVTYF 365
Essential for cuticular modification during development.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 1EC: .EC: 9EC: 9EC: .EC: 1EC: 0
>sp|B1LIJ7|BETA_ECOSM Choline dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|A7MFA8|BETA_CROS8 Choline dehydrogenase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|Q0T7N0|BETA_SHIF8 Choline dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|B6I074|BETA_ECOSE Choline dehydrogenase OS=Escherichia coli (strain SE11) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|B7N8L3|BETA_ECOLU Choline dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|P17444|BETA_ECOLI Choline dehydrogenase OS=Escherichia coli (strain K12) GN=betA PE=1 SV=1 Back     alignment and function description
>sp|B1J0W6|BETA_ECOLC Choline dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|A7ZWV4|BETA_ECOHS Choline dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|B1XE52|BETA_ECODH Choline dehydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=betA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query152
193659536 719 PREDICTED: glucose dehydrogenase [accept 0.868 0.183 0.395 5e-19
357631700 637 putative glucose dehydrogenase [Danaus p 0.868 0.207 0.381 1e-15
357631637 667 putative glucose dehydrogenase [Danaus p 0.842 0.191 0.384 7e-15
195432703 640 GK19740 [Drosophila willistoni] gi|19416 0.848 0.201 0.340 2e-14
193676365 1147 PREDICTED: hypothetical protein LOC10015 0.940 0.124 0.347 3e-14
383860418 623 PREDICTED: glucose dehydrogenase [accept 0.861 0.210 0.359 5e-14
238605050146 hypothetical protein MPER_03434 [Monilio 0.703 0.732 0.436 1e-13
332023081 625 Glucose dehydrogenase [Acromyrmex echina 0.855 0.208 0.367 1e-13
338994572 555 glucose-methanol-choline oxidoreductase 0.651 0.178 0.441 2e-13
357631699 1227 glucose dehydrogenase [Danaus plexippus] 0.875 0.108 0.392 2e-13
>gi|193659536|ref|XP_001943395.1| PREDICTED: glucose dehydrogenase [acceptor]-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 99.4 bits (246), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 53/134 (39%), Positives = 77/134 (57%), Gaps = 2/134 (1%)

Query: 3   ASSIFLRAIKDKNTVQVSKNSEVTKLCFDETKTKVTGVEFRNPQGKTIKVNANREVVLAA 62
           A+  FL+    K  +++S  S V ++ F+    K  GVEF N  G+ I+V + +EV+L A
Sbjct: 344 AAKAFLKNANRKYNLKISARSLVKRIIFE--GKKAVGVEFENSVGEQIQVKSKKEVILCA 401

Query: 63  NSINSVRILQQSGVGDAALLSKYNIPLVKNLPGVGKRLSLHPMFFGLSYTFTKTPVSSYT 122
             I S ++L +SGVG  ALL    IP+V     VG  L  HP F G+   F   PV SY+
Sbjct: 402 GPIGSPKLLLESGVGPKALLDSLGIPVVVENDNVGSNLQAHPNFLGIVVKFEMQPVKSYS 461

Query: 123 INEIIYEYLTQRTG 136
           I+E+++EYL + TG
Sbjct: 462 ISEMVFEYLMKHTG 475

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom:

>gi|357631700|gb|EHJ79169.1| putative glucose dehydrogenase [Danaus plexippus] Back     alignment and taxonomy information
>gi|357631637|gb|EHJ79106.1| putative glucose dehydrogenase [Danaus plexippus] Back     alignment and taxonomy information
>gi|195432703|ref|XP_002064356.1| GK19740 [Drosophila willistoni] gi|194160441|gb|EDW75342.1| GK19740 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|193676365|ref|XP_001949532.1| PREDICTED: hypothetical protein LOC100159632 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|383860418|ref|XP_003705686.1| PREDICTED: glucose dehydrogenase [acceptor]-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|238605050|ref|XP_002396356.1| hypothetical protein MPER_03434 [Moniliophthora perniciosa FA553] gi|215468766|gb|EEB97286.1| hypothetical protein MPER_03434 [Moniliophthora perniciosa FA553] Back     alignment and taxonomy information
>gi|332023081|gb|EGI63346.1| Glucose dehydrogenase [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|338994572|ref|ZP_08635286.1| glucose-methanol-choline oxidoreductase [Halomonas sp. TD01] gi|338766591|gb|EGP21509.1| glucose-methanol-choline oxidoreductase [Halomonas sp. TD01] Back     alignment and taxonomy information
>gi|357631699|gb|EHJ79168.1| glucose dehydrogenase [Danaus plexippus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query152
TIGR_CMR|SPO_A0283 534 SPO_A0283 "oxidoreductase, GMC 0.703 0.200 0.4 2e-13
FB|FBgn0030598 626 CG9503 [Drosophila melanogaste 0.743 0.180 0.396 1.2e-12
FB|FBgn0030586 626 CG12539 [Drosophila melanogast 0.776 0.188 0.347 1.5e-12
FB|FBgn0001112 625 Gld "Glucose dehydrogenase" [D 0.664 0.161 0.396 2.4e-12
UNIPROTKB|G4MYF5 646 MGG_10479 "Oxidoreductase" [Ma 0.605 0.142 0.419 5.4e-12
UNIPROTKB|E1C003 595 CHDH "Choline dehydrogenase" [ 0.75 0.191 0.361 6.1e-12
FB|FBgn0030592 726 CG9514 [Drosophila melanogaste 0.730 0.152 0.362 1.7e-11
UNIPROTKB|P17444 556 betA "choline dehydrogenase" [ 0.723 0.197 0.384 1.9e-11
ASPGD|ASPL0000037024 611 AN3229 [Emericella nidulans (t 0.769 0.191 0.303 3.6e-11
UNIPROTKB|G4NEK0 646 MGG_00779 "Choline dehydrogena 0.572 0.134 0.407 6.4e-11
TIGR_CMR|SPO_A0283 SPO_A0283 "oxidoreductase, GMC family" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
 Score = 184 (69.8 bits), Expect = 2.0e-13, P = 2.0e-13
 Identities = 46/115 (40%), Positives = 73/115 (63%)

Query:     3 ASSIFLR-AIKDKNTVQVSKNSEVTKLCFDETKTKVTGVEFRNPQGKTIKVNANREVVLA 61
             A+  FLR A+K  N   VS N+ V ++   +     TGVE+R  +G+ ++ +A REV+++
Sbjct:   200 AADAFLRPALKRPNLFLVS-NALVERVTLHDGAA--TGVEYR-ARGQLVRASATREVIVS 255

Query:    62 ANSINSVRILQQSGVGDAALLSKYNIPLVKNLPGVGKRLSLHPMFFGLSYTFTKT 116
             A ++NS ++LQ SG+G AALL ++ I + ++LP VG+ L  H    G+SY FT T
Sbjct:   256 AGAVNSPQLLQLSGLGPAALLQRHGIAVARDLPQVGQGLQDH---LGISYQFTAT 307
GO:0008152 "metabolic process" evidence=ISS
GO:0016491 "oxidoreductase activity" evidence=ISS
FB|FBgn0030598 CG9503 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030586 CG12539 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0001112 Gld "Glucose dehydrogenase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|G4MYF5 MGG_10479 "Oxidoreductase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|E1C003 CHDH "Choline dehydrogenase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0030592 CG9514 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P17444 betA "choline dehydrogenase" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
ASPGD|ASPL0000037024 AN3229 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4NEK0 MGG_00779 "Choline dehydrogenase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query152
PRK02106 560 PRK02106, PRK02106, choline dehydrogenase; Validat 5e-24
TIGR01810 532 TIGR01810, betA, choline dehydrogenase 9e-21
COG2303 542 COG2303, BetA, Choline dehydrogenase and related f 6e-19
pfam00732218 pfam00732, GMC_oxred_N, GMC oxidoreductase 1e-10
TIGR03970 487 TIGR03970, Rv0697, dehydrogenase, Rv0697 family 2e-09
PLN02785 587 PLN02785, PLN02785, Protein HOTHEAD 2e-09
>gnl|CDD|235000 PRK02106, PRK02106, choline dehydrogenase; Validated Back     alignment and domain information 
 Score = 96.4 bits (241), Expect = 5e-24
 Identities = 43/140 (30%), Positives = 70/140 (50%), Gaps = 11/140 (7%)

Query: 3   ASSIFLRAIKDKNTVQVSKNSEVTKLCFDETKTKVTGVEFRNPQGKTIKVNANREVVLAA 62
           A+  +L     +  + +  ++   ++ F+    +  GVE+    G      A REV+L+A
Sbjct: 202 AARAYLDPALKRPNLTIVTHALTDRILFE--GKRAVGVEYER-GGGRETARARREVILSA 258

Query: 63  NSINSVRILQQSGVGDAALLSKYNIPLVKNLPGVGKRLSLHPMFFGLSYTFTKTPVSSYT 122
            +INS ++LQ SG+G A  L +  IP+V +LPGVG+ L  H +   + Y   + PVS Y 
Sbjct: 259 GAINSPQLLQLSGIGPAEHLKELGIPVVHDLPGVGENLQDH-LEVYIQYECKQ-PVSLYP 316

Query: 123 INE------IIYEYLTQRTG 136
             +      I  E+L   TG
Sbjct: 317 ALKWWNKPKIGAEWLFTGTG 336

Length = 560
>gnl|CDD|233581 TIGR01810, betA, choline dehydrogenase Back     alignment and domain information
>gnl|CDD|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|216089 pfam00732, GMC_oxred_N, GMC oxidoreductase Back     alignment and domain information
>gnl|CDD|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family Back     alignment and domain information
>gnl|CDD|215420 PLN02785, PLN02785, Protein HOTHEAD Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 152
KOG1238|consensus 623 100.0
PRK02106 560 choline dehydrogenase; Validated 99.96
TIGR01810 532 betA choline dehydrogenase. This enzyme is a membe 99.96
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 99.95
PLN02785 587 Protein HOTHEAD 99.93
COG2303 542 BetA Choline dehydrogenase and related flavoprotei 99.87
TIGR02462 544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 99.77
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.81
PRK12837 513 3-ketosteroid-delta-1-dehydrogenase; Provisional 97.77
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.52
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.39
PRK08274 466 tricarballylate dehydrogenase; Validated 97.3
PF00890 417 FAD_binding_2: FAD binding domain of the Pfam fami 97.24
PRK07121 492 hypothetical protein; Validated 97.21
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.18
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 96.9
PRK06175 433 L-aspartate oxidase; Provisional 96.89
PLN02815 594 L-aspartate oxidase 96.86
TIGR01816 565 sdhA_forward succinate dehydrogenase, flavoprotein 96.85
PRK12839 572 hypothetical protein; Provisional 96.85
PRK05675 570 sdhA succinate dehydrogenase flavoprotein subunit; 96.82
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 96.79
TIGR01813 439 flavo_cyto_c flavocytochrome c. This model describ 96.76
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 96.76
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 96.69
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 96.67
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 96.61
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 96.57
PRK07395 553 L-aspartate oxidase; Provisional 96.56
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 96.53
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 96.49
PRK12842 574 putative succinate dehydrogenase; Reviewed 96.47
PRK09077 536 L-aspartate oxidase; Provisional 96.41
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 96.38
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 96.37
PRK06481 506 fumarate reductase flavoprotein subunit; Validated 96.36
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 96.32
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 96.31
PRK08275 554 putative oxidoreductase; Provisional 96.26
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 96.25
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 96.24
KOG2404|consensus 477 96.23
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 96.18
COG0029 518 NadB Aspartate oxidase [Coenzyme metabolism] 96.17
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 96.09
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 96.07
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 95.99
TIGR00551 488 nadB L-aspartate oxidase. L-aspartate oxidase is t 95.97
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 95.95
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 95.93
PRK07512 513 L-aspartate oxidase; Provisional 95.93
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 95.92
PRK13977 576 myosin-cross-reactive antigen; Provisional 95.92
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 95.9
PF06039 488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 95.86
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 95.83
PRK08071 510 L-aspartate oxidase; Provisional 95.8
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 95.67
TIGR02485 432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 95.2
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 95.19
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 95.17
TIGR03377 516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 95.11
PRK07804 541 L-aspartate oxidase; Provisional 94.64
PLN02464 627 glycerol-3-phosphate dehydrogenase 94.56
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 94.54
PRK05257 494 malate:quinone oxidoreductase; Validated 94.46
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 94.33
PTZ00383 497 malate:quinone oxidoreductase; Provisional 94.04
PF01134 392 GIDA: Glucose inhibited division protein A; InterP 94.03
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 93.5
PLN02661357 Putative thiazole synthesis 93.44
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 93.34
PF12831 428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 92.81
PRK06185 407 hypothetical protein; Provisional 92.44
TIGR01320 483 mal_quin_oxido malate:quinone-oxidoreductase. This 92.27
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 91.99
PRK13339 497 malate:quinone oxidoreductase; Reviewed 91.61
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 91.57
TIGR02733 492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 90.99
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 90.61
TIGR02730 493 carot_isom carotene isomerase. Members of this fam 90.17
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 89.75
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 89.61
PRK07208 479 hypothetical protein; Provisional 89.56
PF03486 409 HI0933_like: HI0933-like protein; InterPro: IPR004 89.55
PRK06126 545 hypothetical protein; Provisional 89.22
TIGR02734 502 crtI_fam phytoene desaturase. Phytoene is converte 89.16
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 89.06
PLN02985 514 squalene monooxygenase 89.05
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 88.95
COG0579 429 Predicted dehydrogenase [General function predicti 88.72
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 87.99
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 87.82
PRK13369 502 glycerol-3-phosphate dehydrogenase; Provisional 87.46
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, f 87.38
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 87.24
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 86.38
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 85.75
KOG0042|consensus 680 85.62
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 84.9
TIGR03862 376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 84.88
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 84.87
KOG4254|consensus 561 84.86
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 84.29
PRK11728 393 hydroxyglutarate oxidase; Provisional 84.11
PRK08401 466 L-aspartate oxidase; Provisional 84.04
PRK10157 428 putative oxidoreductase FixC; Provisional 83.6
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 83.48
TIGR02732 474 zeta_caro_desat carotene 7,8-desaturase. Carotene 83.06
PRK07364 415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 83.06
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 82.77
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 82.47
COG2081 408 Predicted flavoproteins [General function predicti 82.01
PRK06327 475 dihydrolipoamide dehydrogenase; Validated 80.96
PRK07818 466 dihydrolipoamide dehydrogenase; Reviewed 80.3
>KOG1238|consensus Back     alignment and domain information 
Probab=100.00  E-value=4.6e-33  Score=244.46  Aligned_cols=149  Identities=31%  Similarity=0.425  Sum_probs=133.8

Q ss_pred             CcchhhhHHhhhc-CCCcEEEcCcEEEEEEEeCCCCeEEEEEEEcCCCcEEEEEeCcEEEEccCCccChHHHhhCCCCCh
Q psy17300          1 MIASSIFLRAIKD-KNTVQVSKNSEVTKLCFDETKTKVTGVEFRNPQGKTIKVNANREVVLAANSINSVRILQQSGVGDA   79 (152)
Q Consensus         1 ~Ss~~~~l~~~~~-~~nl~l~~~~~V~ri~~~~~~~~~~gV~~~~~~g~~~~~~a~k~VIlaaGai~tP~lLl~Sgig~~   79 (152)
                      ||++++|++|+.. |+||++..++.|+||++|+.+.++.||++....|++++++|+||||||||||+||||||+|||||.
T Consensus       252 ~s~~~a~l~~~~~~R~NL~~~~~~~vtrvl~D~~~~~a~gv~~~~~~~~~~~v~a~kEVILSAGAi~SPQLLMLSGIGP~  331 (623)
T KOG1238|consen  252 VSLAKAYLKPIRLTRPNLHISRNAAVTRVLIDPAGKRAKGVEFVRDGGKEHTVKARKEVILSAGAINSPQLLMLSGIGPA  331 (623)
T ss_pred             EEehhhhhhhhhccCccccccccceEEEEEEcCCCceEEEEEEEecCceeeeecccceEEEeccccCCHHHHHHcCCCcH
Confidence            7899999999887 999999999999999999888999999999433799999999999999999999999999999999


Q ss_pred             hhhhhcCCCcccCCcccccccccCcCcceEEEEEeCCCC---CchhhHHHHHHHHhcCCCccccccccccCcccc
Q psy17300         80 ALLSKYNIPLVKNLPGVGKRLSLHPMFFGLSYTFTKTPV---SSYTINEIIYEYLTQRTGKRRRKFTRKRGGRLE  151 (152)
Q Consensus        80 ~~l~~~gi~~~~~lp~VG~nl~dh~~~~~~~~~~~~~~~---~~~~~~~~~~~y~~~~~G~l~~~~~~~~~~~~~  151 (152)
                      ++|+++|||++.|||+||+|||||++. ++...+..+.+   .+......+.+|+..++||++..+ .+.+||+.
T Consensus       332 ~~L~~~gIpvv~dLP~VG~nLqDH~~~-~~~~~~~~~~~~~~~~~~~~~~~~~yl~~~~G~~~~~~-~e~~~f~~  404 (623)
T KOG1238|consen  332 DHLKKLGIPVVLDLPGVGQNLQDHPMN-PGFVFSTNPVELSLIRLVGITTVGQYLEGGSGPLASPG-VETLGFIN  404 (623)
T ss_pred             HHHHhcCCCeeccCccccccccccccc-ceeeecCCCccccccccccchHHHHHHHcCCCCcccCc-ceeeEEec
Confidence            999999999999999999999999999 77666666544   344556889999999999999888 67777764

>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4254|consensus Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query152
3fim_B 566 Crystal Structure Of Aryl-Alcohol-Oxidase From Pleu 4e-09
3nne_A 546 Crystal Structure Of Choline Oxidase S101a Mutant L 7e-08
3ljp_A 546 Crystal Structure Of Choline Oxidase V464a Mutant L 7e-08
2jbv_A 546 Crystal Structure Of Choline Oxidase Reveals Insigh 7e-08
3red_A 521 3.0 A Structure Of The Prunus Mume Hydroxynitrile L 3e-07
1ju2_A 536 Crystal Structure Of The Hydroxynitrile Lyase From 2e-06
3gdn_A 521 Almond Hydroxynitrile Lyase In Complex With Benzald 3e-06
1cf3_A 583 Glucose Oxidase From Apergillus Niger Length = 583 2e-05
3q9t_A 577 Crystal Structure Analysis Of Formate Oxidase Lengt 9e-05
1gpe_A 587 Glucose Oxidase From Penicillium Amagasakiense Leng 6e-04
>pdb|3FIM|B Chain B, Crystal Structure Of Aryl-Alcohol-Oxidase From Pleurotus Eryingii Length = 566 Back     alignment and structure 
Iteration: 1

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 57/105 (54%), Gaps = 4/105 (3%)
Query: 3   ASSIFLRAIKDKNTVQVSKNSEVTKLCFDETKTKVTG---VEFRNPQGK-TIKVNANREV 58
           +S+ +LR  + +  + V  N++VTKL    T   +     VE+   +G  T  V A +EV
Sbjct: 209 SSTAYLRPAQSRPNLSVLINAQVTKLVNSGTTNGLPAFRCVEYAEQEGAPTTTVCAKKEV 268
Query: 59  VLAANSINSVRILQQSGVGDAALLSKYNIPLVKNLPGVGKRLSLH 103
           VL+A S+ +  +LQ SG+GD   LS   I  + N P VG+ LS H
Sbjct: 269 VLSAGSVGTPILLQLSGIGDENDLSSVGIDTIVNNPSVGRNLSDH 313
>pdb|3NNE|A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant Length = 546 Back     alignment and structure
>pdb|3LJP|A Chain A, Crystal Structure Of Choline Oxidase V464a Mutant Length = 546 Back     alignment and structure
>pdb|2JBV|A Chain A, Crystal Structure Of Choline Oxidase Reveals Insights Into The Catalytic Mechanism Length = 546 Back     alignment and structure
>pdb|3RED|A Chain A, 3.0 A Structure Of The Prunus Mume Hydroxynitrile Lyase Isozyme-1 Length = 521 Back     alignment and structure
>pdb|1JU2|A Chain A, Crystal Structure Of The Hydroxynitrile Lyase From Almond Length = 536 Back     alignment and structure
>pdb|3GDN|A Chain A, Almond Hydroxynitrile Lyase In Complex With Benzaldehyde Length = 521 Back     alignment and structure
>pdb|1CF3|A Chain A, Glucose Oxidase From Apergillus Niger Length = 583 Back     alignment and structure
>pdb|3Q9T|A Chain A, Crystal Structure Analysis Of Formate Oxidase Length = 577 Back     alignment and structure
>pdb|1GPE|A Chain A, Glucose Oxidase From Penicillium Amagasakiense Length = 587 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query152
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 5e-33
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 2e-30
2jbv_A 546 Choline oxidase; alcohol oxidation, flavoenyzme ox 5e-30
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 4e-29
1ju2_A 536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 7e-29
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 7e-28
3t37_A 526 Probable dehydrogenase; BET alpha beta fold, ADP b 2e-27
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 1e-26
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 4e-14
1n4w_A 504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 1e-06
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 2e-06
1coy_A 507 Cholesterol oxidase; oxidoreductase(oxygen recepto 4e-06
4at0_A 510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 3e-05
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 3e-05
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 6e-05
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Length = 577 Back     alignment and structure
 Score =  121 bits (305), Expect = 5e-33
 Identities = 30/141 (21%), Positives = 51/141 (36%), Gaps = 11/141 (7%)

Query: 4   SSIFLRAIKDKNTVQVSKNSEVTKLCFDETKTKVTGVEFRNPQGKTIKVNANREVVLAAN 63
           S  FL      N + +       +L  +E      GV      G  +   A+REV+L+  
Sbjct: 209 SGSFLFVKNKPN-ITIVPEVHSKRLIINEADRTCKGVTVVTAAGNELNFFADREVILSQG 267

Query: 64  SINSVRILQQSGVGDAALLSKYNIPLVKNLPGVGKRLSLHPMFFGLSYTFTKTPVSSYTI 123
              + ++L  SG+G    LS++ I  + +   VG+ L  HP          K       +
Sbjct: 268 VFETPKLLMLSGIGPTRELSRHGINTIVDSRHVGQNLMDHPG-VPFVLR-VKDGFGMDDV 325

Query: 124 N--------EIIYEYLTQRTG 136
                     ++  Y   R+G
Sbjct: 326 LLRHGPKRDAVVSAYNKNRSG 346
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Length = 566 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Length = 546 Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Length = 587 Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Length = 536 Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Length = 583 Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Length = 526 Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Length = 546 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Length = 504 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Length = 507 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query152
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 100.0
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 99.97
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 99.97
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 99.95
2jbv_A 546 Choline oxidase; alcohol oxidation, flavoenyzme ox 99.91
3t37_A 526 Probable dehydrogenase; BET alpha beta fold, ADP b 99.9
1ju2_A 536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 99.9
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 99.88
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 99.81
1n4w_A 504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 99.78
1coy_A 507 Cholesterol oxidase; oxidoreductase(oxygen recepto 99.7
4at0_A 510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 97.77
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 96.94
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 96.9
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 96.86
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 96.67
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 96.55
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 96.43
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 96.36
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 96.24
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 96.01
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 95.96
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 95.62
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 95.59
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 95.55
3dme_A369 Conserved exported protein; structural genomics, P 95.33
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 95.16
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 95.13
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 95.01
3atr_A 453 Conserved archaeal protein; saturating double bond 94.72
3r9u_A315 Thioredoxin reductase; structural genomics, center 94.65
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 94.59
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 94.29
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 94.26
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 94.25
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 94.22
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 94.17
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 93.98
3cgv_A 397 Geranylgeranyl reductase related protein; NP_39399 93.86
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 93.69
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 93.2
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 93.11
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 92.92
3axb_A 448 Putative oxidoreductase; dinucleotide-binding fold 92.88
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 92.69
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 92.51
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 92.24
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 92.19
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 91.66
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 91.25
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 91.24
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 91.13
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 91.04
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 90.97
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 90.94
3s5w_A 463 L-ornithine 5-monooxygenase; class B flavin depend 90.93
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 90.61
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 90.51
2cul_A232 Glucose-inhibited division protein A-related PROT 89.99
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 89.7
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 89.67
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 89.56
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 89.54
2oln_A 397 NIKD protein; flavoprotein, rossmann fold, oxidore 89.53
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 89.41
3oz2_A 397 Digeranylgeranylglycerophospholipid reductase; str 89.3
3v76_A 417 Flavoprotein; structural genomics, PSI-biology, NE 89.22
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 88.95
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 88.8
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 88.78
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 88.7
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 88.44
4a9w_A 357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 88.1
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 87.84
4b63_A 501 L-ornithine N5 monooxygenase; oxidoreductase, side 87.34
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 87.15
2bry_A 497 NEDD9 interacting protein with calponin homology a 87.03
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 86.74
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 86.52
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 85.95
3ic9_A 492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 85.37
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 85.06
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 84.76
2qae_A 468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 84.24
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 83.96
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 83.66
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 83.42
3urh_A 491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 83.1
2gv8_A 447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 83.05
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 82.96
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 82.96
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 82.75
3lad_A 476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 82.48
2x3n_A 399 Probable FAD-dependent monooxygenase; oxidoreducta 82.21
2gqf_A 401 Hypothetical protein HI0933; structural genomics, 81.71
3dgh_A 483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 81.17
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 81.1
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 81.0
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 81.0
2ywl_A180 Thioredoxin reductase related protein; uncharacter 80.61
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 80.36
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
Probab=100.00  E-value=6.7e-35  Score=255.70  Aligned_cols=149  Identities=29%  Similarity=0.379  Sum_probs=129.3

Q ss_pred             CcchhhhHHhhhcCCCcEEEcCcEEEEEEEeC--CC-CeEEEEEEEcCCC-cEEEEEeCcEEEEccCCccChHHHhhCCC
Q psy17300          1 MIASSIFLRAIKDKNTVQVSKNSEVTKLCFDE--TK-TKVTGVEFRNPQG-KTIKVNANREVVLAANSINSVRILQQSGV   76 (152)
Q Consensus         1 ~Ss~~~~l~~~~~~~nl~l~~~~~V~ri~~~~--~~-~~~~gV~~~~~~g-~~~~~~a~k~VIlaaGai~tP~lLl~Sgi   76 (152)
                      +|++.+||.|+.+++|++|++++.|+||+|++  ++ ++|+||+|.+.+| +.++++|+||||||||+|+||||||+|||
T Consensus       207 ~sa~~ayL~p~~~r~NL~Vlt~a~V~rIl~~~~~~g~~rA~GVe~~~~~g~~~~~v~A~kEVILsAGai~SPqlL~lSGI  286 (566)
T 3fim_B          207 SSSSTAYLRPAQSRPNLSVLINAQVTKLVNSGTTNGLPAFRCVEYAEQEGAPTTTVCAKKEVVLSAGSVGTPILLQLSGI  286 (566)
T ss_dssp             CCHHHHTHHHHTTCTTEEEESSCEEEEEECCEEETTEEECCEEEEESSTTSCCEEEEEEEEEEECCHHHHHHHHHHHTTE
T ss_pred             cCHHHHHhhhhccCCCeEEECCCEEEEEEeecCCCCCCEEEEEEEEECCCceEEEEEeeeEEEEecCCcCChHHHHhcCC
Confidence            57889999999899999999999999999981  13 6899999996556 78899999999999999999999999999


Q ss_pred             CChhhhhhcCCCcccCCcccccccccCcCcceEEEEEeCCCC------CchhhHHHHHHHHhcCCCccccccccccCccc
Q psy17300         77 GDAALLSKYNIPLVKNLPGVGKRLSLHPMFFGLSYTFTKTPV------SSYTINEIIYEYLTQRTGKRRRKFTRKRGGRL  150 (152)
Q Consensus        77 g~~~~l~~~gi~~~~~lp~VG~nl~dh~~~~~~~~~~~~~~~------~~~~~~~~~~~y~~~~~G~l~~~~~~~~~~~~  150 (152)
                      ||+++|+++||++++|||+||+|||||+.+ .+.|.++...+      +......++.+|+..++||++.... +.++|+
T Consensus       287 Gp~~~L~~~gI~vv~dlPgVG~NLqDH~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~l~~~~~-~~~~f~  364 (566)
T 3fim_B          287 GDENDLSSVGIDTIVNNPSVGRNLSDHLLL-PAAFFVNSNQTFDNIFRDSSEFNVDLDQWTNTRTGPLTALIA-NHLAWL  364 (566)
T ss_dssp             ECHHHHHHTTCCCSEECTTTTCSBBCCEEE-CCEEEESCSCSSGGGGTCHHHHHHHHHHHHHHSCSGGGCCSC-SEEEEE
T ss_pred             CChHHHhhcCCCceecCcchhhhhhcCccc-eEEEEeCCCcccchhhcChHHHHHHHHHHHhcCCCCcccChh-hheeee
Confidence            999999999999999999999999999999 89998876543      1233456789999999999998774 455665


Q ss_pred             c
Q psy17300        151 E  151 (152)
Q Consensus       151 ~  151 (152)
                      +
T Consensus       365 ~  365 (566)
T 3fim_B          365 R  365 (566)
T ss_dssp             C
T ss_pred             c
Confidence            3
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 152
d1cf3a1385 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper 2e-24
d1ju2a1351 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase { 2e-21
d1gpea1391 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic 6e-19
d1kdga1360 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain 2e-15
d2f5va1379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 5e-10
d1n4wa1367 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of 1e-09
d3coxa1370 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of 1e-09
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Glucose oxidase
species: Aspergillus niger [TaxId: 5061]

 Score = 94.9 bits (235), Expect = 2e-24
 Identities = 33/108 (30%), Positives = 49/108 (45%), Gaps = 3/108 (2%)

Query: 1   MIASSIFLRAIKDKNTVQVSKNSEVTKLCFDE--TKTKVTGVEFRNPQGKTIKVNANREV 58
             A+  +L     +  +QV     V K+   +  T  +  GVEF   +G T  V A  EV
Sbjct: 224 SDAAREWLLPNYQRPNLQVLTGQYVGKVLLSQNGTTPRAVGVEFGTHKGNTHNVYAKHEV 283

Query: 59  VLAANSINSVRILQQSGVGDAALLSKYNIPLVKNLP-GVGKRLSLHPM 105
           +LAA S  S  IL+ SG+G  ++L    I  V +LP G+   +     
Sbjct: 284 LLAAGSAVSPTILEYSGIGMKSILEPLGIDTVVDLPVGLCSMMPKEMG 331
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Length = 351 Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367 Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query152
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 99.96
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 99.95
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 99.93
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 99.88
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 99.64
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 99.57
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 99.46
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 97.83
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 97.65
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 97.6
d1kdga2 181 Flavoprotein domain of flavocytochrome cellobiose 97.53
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 97.43
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 96.9
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 96.75
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 96.71
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 96.25
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 95.79
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 95.53
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 95.33
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 94.83
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 94.49
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 94.31
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 94.23
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 94.13
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 94.07
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 93.81
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 93.72
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 93.67
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 93.56
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 92.76
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 92.29
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 91.98
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 91.84
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 91.84
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 91.56
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 91.46
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 91.03
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 90.23
d1cf3a2 196 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 89.91
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 88.07
d1gpea2 196 Glucose oxidase {Penicillium amagasakiense [TaxId: 87.06
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 86.06
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 85.77
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 85.67
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 85.62
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 85.06
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 84.45
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 83.44
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Glucose oxidase
species: Penicillium amagasakiense [TaxId: 63559]

Probab=99.96  E-value=1.2e-29  Score=210.17  Aligned_cols=106  Identities=26%  Similarity=0.348  Sum_probs=97.6

Q ss_pred             CcchhhhHHhhhcCCCcEEEcCcEEEEEEEeC--CCCeEEEEEEEcCCCcEEEEEeCcEEEEccCCccChHHHhhCCCCC
Q psy17300          1 MIASSIFLRAIKDKNTVQVSKNSEVTKLCFDE--TKTKVTGVEFRNPQGKTIKVNANREVVLAANSINSVRILQQSGVGD   78 (152)
Q Consensus         1 ~Ss~~~~l~~~~~~~nl~l~~~~~V~ri~~~~--~~~~~~gV~~~~~~g~~~~~~a~k~VIlaaGai~tP~lLl~Sgig~   78 (152)
                      +|++.+++.|...++|++|++++.|+||+|+.  ++.+|+||+|.+.++.+++++|+||||||||+|+||+|||+|||||
T Consensus       230 ~s~a~~~~~p~~~r~nl~i~t~a~V~rIl~~~~~~g~ra~GV~~~~~~g~~~~v~A~keVILaAGai~SP~LLl~SGIGp  309 (391)
T d1gpea1         230 VDAARAWLLPNYQRSNLEILTGQMVGKVLFKQTASGPQAVGVNFGTNKAVNFDVFAKHEVLLAAGSAISPLILEYSGIGL  309 (391)
T ss_dssp             CCHHHHHTTTTTTCTTEEEEESCEEEEEEEEEETTEEEEEEEEEEEETTEEEEEEEEEEEEECSCTTTHHHHHHHTTEEC
T ss_pred             cchhhhccCccccchhhhhhccceeeEEeeeCCCCCceEEeeEEecCCCeEEEEEeCCEEEEecchhcchHHHHhcCCCc
Confidence            57888899998899999999999999999975  2458999999876788889999999999999999999999999999


Q ss_pred             hhhhhhcCCCcccCCc-ccccccccCcCc
Q psy17300         79 AALLSKYNIPLVKNLP-GVGKRLSLHPMF  106 (152)
Q Consensus        79 ~~~l~~~gi~~~~~lp-~VG~nl~dh~~~  106 (152)
                      +++|+++||++++||| +||+|||||+..
T Consensus       310 ~~~L~~~gI~~v~dlP~Gvg~nl~dh~~~  338 (391)
T d1gpea1         310 KSVLDQANVTQLLDLPVGICSMMSRELGG  338 (391)
T ss_dssp             HHHHHHTTCCCSEECCTTCTCBSCGGGTC
T ss_pred             HHHHHHCCCCEEEECCcccccccccCccc
Confidence            9999999999999999 799999999864
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1kdga2 d.16.1.1 (A:513-693) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), substrate-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1cf3a2 d.16.1.1 (A:325-520) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gpea2 d.16.1.1 (A:329-524) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure