Psyllid ID: psy17350

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------53

MTLSLEVLGLNPGGVLLNAYFKMNARQIKRLENKKRKMDALVEIKTLNEADKQMMHPYVIDTSVIFNTTGIRTHKPKLKMLTSHFLGLDIQNQDGGHCSKEDAIAALRLVKLKLSKGDLCSTKPAHHTVNLGFSLNDYLMFAHELPGLRDRFVKMEVIPPSSYTTSLVHELVMSSRHMEAQDMTPSKETSLPSNVTNSTHSPSQTIKSAFPIGTQPVRSANTESLSATSQNTKSQSQNIESAFQNTKSQSQYIESAFQNTKSQPQNIQLASQSTKSKSEIPLNDESKSATPQNTESQSVASAKRKSSESKSVEDKFPRTMLLLSALQMIEEDYPIPLRGELSAKFSKYINTKEVYAEVTPTSPLYGLDCEMCKTSNDQNELTRVTLVDEQENVVYESLVKPYNPITNYLTAYSGITRALLAPVATRLEHVQKILSELLPPDAILVGQSLNCDLHALKMMHPYVIDTSVIFNTTGIRTHKPKLKMLTSHFLGLDIQNQDGGHCSKEDAIAALRLVKLKLSKGDLIGLKL

ccccEEEEcccccccccccHHHccHHHHHHHHHHHHHHccEEEEccccccccccccccEEEEcccccccccccccccHHHHHHHHHccHHccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccHHHHHHHHHcccccccccHHcccccccccccccccccccccccccccccccHHHcccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEEccEEEEccccccEEEEEEEEccccEEEEEEccccccccccccccccccccccccccccHHHHHHHHHHHcccccEEEEEccHHHHHHHccccccEEEcccccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHccccccccc

ccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEccccccHHHHHHcccEEccEEEEccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHccccHHHHHccccEcccccccEEEEEEEEccHHHHHHHHcccccccccccccccccccccEEEccccccccccccccccccccccccccHHHHHcccccccccccccccEEEccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccEEEEcHHHHHcccccccccccccccccccEccccccccccccccEEEEEEEEEEccccccEEEEEEEEEccccEEEEEcEcccccEEEEccccccccHHHHccccccHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHcccEEccEEEEccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccccc

MTLSLEVlglnpggvlLNAYFKMNARQIKRLENKKRKMDALVEIKTLNEadkqmmhpyviDTSVIfnttgirthkpklkmltshflgldiqnqdgghcskEDAIAALRLVKLKLskgdlcstkpahhtvnlgfSLNDYLMfahelpglrdrfvkmevippssyttSLVHELVMSsrhmeaqdmtpsketslpsnvtnsthspsqtiksafpigtqpvrsanteslsatsqntKSQSQNIESAFQNTKSQSQYIESAFQntksqpqniQLASQstkskseiplndesksatpqntesqsVASAKrkssesksvedkfpRTMLLLSALQMIeedypiplrgeLSAKFSKYIntkevyaevtptsplygldcemcktsndqneltrVTLVDEQENVVYESlvkpynpitnyLTAYSGITRALLAPVATRLEHVQKILSEllppdailvgqslnCDLHALKMMHPYVIDTSVifnttgirthkpklkmltshflgldiqnqdgghcskEDAIAALRLVKLKLskgdliglkl

MTLSLevlglnpggVLLNAYFKMNARQIKrlenkkrkMDALVEIKTlneadkqmmhpYVIDTSVIFNTTGIRTHKPKLKMLTSHFLGLDIQNQDGGHCSKEDAIAALRLVKLKLSkgdlcstkpahHTVNLGFSLNDYLMFAHELPGLRDRFVKMEVIPPSSYTTSLVHELVMSSRHMEAQDMTPSKETSLPSNVTNSTHSPSQTIKSAFPIGTQPVRSANTESLSATSQNTKSQSQNIESAFQNTKSQSQYIESAFQNTKSQPQNIQLASQstkskseiplndesksatpqntesqsvasakrkssesksvedkfprTMLLLSALQMIEEDYPIPLRGELSAKFSKYINTKEVYAEVTPTSPLYGLDCEMCKTSNDQNELTRVTLVDEQENVVYeslvkpynpiTNYLTAYSGITRALLAPVATRLEHVQKILSELLPPDAILVGQSLNCDLHALKMMHPYVIDTSVIFNTTGIRTHKPKLKMLTSHFLGLDIQNQDGGHCSKEDAIAALRLVKlklskgdliglkl

MTLSlevlglnpggvllnAYFKMNARQIKRLENKKRKMDALVEIKTLNEADKQMMHPYVIDTSVIFNTTGIRTHKPKLKMLTSHFLGLDIQNQDGGHCSKEDAIAALRLVKLKLSKGDLCSTKPAHHTVNLGFSLNDYLMFAHELPGLRDRFVKMEVIPPSSYTTSLVHELVMSSRHMEAQDMTPSKETSLPSNVTNSTHSPSQTIKSAFPIGTQPVRSANTESLSATSQNTKSQSQNIESAFQNTKSQSQYIESAFQNTKSQPQNIQLASQSTKSKSEIPLNDESKSATPQNTESQsvasakrkssesksveDKFPRTMLLLSALQMIEEDYPIPLRGELSAKFSKYINTKEVYAEVTPTSPLYGLDCEMCKTSNDQNELTRVTLVDEQENVVYESLVKPYNPITNYLTAYSGITRALLAPVATRLEHVQKILSELLPPDAILVGQSLNCDLHALKMMHPYVIDTSVIFNTTGIRTHKPKLKMLTSHFLGLDIQNQDGGHCSKEDAIAALRLVKLKLSKGDLIGLKL

****LEVLGLNPGGVLLNAYFKMNARQIKRLEN**RKMDALVEIKTLNEADKQMMHPYVIDTSVIFNTTGIRTHKPKLKMLTSHFLGLDIQNQDGGHCSKEDAIAALRLVKLKLSKGDLCSTKPAHHTVNLGFSLNDYLMFAHELPGLRDRFVKMEVIPPSSYTTSLVHEL***************************************************************************************************************************************************TMLLLSALQMIEEDYPIPLRGELSAKFSKYINTKEVYAEVTPTSPLYGLDCEMCKTSNDQNELTRVTLVDEQENVVYESLVKPYNPITNYLTAYSGITRALLAPVATRLEHVQKILSELLPPDAILVGQSLNCDLHALKMMHPYVIDTSVIFNTTGIRTHKPKLKMLTSHFLGLDIQNQDGGHCSKEDAIAALRLVKLKLSKGDLI****

***SLEVLGLNPGGVLLNAYFKMNARQIKRLENKKRKMDALVEIKTLNEADKQMMHPYVIDTSVIFNTTGIRTHKPKLKMLTSHFLGLDIQ******CSKEDAIAALRLVKLKLSKGDLCSTKPAHHT*****************************IPPSSYTTSLVHELVMSSRHME*******************************************************************************************************************************************TMLLLSALQMIEEDYPIPL**************************LYGLDCEMCKTSNDQNELTRVTLVDEQENVVYESLVKPYNPITNYLTAYSGITRALLAPVATRLEHVQKILSELLPPDAILVGQSLNCDLHALKMMHPYVIDTSVIFNTTGIRTHKPKLKMLTSHFLGLDIQNQDGGHCSKEDAIAALRLVKLKLSKGDLIGLKL

MTLSLEVLGLNPGGVLLNAYFKMNARQIKRLENKKRKMDALVEIKTLNEADKQMMHPYVIDTSVIFNTTGIRTHKPKLKMLTSHFLGLDIQNQDGGHCSKEDAIAALRLVKLKLSKGDLCSTKPAHHTVNLGFSLNDYLMFAHELPGLRDRFVKMEVIPPSSYTTSLVHELVMSSRH**************************QTIKSAFPIGTQPVR******************************QSQYIESA**********************************************************KFPRTMLLLSALQMIEEDYPIPLRGELSAKFSKYINTKEVYAEVTPTSPLYGLDCEMCKTSNDQNELTRVTLVDEQENVVYESLVKPYNPITNYLTAYSGITRALLAPVATRLEHVQKILSELLPPDAILVGQSLNCDLHALKMMHPYVIDTSVIFNTTGIRTHKPKLKMLTSHFLGLDIQNQDGGHCSKEDAIAALRLVKLKLSKGDLIGLKL

*TLSLEVLGLNPGGVLLNAYFKMNARQIKRLENKKRKMDALVEIKTLNEADKQMMHPYVIDTSVIFNTTGIRTHKPKLKMLTSHFLGLDIQNQDGGHCSKEDAIAALRLVKLKLSKGDLCSTKPAHHTVNLGFSLNDYLMFAHELPGLRDRFVKMEVIPPSSYTTSLVHELVMSSRHMEAQDMTPSKETSLPSNVTNSTHSPSQTIKS******************************IESAFQNTKSQSQYIESAFQNTKSQPQNIQLASQSTKSKS****************************SESKSVEDKFPRTMLLLSALQMIEEDYPIPLRGELSAKFSKYINTKEVYAEVTPTSPLYGLDCEMCKTSNDQNELTRVTLVDEQENVVYESLVKPYNPITNYLTAYSGITRALLAPVATRLEHVQKILSELLPPDAILVGQSLNCDLHALKMMHPYVIDTSVIFNTTGIRTHKPKLKMLTSHFLGLDIQNQDGGHCSKEDAIAALRLVKLKLSKGDLI****

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		528	2.2.26 [Sep-21-2011]
Q2T9U5		783	Putative RNA exonuclease	yes	N/A	0.369	0.249	0.485	3e-39
Q96IC2		774	Putative RNA exonuclease	yes	N/A	0.304	0.208	0.521	9e-37
Q4R9F7		772	Putative RNA exonuclease	N/A	N/A	0.308	0.211	0.514	1e-36
A1A5R7		754	Putative RNA exonuclease	yes	N/A	0.304	0.213	0.503	1e-35
O94443		631	Uncharacterized exonuclea	yes	N/A	0.414	0.347	0.384	3e-34
Q8L7M4		567	Small RNA degrading nucle	yes	N/A	0.318	0.296	0.449	1e-30
P53331		553	RNA exonuclease 1 OS=Sacc	yes	N/A	0.378	0.361	0.401	8e-29
P48778		690	Exonuclease GOR OS=Pan tr	no	N/A	0.291	0.223	0.451	7e-27
Q8IX06		675	Exonuclease GOR OS=Homo s	no	N/A	0.291	0.228	0.445	9e-27
A0PJM3		583	Putative exonuclease GOR-	no	N/A	0.291	0.264	0.445	1e-26

>sp\|Q2T9U5\|REXON_BOVIN Putative RNA exonuclease NEF-sp OS=Bos taurus PE=2 SV=1	Back alignment and function desciption

 Score =  163 bits (412), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 99/204 (48%), Positives = 128/204 (62%), Gaps = 9/204 (4%)

Query: 319 TMLLLSALQMIEEDYPIPLRGELSAKFSKYINTKEVYAEVTPTSPLYGLDCEMCKTSNDQ 378
           T  LL+  +M  + Y  PL+G L  +   ++ TK     VT  SPL+GLDCEMC TS  +
Sbjct: 190 TRCLLTKEEM--KTYHFPLQGFLDCE--NFVPTK-CNGSVTDNSPLFGLDCEMCLTSKGR 244

Query: 379 NELTRVTLVDEQENVVYESLVKPYNPITNYLTAYSGITRALLAPVATRLEHVQKILSELL 438
            ELTR++LV E    V + LVKP N I +YLT++SGIT+ +L PV T+L+ VQ+ L  LL
Sbjct: 245 -ELTRISLVAEGGGCVMDELVKPDNKIVDYLTSFSGITKKILNPVTTKLKDVQRRLKILL 303

Query: 439 PPDAILVGQSLNCDLHALKMMHPYVIDTSVIFNTTGIRTHKPKLKMLTSHFLGLDIQNQD 498
           PPDA+LVG SL+ DL ALKM+HPYVIDTS+++     R  + KLK L    LG DIQ  D
Sbjct: 304 PPDAVLVGHSLDLDLRALKMIHPYVIDTSLLYVREQGR--RFKLKFLAKAILGKDIQCPD 361

Query: 499 G-GHCSKEDAIAALRLVKLKLSKG 521
             GH + EDA   L L +  L  G
Sbjct: 362 RLGHDATEDARTTLELARYFLKYG 385

Bos taurus (taxid: 9913)
EC: 3EC: .EC: 1EC: .EC: -EC: .EC: -

>sp\|Q96IC2\|REXON_HUMAN Putative RNA exonuclease NEF-sp OS=Homo sapiens GN=44M2.3 PE=2 SV=1	Back alignment and function description

>sp\|Q4R9F7\|REXON_MACFA Putative RNA exonuclease NEF-sp OS=Macaca fascicularis GN=QtsA-10054 PE=2 SV=1	Back alignment and function description

>sp\|A1A5R7\|REXON_RAT Putative RNA exonuclease NEF-sp OS=Rattus norvegicus PE=2 SV=1	Back alignment and function description

>sp\|O94443\|YFE9_SCHPO Uncharacterized exonuclease C637.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC637.09 PE=3 SV=2	Back alignment and function description

>sp\|Q8L7M4\|SDN5_ARATH Small RNA degrading nuclease 5 OS=Arabidopsis thaliana GN=SDN5 PE=2 SV=2	Back alignment and function description

>sp\|P53331\|REXO1_YEAST RNA exonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNH70 PE=1 SV=1	Back alignment and function description

>sp\|P48778\|GOR_PANTR Exonuclease GOR OS=Pan troglodytes GN=REXO1L1 PE=2 SV=3	Back alignment and function description

>sp\|Q8IX06\|GOR_HUMAN Exonuclease GOR OS=Homo sapiens GN=REXO1L1 PE=2 SV=2	Back alignment and function description

>sp\|A0PJM3\|GORL_HUMAN Putative exonuclease GOR-like protein OS=Homo sapiens GN=REXO1L2P PE=5 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		528
322802272		683	hypothetical protein SINV_05196 [Solenop	0.647	0.500	0.422	5e-72
383860490		683	PREDICTED: putative RNA exonuclease NEF-	0.393	0.304	0.605	2e-71
242021728		773	exonuclease nef-sp, putative [Pediculus	0.416	0.284	0.572	5e-71
380013367		683	PREDICTED: putative RNA exonuclease NEF-	0.426	0.329	0.577	5e-70
340716751		689	PREDICTED: putative RNA exonuclease NEF-	0.390	0.298	0.611	1e-69
350421814		689	PREDICTED: hypothetical protein LOC10074	0.390	0.298	0.611	1e-69
328776034		669	PREDICTED: hypothetical protein LOC41076	0.426	0.336	0.577	2e-69
357624762		420	hypothetical protein KGM_20272 [Danaus p	0.454	0.571	0.517	6e-68
195439784		693	GK12547 [Drosophila willistoni] gi\|19416	0.392	0.298	0.608	8e-68
195126933		686	GI12104 [Drosophila mojavensis] gi\|19391	0.376	0.290	0.603	1e-67

>gi\|322802272\|gb\|EFZ22668.1\| hypothetical protein SINV_05196 [Solenopsis invicta]	Back alignment and taxonomy information

 Score =  278 bits (711), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 169/400 (42%), Positives = 221/400 (55%), Gaps = 58/400 (14%)

Query: 138 YLMFAHELPGLRDRFVKMEVIPPSSYTTSLVHELVMSSRHMEAQDMTPSKETSLPSNVTN 197
           Y +  H  P L  R+ ++E      +T   V E + S   M  +DM P            
Sbjct: 160 YSLLGHHSPYLPARWCQLEKYNKVIHTVVFVLEGLSSYHFMAYEDMFPH----------- 208

Query: 198 STHSPSQTIKSAFPIGTQPVRSAN-TESLSAT----SQNTK--SQSQNIESAFQNTKSQS 250
                 Q  K    + T  V  A+ TE L+A     +Q+ K   +  ++E+A Q   +  
Sbjct: 209 ----IVQNFKHRLEVITPTVYGASITEELAAVPLTGTQSDKLIKRYGSLETALQANGNVI 264

Query: 251 QYIESAFQNTKSQPQNIQLASQSTKSKSEIPLNDESKSATPQNTESQSVASAKRKSSESK 310
           + + S F      P ++      T S     + + S    PQ                  
Sbjct: 265 KLLRSVF------PMHL------TNSNVNFSMTNNSVENLPQT----------------- 295

Query: 311 SVEDKFPRTMLLLSALQMIEEDYPIPLRGELSAKFSKYINTKEVYAEVTPTSPLYGLDCE 370
              DKF RT LLLS  QM+EE+YP+PL+G L+ K+  YI TK+VY E T TSP++GLDCE
Sbjct: 296 ---DKFCRTKLLLSLWQMVEENYPVPLKGTLAKKYGSYILTKDVYKEATSTSPMFGLDCE 352

Query: 371 MCKTSNDQNELTRVTLVDEQENVVYESLVKPYNPITNYLTAYSGITRALLAPVATRLEHV 430
           MC T++   ELTR+++VDE  NV+Y+SLVKP NPITNYLT +SGIT  +L  V  RL  V
Sbjct: 353 MCLTTSGYLELTRISVVDESMNVIYDSLVKPENPITNYLTRFSGITEDMLNDVKIRLHDV 412

Query: 431 QKILSELLPPDAILVGQSLNCDLHALKMMHPYVIDTSVIFNTTGIRTHKPKLKMLTSHFL 490
           Q+ L  LLPPDAILVGQSLN DLH LKMMHPY+IDTSVIFN TG R  K KL++L   FL
Sbjct: 413 QQTLRTLLPPDAILVGQSLNSDLHTLKMMHPYIIDTSVIFNLTGDRYRKTKLQILVREFL 472

Query: 491 GLDIQNQDGGHCSKEDAIAALRLVKLKLSK----GDLIGL 526
           G  IQ+   GHCS ED+ A+++LVKLKL+     GD + L
Sbjct: 473 GESIQDNKAGHCSTEDSKASMKLVKLKLANSVDYGDAVLL 512

Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|383860490\|ref\|XP_003705722.1\| PREDICTED: putative RNA exonuclease NEF-sp-like [Megachile rotundata]	Back alignment and taxonomy information

>gi\|242021728\|ref\|XP_002431295.1\| exonuclease nef-sp, putative [Pediculus humanus corporis] gi\|212516563\|gb\|EEB18557.1\| exonuclease nef-sp, putative [Pediculus humanus corporis]	Back alignment and taxonomy information

>gi\|380013367\|ref\|XP_003690733.1\| PREDICTED: putative RNA exonuclease NEF-sp-like [Apis florea]	Back alignment and taxonomy information

>gi\|340716751\|ref\|XP_003396857.1\| PREDICTED: putative RNA exonuclease NEF-sp-like [Bombus terrestris]	Back alignment and taxonomy information

>gi\|350421814\|ref\|XP_003492965.1\| PREDICTED: hypothetical protein LOC100740672 [Bombus impatiens]	Back alignment and taxonomy information

>gi\|328776034\|ref\|XP_394242.3\| PREDICTED: hypothetical protein LOC410766 [Apis mellifera]	Back alignment and taxonomy information

>gi\|357624762\|gb\|EHJ75416.1\| hypothetical protein KGM_20272 [Danaus plexippus]	Back alignment and taxonomy information

>gi\|195439784\|ref\|XP_002067739.1\| GK12547 [Drosophila willistoni] gi\|194163824\|gb\|EDW78725.1\| GK12547 [Drosophila willistoni]	Back alignment and taxonomy information

>gi\|195126933\|ref\|XP_002007923.1\| GI12104 [Drosophila mojavensis] gi\|193919532\|gb\|EDW18399.1\| GI12104 [Drosophila mojavensis]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		528
FB\|FBgn0035707		681	CG8368 [Drosophila melanogaste	0.390	0.302	0.611	5.4e-65
WB\|WBGene00015462		594	C05C8.5 [Caenorhabditis elegan	0.384	0.341	0.448	1.4e-41
UNIPROTKB\|Q2T9U5		783	Q2T9U5 "Putative RNA exonuclea	0.367	0.247	0.487	1.8e-37
UNIPROTKB\|E2RFH9		774	LOC479820 "Uncharacterized pro	0.494	0.337	0.389	1.6e-36
UNIPROTKB\|E2RFH4		733	LOC479820 "Uncharacterized pro	0.367	0.264	0.473	1.7e-36
UNIPROTKB\|Q96IC2		774	44M2.3 "Putative RNA exonuclea	0.367	0.250	0.468	4.2e-35
UNIPROTKB\|E1BR93		755	LOC427001 "Uncharacterized pro	0.369	0.258	0.460	6.4e-35
UNIPROTKB\|F1P5D1		773	LOC427001 "Uncharacterized pro	0.369	0.252	0.460	6.9e-35
RGD\|1305412		754	Exnef "exonuclease NEF-sp" [Ra	0.367	0.257	0.458	7.7e-34
UNIPROTKB\|F1M6V9		754	Exnef "Protein Exnef" [Rattus	0.367	0.257	0.458	7.7e-34

FB\|FBgn0035707 CG8368 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 618 (222.6 bits), Expect = 5.4e-65, Sum P(2) = 5.4e-65
 Identities = 126/206 (61%), Positives = 153/206 (74%)

Query:   314 DKFPRTMLLLSALQMIEEDYPIPLRGELSAKFSKYINTKEVYAEVTPTSPLYGLDCEMCK 373
             DKFPRT LLLSALQM++E YPIPL+GEL  +F  +  TK++YA VT  SP++G+DCEMC 
Sbjct:   306 DKFPRTKLLLSALQMVDEGYPIPLQGELHTRFQNFKFTKDLYAPVTNRSPMFGVDCEMCH 365

Query:   374 TSNDQNELTRVTLVDEQENVVYESLVKPYNPITNYLTAYSGITRALLAPVATRLEHVQKI 433
             T    NELTR+++V+E    VYE+LV P N IT+YLT YSGIT  ++  V  RL+ VQK 
Sbjct:   366 TEAGCNELTRISIVNENYETVYETLVLPNNRITDYLTQYSGITAEIMEQVTKRLDVVQKE 425

Query:   434 LSELLPPDAILVGQSLNCDLHALKMMHPYVIDTSVIFNTTGIRTHKPKLKMLTSHFLGLD 493
             +SELLPPDAILVGQSLN DL+A+KMMHPYVIDTSV FNT+G+R  K KLK L   FL   
Sbjct:   426 VSELLPPDAILVGQSLNSDLNAMKMMHPYVIDTSVCFNTSGVRRRKTKLKDLAKTFLQEI 485

Query:   494 IQNQDGGHCSKEDAIAALRLVKLKLS 519
             IQ    GH S ED+ A L+LVK KL+
Sbjct:   486 IQENIDGHDSIEDSRATLKLVKKKLA 511

GO:0004527 "exonuclease activity" evidence=IEA

GO:0003676 "nucleic acid binding" evidence=IEA

GO:0005622 "intracellular" evidence=IEA

WB\|WBGene00015462 C05C8.5 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

UNIPROTKB\|Q2T9U5 Q2T9U5 "Putative RNA exonuclease NEF-sp" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RFH9 LOC479820 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RFH4 LOC479820 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q96IC2 44M2.3 "Putative RNA exonuclease NEF-sp" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BR93 LOC427001 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|F1P5D1 LOC427001 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

RGD\|1305412 Exnef "exonuclease NEF-sp" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|F1M6V9 Exnef "Protein Exnef" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		528
cd06145		150	cd06145, REX1_like, DEDDh 3'-5' exonuclease domain	1e-74
cd06137		161	cd06137, DEDDh_RNase, DEDDh 3'-5' exonuclease doma	5e-37
cd06144		152	cd06144, REX4_like, DEDDh 3'-5' exonuclease domain	1e-36
smart00479		169	smart00479, EXOIII, exonuclease domain in DNA-poly	3e-25
cd06149		157	cd06149, ISG20, DEDDh 3'-5' exonuclease domain of	6e-22
cd06145		150	cd06145, REX1_like, DEDDh 3'-5' exonuclease domain	1e-21
pfam00929		161	pfam00929, RNase_T, Exonuclease	3e-16
cd06143		174	cd06143, PAN2_exo, DEDDh 3'-5' exonuclease domain	2e-14
cd06144		152	cd06144, REX4_like, DEDDh 3'-5' exonuclease domain	3e-08
cd06137		161	cd06137, DEDDh_RNase, DEDDh 3'-5' exonuclease doma	6e-08
cd06143		174	cd06143, PAN2_exo, DEDDh 3'-5' exonuclease domain	4e-06
cd06127		159	cd06127, DEDDh, DEDDh 3'-5' exonuclease domain fam	7e-06
COG0847		243	COG0847, DnaQ, DNA polymerase III, epsilon subunit	0.001
cd06149		157	cd06149, ISG20, DEDDh 3'-5' exonuclease domain of	0.004

>gnl\|CDD\|99848 cd06145, REX1_like, DEDDh 3'-5' exonuclease domain of RNA exonuclease 1, -3 and similar eukaryotic proteins	Back alignment and domain information

 Score =  232 bits (595), Expect = 1e-74
 Identities = 82/151 (54%), Positives = 99/151 (65%), Gaps = 1/151 (0%)

Query: 365 YGLDCEMCKTSNDQNELTRVTLVDEQENVVYESLVKPYNPITNYLTAYSGITRALLAPVA 424
           + LDCEMC T++   ELTRVT+VDE   VV + LVKP   I +Y T +SGIT  +L  V 
Sbjct: 1   FALDCEMCYTTDGL-ELTRVTVVDENGKVVLDELVKPDGEIVDYNTRFSGITEEMLENVT 59

Query: 425 TRLEHVQKILSELLPPDAILVGQSLNCDLHALKMMHPYVIDTSVIFNTTGIRTHKPKLKM 484
           T LE VQK L  L+ PD ILVG SL  DL ALK++HP VIDT+++F       +KP LK 
Sbjct: 60  TTLEDVQKKLLSLISPDTILVGHSLENDLKALKLIHPRVIDTAILFPHPRGPPYKPSLKN 119

Query: 485 LTSHFLGLDIQNQDGGHCSKEDAIAALRLVK 515
           L   +LG DIQ  +GGH S EDA AAL LVK
Sbjct: 120 LAKKYLGRDIQQGEGGHDSVEDARAALELVK 150

This subfamily is composed of RNA exonuclease 1 (REX1 or Rex1p), REX3 (or Rex3p), and similar eukaryotic proteins. In yeast, REX1 and REX3 are required for 5S rRNA and MRP (mitochondrial RNA processing) RNA maturation, respectively. They are DEDDh-type DnaQ-like 3'-5' exonucleases containing three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. REX1 is the major exonuclease responsible for pre-tRNA trail trimming and may also be involved in nuclear CCA turnover. REX proteins function in the processing and maturation of many RNA species, similar to the function of Escherichia coli RNase T. Length = 150

>gnl\|CDD\|99840 cd06137, DEDDh_RNase, DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonucleases PAN2, RNA exonuclease (REX)-1,-3, and -4, ISG20, and similar proteins	Back alignment and domain information

>gnl\|CDD\|99847 cd06144, REX4_like, DEDDh 3'-5' exonuclease domain of RNA exonuclease 4, XPMC2, Interferon Stimulated Gene product of 20 kDa, and similar proteins	Back alignment and domain information

>gnl\|CDD\|214685 smart00479, EXOIII, exonuclease domain in DNA-polymerase alpha and epsilon chain, ribonuclease T and other exonucleases	Back alignment and domain information

>gnl\|CDD\|99852 cd06149, ISG20, DEDDh 3'-5' exonuclease domain of Interferon Stimulated Gene product of 20 kDa, and similar proteins	Back alignment and domain information

>gnl\|CDD\|99848 cd06145, REX1_like, DEDDh 3'-5' exonuclease domain of RNA exonuclease 1, -3 and similar eukaryotic proteins	Back alignment and domain information

>gnl\|CDD\|216200 pfam00929, RNase_T, Exonuclease	Back alignment and domain information

>gnl\|CDD\|99846 cd06143, PAN2_exo, DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonuclease PAN2	Back alignment and domain information

>gnl\|CDD\|99847 cd06144, REX4_like, DEDDh 3'-5' exonuclease domain of RNA exonuclease 4, XPMC2, Interferon Stimulated Gene product of 20 kDa, and similar proteins	Back alignment and domain information

>gnl\|CDD\|99840 cd06137, DEDDh_RNase, DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonucleases PAN2, RNA exonuclease (REX)-1,-3, and -4, ISG20, and similar proteins	Back alignment and domain information

>gnl\|CDD\|99846 cd06143, PAN2_exo, DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonuclease PAN2	Back alignment and domain information

>gnl\|CDD\|176648 cd06127, DEDDh, DEDDh 3'-5' exonuclease domain family	Back alignment and domain information

>gnl\|CDD\|223916 COG0847, DnaQ, DNA polymerase III, epsilon subunit and related 3'-5' exonucleases [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|99852 cd06149, ISG20, DEDDh 3'-5' exonuclease domain of Interferon Stimulated Gene product of 20 kDa, and similar proteins	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		528
cd06143		174	PAN2_exo DEDDh 3'-5' exonuclease domain of the euk	100.0
KOG2248\|consensus		380		100.0
KOG2249\|consensus		280		100.0
cd06145		150	REX1_like DEDDh 3'-5' exonuclease domain of RNA ex	100.0
cd06149		157	ISG20 DEDDh 3'-5' exonuclease domain of Interferon	100.0
cd06137		161	DEDDh_RNase DEDDh 3'-5' exonuclease domain of the	100.0
cd06144		152	REX4_like DEDDh 3'-5' exonuclease domain of RNA ex	99.97
KOG2249\|consensus		280		99.94
cd06143		174	PAN2_exo DEDDh 3'-5' exonuclease domain of the euk	99.94
PRK07247		195	DNA polymerase III subunit epsilon; Validated	99.93
PRK07740		244	hypothetical protein; Provisional	99.92
PRK05711		240	DNA polymerase III subunit epsilon; Provisional	99.91
PRK09146		239	DNA polymerase III subunit epsilon; Validated	99.91
PRK06310		250	DNA polymerase III subunit epsilon; Validated	99.91
cd06130		156	DNA_pol_III_epsilon_like an uncharacterized bacter	99.91
TIGR01406		225	dnaQ_proteo DNA polymerase III, epsilon subunit, P	99.91
smart00479		169	EXOIII exonuclease domain in DNA-polymerase alpha	99.91
PRK09145		202	DNA polymerase III subunit epsilon; Validated	99.91
PRK06063		313	DNA polymerase III subunit epsilon; Provisional	99.91
PRK06807		313	DNA polymerase III subunit epsilon; Validated	99.91
PRK06309		232	DNA polymerase III subunit epsilon; Validated	99.91
PRK08517		257	DNA polymerase III subunit epsilon; Provisional	99.9
PRK07942		232	DNA polymerase III subunit epsilon; Provisional	99.9
TIGR00573		217	dnaq exonuclease, DNA polymerase III, epsilon subu	99.9
cd06131		167	DNA_pol_III_epsilon_Ecoli_like DEDDh 3'-5' exonucl	99.9
cd06136		177	TREX1_2 DEDDh 3'-5' exonuclease domain of three pr	99.9
PRK07983		219	exodeoxyribonuclease X; Provisional	99.9
PRK07748		207	sporulation inhibitor KapD; Provisional	99.89
PRK06195		309	DNA polymerase III subunit epsilon; Validated	99.89
KOG2248\|consensus		380		99.88
PRK07246		820	bifunctional ATP-dependent DNA helicase/DNA polyme	99.88
PRK07883		557	hypothetical protein; Validated	99.88
TIGR01298		200	RNaseT ribonuclease T. in gamma-subdivision Proteo	99.88
cd06134		189	RNaseT DEDDh 3'-5' exonuclease domain of RNase T.	99.87
PRK05168		211	ribonuclease T; Provisional	99.87
TIGR01407		850	dinG_rel DnaQ family exonuclease/DinG family helic	99.87
cd06127		159	DEDDh DEDDh 3'-5' exonuclease domain family. DEDDh	99.86
PRK08074		928	bifunctional ATP-dependent DNA helicase/DNA polyme	99.86
PRK05601		377	DNA polymerase III subunit epsilon; Validated	99.86
COG2176		1444	PolC DNA polymerase III, alpha subunit (gram-posit	99.86
TIGR01405		1213	polC_Gram_pos DNA polymerase III, alpha chain, Gra	99.86
PRK06722		281	exonuclease; Provisional	99.85
cd06133		176	ERI-1_3'hExo_like DEDDh 3'-5' exonuclease domain o	99.85
cd06138		183	ExoI_N N-terminal DEDDh 3'-5' exonuclease domain o	99.84
COG0847		243	DnaQ DNA polymerase III, epsilon subunit and relat	99.84
PF00929		164	RNase_T: Exonuclease; InterPro: IPR013520 This ent	99.83
PRK09182		294	DNA polymerase III subunit epsilon; Validated	99.82
PRK11779		476	sbcB exonuclease I; Provisional	99.76
PTZ00315		582	2'-phosphotransferase; Provisional	99.75
PRK00448		1437	polC DNA polymerase III PolC; Validated	99.75
PRK05359		181	oligoribonuclease; Provisional	99.75
cd06135		173	Orn DEDDh 3'-5' exonuclease domain of oligoribonuc	99.74
KOG1275\|consensus		1118		99.72
KOG1275\|consensus		1118		99.72
cd06149		157	ISG20 DEDDh 3'-5' exonuclease domain of Interferon	99.56
cd06145		150	REX1_like DEDDh 3'-5' exonuclease domain of RNA ex	99.52
cd06137		161	DEDDh_RNase DEDDh 3'-5' exonuclease domain of the	99.48
cd06144		152	REX4_like DEDDh 3'-5' exonuclease domain of RNA ex	99.12
cd05160		199	DEDDy_DNA_polB_exo DEDDy 3'-5' exonuclease domain	98.88
KOG3242\|consensus		208		98.74
COG1949		184	Orn Oligoribonuclease (3'-5' exoribonuclease) [RNA	98.74
cd06139		193	DNA_polA_I_Ecoli_like_exo DEDDy 3'-5' exonuclease	98.61
COG5018		210	KapD Inhibitor of the KinA pathway to sporulation,	98.56
KOG0542\|consensus		280		98.49
PF01612		176	DNA_pol_A_exo1: 3'-5' exonuclease; InterPro: IPR00	98.42
COG2925		475	SbcB Exonuclease I [DNA replication, recombination	98.36
cd06146		193	mut-7_like_exo DEDDy 3'-5' exonuclease domain of C	98.35
PRK05755		880	DNA polymerase I; Provisional	98.11
cd06130		156	DNA_pol_III_epsilon_like an uncharacterized bacter	98.03
cd06125		96	DnaQ_like_exo DnaQ-like (or DEDD) 3'-5' exonucleas	98.02
smart00479		169	EXOIII exonuclease domain in DNA-polymerase alpha	98.01
cd06141		170	WRN_exo DEDDy 3'-5' exonuclease domain of WRN and	97.97
cd00007		155	35EXOc 3'-5' exonuclease. The 35EXOc domain is res	97.86
cd06129		161	RNaseD_like DEDDy 3'-5' exonuclease domain of RNas	97.82
cd05780		195	DNA_polB_Kod1_like_exo DEDDy 3'-5' exonuclease dom	97.78
PRK07740		244	hypothetical protein; Provisional	97.66
cd06127		159	DEDDh DEDDh 3'-5' exonuclease domain family. DEDDh	97.49
PF00929		164	RNase_T: Exonuclease; InterPro: IPR013520 This ent	97.44
PF04857		262	CAF1: CAF1 family ribonuclease; InterPro: IPR00694	97.41
PRK09145		202	DNA polymerase III subunit epsilon; Validated	97.31
PRK10829		373	ribonuclease D; Provisional	97.27
cd05781		188	DNA_polB_B3_exo DEDDy 3'-5' exonuclease domain of	97.24
PRK07247		195	DNA polymerase III subunit epsilon; Validated	97.22
cd06134		189	RNaseT DEDDh 3'-5' exonuclease domain of RNase T.	97.2
TIGR00573		217	dnaq exonuclease, DNA polymerase III, epsilon subu	97.17
PRK06310		250	DNA polymerase III subunit epsilon; Validated	97.15
PRK06807		313	DNA polymerase III subunit epsilon; Validated	97.09
cd05779		204	DNA_polB_epsilon_exo DEDDy 3'-5' exonuclease domai	97.08
cd05784		193	DNA_polB_II_exo DEDDy 3'-5' exonuclease domain of	97.05
PF13482		164	RNase_H_2: RNase_H superfamily; PDB: 1TKD_A 1TK5_A	97.0
smart00474		172	35EXOc 3'-5' exonuclease. 3\' -5' exonuclease proo	97.0
cd06133		176	ERI-1_3'hExo_like DEDDh 3'-5' exonuclease domain o	96.97
PRK06063		313	DNA polymerase III subunit epsilon; Provisional	96.93
cd06142		178	RNaseD_exo DEDDy 3'-5' exonuclease domain of Ribon	96.91
cd06136		177	TREX1_2 DEDDh 3'-5' exonuclease domain of three pr	96.82
cd05777		230	DNA_polB_delta_exo DEDDy 3'-5' exonuclease domain	96.78
PRK06309		232	DNA polymerase III subunit epsilon; Validated	96.77
cd05785		207	DNA_polB_like2_exo Uncharacterized bacterial subgr	96.74
PRK07246		820	bifunctional ATP-dependent DNA helicase/DNA polyme	96.7
cd06148		197	Egl_like_exo DEDDy 3'-5' exonuclease domain of Dro	96.7
TIGR01388		367	rnd ribonuclease D. This model describes ribonucle	96.66
COG0349		361	Rnd Ribonuclease D [Translation, ribosomal structu	96.53
PRK07942		232	DNA polymerase III subunit epsilon; Provisional	96.53
TIGR01298		200	RNaseT ribonuclease T. in gamma-subdivision Proteo	96.51
PRK07748		207	sporulation inhibitor KapD; Provisional	96.51
PRK07883		557	hypothetical protein; Validated	96.51
PRK06195		309	DNA polymerase III subunit epsilon; Validated	96.51
TIGR01407		850	dinG_rel DnaQ family exonuclease/DinG family helic	96.5
cd05783		204	DNA_polB_B1_exo DEDDy 3'-5' exonuclease domain of	96.49
PRK08517		257	DNA polymerase III subunit epsilon; Provisional	96.36
TIGR01405		1213	polC_Gram_pos DNA polymerase III, alpha chain, Gra	96.34
PRK08074		928	bifunctional ATP-dependent DNA helicase/DNA polyme	95.97
PRK07983		219	exodeoxyribonuclease X; Provisional	95.8
PRK05711		240	DNA polymerase III subunit epsilon; Provisional	95.78
cd06131		167	DNA_pol_III_epsilon_Ecoli_like DEDDh 3'-5' exonucl	95.78
PRK11779		476	sbcB exonuclease I; Provisional	95.68
TIGR01406		225	dnaQ_proteo DNA polymerase III, epsilon subunit, P	95.64
PRK05168		211	ribonuclease T; Provisional	95.63
cd06138		183	ExoI_N N-terminal DEDDh 3'-5' exonuclease domain o	95.54
PRK09146		239	DNA polymerase III subunit epsilon; Validated	95.33
cd06140		178	DNA_polA_I_Bacillus_like_exo inactive DEDDy 3'-5'	95.27
COG0847		243	DnaQ DNA polymerase III, epsilon subunit and relat	95.19
PRK05762		786	DNA polymerase II; Reviewed	95.1
COG0749		593	PolA DNA polymerase I - 3'-5' exonuclease and poly	94.86
PRK06722		281	exonuclease; Provisional	94.59
cd06146		193	mut-7_like_exo DEDDy 3'-5' exonuclease domain of C	94.3
PRK00448		1437	polC DNA polymerase III PolC; Validated	94.29
cd05778		231	DNA_polB_zeta_exo inactive DEDDy 3'-5' exonuclease	93.7
PRK05601		377	DNA polymerase III subunit epsilon; Validated	93.05
cd05776		234	DNA_polB_alpha_exo inactive DEDDy 3'-5' exonucleas	93.01
cd06135		173	Orn DEDDh 3'-5' exonuclease domain of oligoribonuc	92.92
PF01612		176	DNA_pol_A_exo1: 3'-5' exonuclease; InterPro: IPR00	92.65
PF03104		325	DNA_pol_B_exo1: DNA polymerase family B, exonuclea	92.61
cd06147		192	Rrp6p_like_exo DEDDy 3'-5' exonuclease domain of y	92.49
cd09018		150	DEDDy_polA_RNaseD_like_exo DEDDy 3'-5' exonuclease	92.19
PTZ00166		1054	DNA polymerase delta catalytic subunit; Provisiona	92.11
PRK09182		294	DNA polymerase III subunit epsilon; Validated	92.09
cd06141		170	WRN_exo DEDDy 3'-5' exonuclease domain of WRN and	91.84
cd06129		161	RNaseD_like DEDDy 3'-5' exonuclease domain of RNas	90.42
cd05782		208	DNA_polB_like1_exo Uncharacterized bacterial subgr	90.34
PRK05359		181	oligoribonuclease; Provisional	89.91
PF10108		209	DNA_pol_B_exo2: Predicted 3'-5' exonuclease relate	89.53
TIGR00593		887	pola DNA polymerase I. This family is based on the	89.29
TIGR00592		1172	pol2 DNA polymerase (pol2). This family is based o	88.01
PHA02528		881	43 DNA polymerase; Provisional	86.89
cd00007		155	35EXOc 3'-5' exonuclease. The 35EXOc domain is res	84.57
smart00474		172	35EXOc 3'-5' exonuclease. 3\' -5' exonuclease proo	83.87
smart00486		471	POLBc DNA polymerase type-B family. DNA polymerase	83.41
cd06139		193	DNA_polA_I_Ecoli_like_exo DEDDy 3'-5' exonuclease	82.41
KOG4793\|consensus		318		81.95
PHA02570		220	dexA exonuclease; Provisional	80.96

>cd06143 PAN2_exo DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonuclease PAN2	Back alignment and domain information

Probab=100.00  E-value=2.6e-39  Score=306.49  Aligned_cols=147  Identities=32%  Similarity=0.468  Sum_probs=134.5

Q ss_pred             EEEeeceecCCC--------CcC--------cEEEEEEEE----eCCcEEEEEEEcCCCCCCCCceeecCCChhhhcccC
Q psy17350        365 YGLDCEMCKTSN--------DQN--------ELTRVTLVD----EQENVVYESLVKPYNPITNYLTAYSGITRALLAPVA  424 (528)
Q Consensus       365 vALDcEmtgt~~--------g~~--------eLirIs~Vd----~~G~vi~d~LVkP~~~I~dy~T~isGIT~e~L~~a~  424 (528)
                      +||||||+++++        |+.        +|+||++||    ++|+++||+||+|..+|.||+|+|||||+++|+++.
T Consensus         1 ~a~d~e~v~~~~~~~~~~~~g~~~~~~~~~~~LaRVsiVd~~~~~~g~vllD~~VkP~~~V~DYrT~~SGIt~~~L~~a~   80 (174)
T cd06143           1 VAIDAEFVKLKPEETEIRSDGTKSTIRPSQMSLARVSVVRGEGELEGVPFIDDYISTTEPVVDYLTRFSGIKPGDLDPKT   80 (174)
T ss_pred             CceeeeEEEecchhceecCCCcEeeeccCCceeEEEEEEcCCCCcCCCEEEeeeECCCCCccCcCccccccCHHHcCccc
Confidence            589999998877        433        799999999    699999999999999999999999999999999863


Q ss_pred             -----CCHHHHHHHHHhcCCCCcEEEEcCchhhHHHHcccCC--CEeeehhhchhcCCCCCCCCHHHHHHHhhCCcccCC
Q psy17350        425 -----TRLEHVQKILSELLPPDAILVGQSLNCDLHALKMMHP--YVIDTSVIFNTTGIRTHKPKLKMLTSHFLGLDIQNQ  497 (528)
Q Consensus       425 -----p~l~dV~~~L~~~i~~d~ILVGHnL~fDL~~L~~~hp--~vIDTs~L~~~~~~~~~k~sLk~La~~~Lg~~Iq~~  497 (528)
                           .++++++.++.+++++++|||||++++||++|++.||  .+|||+.+|+.+.  .++++|+.||+.|||++||.+
T Consensus        81 ~~~~~~t~~~v~~~l~~li~~~tILVGHsL~nDL~aL~l~hp~~~viDTa~l~~~~~--~r~~sLk~La~~~L~~~IQ~~  158 (174)
T cd06143          81 SSKNLTTLKSAYLKLRLLVDLGCIFVGHGLAKDFRVINIQVPKEQVIDTVELFHLPG--QRKLSLRFLAWYLLGEKIQSE  158 (174)
T ss_pred             cccccCCHHHHHHHHHHHcCCCCEEEeccchhHHHHhcCcCCCcceEEcHHhccCCC--CCChhHHHHHHHHcCCcccCC
Confidence                 4799999999999988999999999999999999988  6999999997643  358999999999999999985


Q ss_pred             CCCCChHHHHHHHHHHHH
Q psy17350        498 DGGHCSKEDAIAALRLVK  515 (528)
Q Consensus       498 ~~~HdAlEDA~AT~eL~~  515 (528)
                        +|||+|||+|||+||+
T Consensus       159 --~HdSvEDArAam~Ly~  174 (174)
T cd06143         159 --THDSIEDARTALKLYR  174 (174)
T ss_pred             --CcCcHHHHHHHHHHhC
Confidence              8999999999999984

PAN2 is the catalytic subunit of poly(A) nuclease (PAN), a Pab1p-dependent 3'-5' exoribonuclease which plays an important role in the posttranscriptional maturation of pre-mRNAs. PAN catalyzes the deadenylation of poly(A) tails, which are initially synthesized to default lengths of 70 to 90, to mRNA-specific lengths of 55 to 71. Pab1p and PAN also play a role in the export and decay of mRNA. PAN2 contains a DEDDh-type DnaQ-like 3'-5' exonuclease domain with three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis.

>KOG2248\|consensus	Back alignment and domain information

>KOG2249\|consensus	Back alignment and domain information

>cd06145 REX1_like DEDDh 3'-5' exonuclease domain of RNA exonuclease 1, -3 and similar eukaryotic proteins	Back alignment and domain information

>cd06149 ISG20 DEDDh 3'-5' exonuclease domain of Interferon Stimulated Gene product of 20 kDa, and similar proteins	Back alignment and domain information

>cd06137 DEDDh_RNase DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonucleases PAN2, RNA exonuclease (REX)-1,-3, and -4, ISG20, and similar proteins	Back alignment and domain information

>cd06144 REX4_like DEDDh 3'-5' exonuclease domain of RNA exonuclease 4, XPMC2, Interferon Stimulated Gene product of 20 kDa, and similar proteins	Back alignment and domain information

>KOG2249\|consensus	Back alignment and domain information

>cd06143 PAN2_exo DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonuclease PAN2	Back alignment and domain information

>PRK07247 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK07740 hypothetical protein; Provisional	Back alignment and domain information

>PRK05711 DNA polymerase III subunit epsilon; Provisional	Back alignment and domain information

>PRK09146 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK06310 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>cd06130 DNA_pol_III_epsilon_like an uncharacterized bacterial subgroup of the DEDDh 3'-5' exonuclease domain family with similarity to the epsilon subunit of DNA polymerase III	Back alignment and domain information

>TIGR01406 dnaQ_proteo DNA polymerase III, epsilon subunit, Proteobacterial	Back alignment and domain information

>smart00479 EXOIII exonuclease domain in DNA-polymerase alpha and epsilon chain, ribonuclease T and other exonucleases	Back alignment and domain information

>PRK09145 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK06063 DNA polymerase III subunit epsilon; Provisional	Back alignment and domain information

>PRK06807 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK06309 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK08517 DNA polymerase III subunit epsilon; Provisional	Back alignment and domain information

>PRK07942 DNA polymerase III subunit epsilon; Provisional	Back alignment and domain information

>TIGR00573 dnaq exonuclease, DNA polymerase III, epsilon subunit family	Back alignment and domain information

>cd06131 DNA_pol_III_epsilon_Ecoli_like DEDDh 3'-5' exonuclease domain of the epsilon subunit of Escherichia coli DNA polymerase III and similar proteins	Back alignment and domain information

>cd06136 TREX1_2 DEDDh 3'-5' exonuclease domain of three prime repair exonuclease (TREX)1, TREX2, and similar proteins	Back alignment and domain information

>PRK07983 exodeoxyribonuclease X; Provisional	Back alignment and domain information

>PRK07748 sporulation inhibitor KapD; Provisional	Back alignment and domain information

>PRK06195 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>KOG2248\|consensus	Back alignment and domain information

>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK07883 hypothetical protein; Validated	Back alignment and domain information

>TIGR01298 RNaseT ribonuclease T	Back alignment and domain information

>cd06134 RNaseT DEDDh 3'-5' exonuclease domain of RNase T	Back alignment and domain information

>PRK05168 ribonuclease T; Provisional	Back alignment and domain information

>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative	Back alignment and domain information

>cd06127 DEDDh DEDDh 3'-5' exonuclease domain family	Back alignment and domain information

>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK05601 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>COG2176 PolC DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR01405 polC_Gram_pos DNA polymerase III, alpha chain, Gram-positive type	Back alignment and domain information

>PRK06722 exonuclease; Provisional	Back alignment and domain information

>cd06133 ERI-1_3'hExo_like DEDDh 3'-5' exonuclease domain of Caenorhabditis elegans ERI-1, human 3' exonuclease, and similar proteins	Back alignment and domain information

>cd06138 ExoI_N N-terminal DEDDh 3'-5' exonuclease domain of Escherichia coli exonuclease I and similar proteins	Back alignment and domain information

>COG0847 DnaQ DNA polymerase III, epsilon subunit and related 3'-5' exonucleases [DNA replication, recombination, and repair]	Back alignment and domain information

>PF00929 RNase_T: Exonuclease; InterPro: IPR013520 This entry includes a variety of exonuclease proteins, such as ribonuclease T [] and the epsilon subunit of DNA polymerase III	Back alignment and domain information

>PRK09182 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK11779 sbcB exonuclease I; Provisional	Back alignment and domain information

>PTZ00315 2'-phosphotransferase; Provisional	Back alignment and domain information

>PRK00448 polC DNA polymerase III PolC; Validated	Back alignment and domain information

>PRK05359 oligoribonuclease; Provisional	Back alignment and domain information

>cd06135 Orn DEDDh 3'-5' exonuclease domain of oligoribonuclease and similar proteins	Back alignment and domain information

>KOG1275\|consensus	Back alignment and domain information

>KOG1275\|consensus	Back alignment and domain information

>cd06149 ISG20 DEDDh 3'-5' exonuclease domain of Interferon Stimulated Gene product of 20 kDa, and similar proteins	Back alignment and domain information

>cd06145 REX1_like DEDDh 3'-5' exonuclease domain of RNA exonuclease 1, -3 and similar eukaryotic proteins	Back alignment and domain information

>cd06137 DEDDh_RNase DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonucleases PAN2, RNA exonuclease (REX)-1,-3, and -4, ISG20, and similar proteins	Back alignment and domain information

>cd06144 REX4_like DEDDh 3'-5' exonuclease domain of RNA exonuclease 4, XPMC2, Interferon Stimulated Gene product of 20 kDa, and similar proteins	Back alignment and domain information

>cd05160 DEDDy_DNA_polB_exo DEDDy 3'-5' exonuclease domain of family-B DNA polymerases	Back alignment and domain information

>KOG3242\|consensus	Back alignment and domain information

>COG1949 Orn Oligoribonuclease (3'-5' exoribonuclease) [RNA processing and modification]	Back alignment and domain information

>cd06139 DNA_polA_I_Ecoli_like_exo DEDDy 3'-5' exonuclease domain of Escherichia coli DNA polymerase I and similar bacterial family-A DNA polymerases	Back alignment and domain information

>COG5018 KapD Inhibitor of the KinA pathway to sporulation, predicted exonuclease [General function prediction only]	Back alignment and domain information

>KOG0542\|consensus	Back alignment and domain information

>PF01612 DNA_pol_A_exo1: 3'-5' exonuclease; InterPro: IPR002562 This domain is responsible for the 3'-5' exonuclease proofreading activity of Escherichia coli DNA polymerase I (polI) and other enzymes, it catalyses the hydrolysis of unpaired or mismatched nucleotides	Back alignment and domain information

>COG2925 SbcB Exonuclease I [DNA replication, recombination, and repair]	Back alignment and domain information

>cd06146 mut-7_like_exo DEDDy 3'-5' exonuclease domain of Caenorhabditis elegans mut-7 and similar proteins	Back alignment and domain information

>PRK05755 DNA polymerase I; Provisional	Back alignment and domain information

>cd06130 DNA_pol_III_epsilon_like an uncharacterized bacterial subgroup of the DEDDh 3'-5' exonuclease domain family with similarity to the epsilon subunit of DNA polymerase III	Back alignment and domain information

>cd06125 DnaQ_like_exo DnaQ-like (or DEDD) 3'-5' exonuclease domain superfamily	Back alignment and domain information

>smart00479 EXOIII exonuclease domain in DNA-polymerase alpha and epsilon chain, ribonuclease T and other exonucleases	Back alignment and domain information

>cd06141 WRN_exo DEDDy 3'-5' exonuclease domain of WRN and similar proteins	Back alignment and domain information

>cd00007 35EXOc 3'-5' exonuclease	Back alignment and domain information

>cd06129 RNaseD_like DEDDy 3'-5' exonuclease domain of RNase D, WRN, and similar proteins	Back alignment and domain information

>cd05780 DNA_polB_Kod1_like_exo DEDDy 3'-5' exonuclease domain of Pyrococcus kodakaraensis Kod1 and similar archaeal family-B DNA polymerases	Back alignment and domain information

>PRK07740 hypothetical protein; Provisional	Back alignment and domain information

>cd06127 DEDDh DEDDh 3'-5' exonuclease domain family	Back alignment and domain information

>PF00929 RNase_T: Exonuclease; InterPro: IPR013520 This entry includes a variety of exonuclease proteins, such as ribonuclease T [] and the epsilon subunit of DNA polymerase III	Back alignment and domain information

>PF04857 CAF1: CAF1 family ribonuclease; InterPro: IPR006941 CAF1 is an RNase of the DEDD superfamily, and a subunit of the Ccr4-Not complex that mediates 3' to 5' mRNA deadenylation	Back alignment and domain information

>PRK09145 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK10829 ribonuclease D; Provisional	Back alignment and domain information

>cd05781 DNA_polB_B3_exo DEDDy 3'-5' exonuclease domain of Sulfurisphaera ohwakuensis DNA polymerase B3 and similar archaeal family-B DNA polymerases	Back alignment and domain information

>PRK07247 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>cd06134 RNaseT DEDDh 3'-5' exonuclease domain of RNase T	Back alignment and domain information

>TIGR00573 dnaq exonuclease, DNA polymerase III, epsilon subunit family	Back alignment and domain information

>PRK06310 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK06807 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>cd05779 DNA_polB_epsilon_exo DEDDy 3'-5' exonuclease domain of eukaryotic DNA polymerase epsilon, a family-B DNA polymerase	Back alignment and domain information

>cd05784 DNA_polB_II_exo DEDDy 3'-5' exonuclease domain of Escherichia coli DNA polymerase II and similar bacterial family-B DNA polymerases	Back alignment and domain information

>PF13482 RNase_H_2: RNase_H superfamily; PDB: 1TKD_A 1TK5_A 2AJQ_F 1T8E_A 1T7P_A 1SKR_A 1X9W_A 1TK8_A 1TK0_A 1SL2_A	Back alignment and domain information

>smart00474 35EXOc 3'-5' exonuclease	Back alignment and domain information

>cd06133 ERI-1_3'hExo_like DEDDh 3'-5' exonuclease domain of Caenorhabditis elegans ERI-1, human 3' exonuclease, and similar proteins	Back alignment and domain information

>PRK06063 DNA polymerase III subunit epsilon; Provisional	Back alignment and domain information

>cd06142 RNaseD_exo DEDDy 3'-5' exonuclease domain of Ribonuclease D and similar proteins	Back alignment and domain information

>cd06136 TREX1_2 DEDDh 3'-5' exonuclease domain of three prime repair exonuclease (TREX)1, TREX2, and similar proteins	Back alignment and domain information

>cd05777 DNA_polB_delta_exo DEDDy 3'-5' exonuclease domain of eukaryotic DNA polymerase delta, a family-B DNA polymerase	Back alignment and domain information

>PRK06309 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>cd05785 DNA_polB_like2_exo Uncharacterized bacterial subgroup of the DEDDy 3'-5' exonuclease domain of family-B DNA polymerases	Back alignment and domain information

>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>cd06148 Egl_like_exo DEDDy 3'-5' exonuclease domain of Drosophila Egalitarian (Egl) and similar proteins	Back alignment and domain information

>TIGR01388 rnd ribonuclease D	Back alignment and domain information

>COG0349 Rnd Ribonuclease D [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK07942 DNA polymerase III subunit epsilon; Provisional	Back alignment and domain information

>TIGR01298 RNaseT ribonuclease T	Back alignment and domain information

>PRK07748 sporulation inhibitor KapD; Provisional	Back alignment and domain information

>PRK07883 hypothetical protein; Validated	Back alignment and domain information

>PRK06195 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative	Back alignment and domain information

>cd05783 DNA_polB_B1_exo DEDDy 3'-5' exonuclease domain of Sulfolobus solfataricus DNA polymerase B1 and similar archaeal family-B DNA polymerases	Back alignment and domain information

>PRK08517 DNA polymerase III subunit epsilon; Provisional	Back alignment and domain information

>TIGR01405 polC_Gram_pos DNA polymerase III, alpha chain, Gram-positive type	Back alignment and domain information

>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK07983 exodeoxyribonuclease X; Provisional	Back alignment and domain information

>PRK05711 DNA polymerase III subunit epsilon; Provisional	Back alignment and domain information

>cd06131 DNA_pol_III_epsilon_Ecoli_like DEDDh 3'-5' exonuclease domain of the epsilon subunit of Escherichia coli DNA polymerase III and similar proteins	Back alignment and domain information

>PRK11779 sbcB exonuclease I; Provisional	Back alignment and domain information

>TIGR01406 dnaQ_proteo DNA polymerase III, epsilon subunit, Proteobacterial	Back alignment and domain information

>PRK05168 ribonuclease T; Provisional	Back alignment and domain information

>cd06138 ExoI_N N-terminal DEDDh 3'-5' exonuclease domain of Escherichia coli exonuclease I and similar proteins	Back alignment and domain information

>PRK09146 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>cd06140 DNA_polA_I_Bacillus_like_exo inactive DEDDy 3'-5' exonuclease domain of Bacillus stearothermophilus DNA polymerase I and similar family-A DNA polymerases	Back alignment and domain information

>COG0847 DnaQ DNA polymerase III, epsilon subunit and related 3'-5' exonucleases [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK05762 DNA polymerase II; Reviewed	Back alignment and domain information

>COG0749 PolA DNA polymerase I - 3'-5' exonuclease and polymerase domains [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK06722 exonuclease; Provisional	Back alignment and domain information

>cd06146 mut-7_like_exo DEDDy 3'-5' exonuclease domain of Caenorhabditis elegans mut-7 and similar proteins	Back alignment and domain information

>PRK00448 polC DNA polymerase III PolC; Validated	Back alignment and domain information

>cd05778 DNA_polB_zeta_exo inactive DEDDy 3'-5' exonuclease domain of eukaryotic DNA polymerase zeta, a family-B DNA polymerase	Back alignment and domain information

>PRK05601 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>cd05776 DNA_polB_alpha_exo inactive DEDDy 3'-5' exonuclease domain of eukaryotic DNA polymerase alpha, a family-B DNA polymerase	Back alignment and domain information

>cd06135 Orn DEDDh 3'-5' exonuclease domain of oligoribonuclease and similar proteins	Back alignment and domain information

>PF01612 DNA_pol_A_exo1: 3'-5' exonuclease; InterPro: IPR002562 This domain is responsible for the 3'-5' exonuclease proofreading activity of Escherichia coli DNA polymerase I (polI) and other enzymes, it catalyses the hydrolysis of unpaired or mismatched nucleotides	Back alignment and domain information

>PF03104 DNA_pol_B_exo1: DNA polymerase family B, exonuclease domain Several related DNA polymerases were too dissimilar to be included	Back alignment and domain information

>cd06147 Rrp6p_like_exo DEDDy 3'-5' exonuclease domain of yeast Rrp6p, human polymyositis/scleroderma autoantigen 100kDa, and similar proteins	Back alignment and domain information

>cd09018 DEDDy_polA_RNaseD_like_exo DEDDy 3'-5' exonuclease domain of family-A DNA polymerases, RNase D, WRN, and similar proteins	Back alignment and domain information

>PTZ00166 DNA polymerase delta catalytic subunit; Provisional	Back alignment and domain information

>PRK09182 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>cd06141 WRN_exo DEDDy 3'-5' exonuclease domain of WRN and similar proteins	Back alignment and domain information

>cd06129 RNaseD_like DEDDy 3'-5' exonuclease domain of RNase D, WRN, and similar proteins	Back alignment and domain information

>cd05782 DNA_polB_like1_exo Uncharacterized bacterial subgroup of the DEDDy 3'-5' exonuclease domain of family-B DNA polymerases	Back alignment and domain information

>PRK05359 oligoribonuclease; Provisional	Back alignment and domain information

>PF10108 DNA_pol_B_exo2: Predicted 3'-5' exonuclease related to the exonuclease domain of PolB; InterPro: IPR019288 This entry represents various prokaryotic 3'-5' exonucleases and hypothetical proteins	Back alignment and domain information

>TIGR00593 pola DNA polymerase I	Back alignment and domain information

>TIGR00592 pol2 DNA polymerase (pol2)	Back alignment and domain information

>PHA02528 43 DNA polymerase; Provisional	Back alignment and domain information

>cd00007 35EXOc 3'-5' exonuclease	Back alignment and domain information

>smart00474 35EXOc 3'-5' exonuclease	Back alignment and domain information

>smart00486 POLBc DNA polymerase type-B family	Back alignment and domain information

>cd06139 DNA_polA_I_Ecoli_like_exo DEDDy 3'-5' exonuclease domain of Escherichia coli DNA polymerase I and similar bacterial family-A DNA polymerases	Back alignment and domain information

>KOG4793\|consensus	Back alignment and domain information

>PHA02570 dexA exonuclease; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		528
1wlj_A		189	Human Isg20 Length = 189		1e-08

>pdb|1WLJ|A Chain A, Human Isg20 Length = 189

Back alignment and structure

Iteration: 1

Score = 57.8 bits (138), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 52/161 (32%), Positives = 79/161 (49%), Gaps = 17/161 (10%) Query: 367 LDCEMCKTS-NDQNELTRVTLVDEQENVVYESLVKPYNPITNYLTAYSGITRALLA---P 422 +DCEM + ++ L R +LV+ V+Y+ ++P IT+Y T SG+T + P Sbjct: 10 MDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATP 69 Query: 423 VAT-RLEHVQKILSELLPPDAILVGQSLNCDLHALKM-MHPYVI-DTS---VIFNTTGI- 475 A RLE +Q L ++VG L D ALK M Y I DTS +++ + Sbjct: 70 FAVARLEILQ------LLKGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLD 123 Query: 476 RTHKPKLKMLTSHFLGLDIQNQDGGHCSKEDAIAALRLVKL 516 + L++L+ L IQN GH S EDA A + L ++ Sbjct: 124 HCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATMELYQI 164

PyMOL of 1wlj

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		528
1wlj_A		189	Interferon stimulated gene 20KDA; exoribonuclease,	4e-61
1wlj_A		189	Interferon stimulated gene 20KDA; exoribonuclease,	1e-16
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-08
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-05

>1wlj_A Interferon stimulated gene 20KDA; exoribonuclease, hydrolase; HET: U5P; 1.90A {Homo sapiens} SCOP: c.55.3.5 Length = 189	Back alignment and structure

 Score =  198 bits (505), Expect = 4e-61
 Identities = 46/168 (27%), Positives = 74/168 (44%), Gaps = 9/168 (5%)

Query: 358 VTPTSPLYGLDCEMCKTSNDQ-NELTRVTLVDEQENVVYESLVKPYNPITNYLTAYSGIT 416
           +  +  +  +DCEM      + + L R +LV+    V+Y+  ++P   IT+Y T  SG+T
Sbjct: 1   MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVT 60

Query: 417 RALLAPVATRLEHVQKILSELLPPDAILVGQSLNCDLHALKMMHP--YVIDTSVI----F 470
              +   AT     +  + +LL    ++VG  L  D  ALK       + DTS       
Sbjct: 61  PQHMVG-ATPFAVARLEILQLL-KGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWR 118

Query: 471 NTTGIRTHKPKLKMLTSHFLGLDIQNQDGGHCSKEDAIAALRLVKLKL 518
                   +  L++L+   L   IQN   GH S EDA A + L ++  
Sbjct: 119 EAKLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATMELYQISQ 166

PyMOL of 1wlj

>1wlj_A Interferon stimulated gene 20KDA; exoribonuclease, hydrolase; HET: U5P; 1.90A {Homo sapiens} SCOP: c.55.3.5 Length = 189	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		528
1wlj_A		189	Interferon stimulated gene 20KDA; exoribonuclease,	99.97
2p1j_A		186	POLIII, DNA polymerase III POLC-type; structural g	99.95
2gui_A		194	DNA polymerase III epsilon subunit; DNA polymerase	99.93
1w0h_A		204	3'-5' exonuclease ERI1; nuclease domain, hydrolase	99.92
3mxm_B		242	Three prime repair exonuclease 1; RNAse H-like fol	99.91
1y97_A		238	Three prime repair exonuclease 2; TREX2, hydrolase	99.91
2xri_A		224	ERI1 exoribonuclease 3; hydrolase, metal binding;	99.9
2igi_A		180	Oligoribonuclease; RNAse, exoribonuclease, exonucl	99.9
1zbh_A		299	3'-5' exonuclease ERI1; histone mRNA 3'-END-specif	99.9
2f96_A		224	Ribonuclease T; RNAse, RNT, RNAse T, tRNA hydrolas	99.89
3u3y_B		314	Three prime repair exonuclease 1; RNAse H fold, 3'	99.89
2gbz_A		194	Oligoribonuclease; ORN, deddh, structural genomics	99.88
3cg7_A		308	CRN-4, cell death-related nuclease 4; hydrolase, a	99.87
1zbu_A		349	ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase;	99.87
3v9w_A		235	Ribonuclease T; DEDD nucleases family, EXO-nucleas	99.87
2qxf_A		482	Exodeoxyribonuclease I; alpha-beta domain, DNAQ su	99.83
3tr8_A		186	Oligoribonuclease; transcription, hydrolase; 2.50A	99.83
1wlj_A		189	Interferon stimulated gene 20KDA; exoribonuclease,	99.06
2kfn_A		605	Klenow fragment of DNA polymerase I; complex (poly	98.71
4hec_A		190	Putative uncharacterized protein; ssgcid, structur	98.69
1x9m_A		698	DNA polymerase; DNA ploymerase, N-2-acetylaminoflu	98.58
2p1j_A		186	POLIII, DNA polymerase III POLC-type; structural g	98.1
2gui_A		194	DNA polymerase III epsilon subunit; DNA polymerase	97.97
4dfk_A		540	DNA polymerase I, thermostable; DNA polymerase, tr	97.91
3saf_A		428	Exosome component 10; exoribonuclease, RNA exosome	97.86
1y97_A		238	Three prime repair exonuclease 2; TREX2, hydrolase	97.65
1w0h_A		204	3'-5' exonuclease ERI1; nuclease domain, hydrolase	97.65
2igi_A		180	Oligoribonuclease; RNAse, exoribonuclease, exonucl	97.64
2f96_A		224	Ribonuclease T; RNAse, RNT, RNAse T, tRNA hydrolas	97.58
2xri_A		224	ERI1 exoribonuclease 3; hydrolase, metal binding;	97.57
1vk0_A		206	Hypothetical protein; homohexamer, AT5G06450, stru	97.53
2e6m_A		208	Werner syndrome ATP-dependent helicase homolog; AP	97.48
1zbh_A		299	3'-5' exonuclease ERI1; histone mRNA 3'-END-specif	97.4
3mxm_B		242	Three prime repair exonuclease 1; RNAse H-like fol	97.34
1qht_A		775	Protein (DNA polymerase); archaea, hyperthermostab	97.27
3v9w_A		235	Ribonuclease T; DEDD nucleases family, EXO-nucleas	97.27
1zbu_A		349	ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase;	97.26
4gmj_B		285	CCR4-NOT transcription complex subunit 7; mRNA dec	97.22
1noy_A		388	Protein (DNA polymerase (E.C.2.7.7.7)); exonucleas	97.2
2gbz_A		194	Oligoribonuclease; ORN, deddh, structural genomics	97.16
3u3y_B		314	Three prime repair exonuclease 1; RNAse H fold, 3'	97.14
1yt3_A		375	Ribonuclease D, RNAse D; exoribonuclease, exonucle	97.01
2hbj_A		410	Exosome complex exonuclease RRP6; RNA metabolism,	96.91
3pv8_A		592	DNA polymerase I; DNA polymerase I, protein-DNA co	96.81
3cg7_A		308	CRN-4, cell death-related nuclease 4; hydrolase, a	96.81
1s5j_A		847	DNA polymerase I; replication, disulfide bonds, tr	96.38
2qxf_A		482	Exodeoxyribonuclease I; alpha-beta domain, DNAQ su	96.3
2p51_A		333	SPCC18.06C protein; DEDD nuclease fold, hydrolase,	96.08
2d5r_A		252	CCR4-NOT transcription complex subunit 7; poly(A)	96.04
3iay_A		919	DNA polymerase delta catalytic subunit; protein-DN	95.93
3cym_A		440	Uncharacterized protein BAD_0989; structural genom	95.89
3k59_A		786	POL II, DNA polymerase II; protein-DNA complex, DN	95.72
3tr8_A		186	Oligoribonuclease; transcription, hydrolase; 2.50A	95.64
3qex_A		903	DNA polymerase, GP43; difluorotoluene nucleoside;	95.61
1uoc_A		289	POP2; hydrolase, DEDD nuclease, mRNA degradation,	95.51
2a1r_A		430	Poly(A)-specific ribonuclease PARN; DEDD, nuclease	95.07
3d45_A		507	Poly(A)-specific ribonuclease PARN; CAP analogue,	94.7
2gv9_A		1193	DNA polymerase; polymerase alpha fold, transferase	94.0
1vk0_A		206	Hypothetical protein; homohexamer, AT5G06450, stru	91.27
2e6m_A		208	Werner syndrome ATP-dependent helicase homolog; AP	85.52
3saf_A		428	Exosome component 10; exoribonuclease, RNA exosome	81.39

>1wlj_A Interferon stimulated gene 20KDA; exoribonuclease, hydrolase; HET: U5P; 1.90A {Homo sapiens} SCOP: c.55.3.5	Back alignment and structure

Probab=99.97  E-value=6.3e-31  Score=249.24  Aligned_cols=159  Identities=29%  Similarity=0.401  Sum_probs=137.2

Q ss_pred             CCCeEEEeeceecCCCCc-CcEEEEEEEEeCCcEEEEEEEcCCCCCCCCceeecCCChhhhcccCCCHHHHHHHHHhcCC
Q psy17350        361 TSPLYGLDCEMCKTSNDQ-NELTRVTLVDEQENVVYESLVKPYNPITNYLTAYSGITRALLAPVATRLEHVQKILSELLP  439 (528)
Q Consensus       361 ~~~~vALDcEmtgt~~g~-~eLirIs~Vd~~G~vi~d~LVkP~~~I~dy~T~isGIT~e~L~~a~p~l~dV~~~L~~~i~  439 (528)
                      ..+|++|||||||+++.. .+|++|++|+.+|+++|++||+|..+|+++++++||||++||++ +|++++|+++|.++++
T Consensus         4 ~~~~vviD~ETTGl~~~~~~~iiei~~v~~~g~~i~~~lV~P~~~i~~~~~~i~GIt~~~l~~-a~~~~~v~~~~~~~l~   82 (189)
T 1wlj_A            4 SREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVG-ATPFAVARLEILQLLK   82 (189)
T ss_dssp             --CEEEEEEEEEEETTTTEEEEEEEEEECTTCCEEEEEEEECSSCEEECCHHHHCCCHHHHTT-CEEHHHHHHHHHHHHT
T ss_pred             CCeEEEEEeECcCcCCCCCceEEEEEEEeCCCCEEEeeEecCCCCCCccccCCCCCCHHHHcC-CCCHHHHHHHHHHHHC
Confidence            457999999999998764 58899999999999999999999999999999999999999999 5999999999999998


Q ss_pred             CCcEEEEcCchhhHHHHcccCCC--Eeeehhhchhc---CC-CCCCCCHHHHHHHhhCCcccCCCCCCChHHHHHHHHHH
Q psy17350        440 PDAILVGQSLNCDLHALKMMHPY--VIDTSVIFNTT---GI-RTHKPKLKMLTSHFLGLDIQNQDGGHCSKEDAIAALRL  513 (528)
Q Consensus       440 ~d~ILVGHnL~fDL~~L~~~hp~--vIDTs~L~~~~---~~-~~~k~sLk~La~~~Lg~~Iq~~~~~HdAlEDA~AT~eL  513 (528)
                       +++|||||+.||+++|+..+|+  ++||..++...   .. ...+++|+.||+.|||++++.+..+|+|++||+||++|
T Consensus        83 -~~~lV~hn~~fD~~~L~~~~~~~~~idt~~~~~~~~~~~~p~~~~~~L~~l~~~~lgi~~~~~~~~H~Al~Da~ata~l  161 (189)
T 1wlj_A           83 -GKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATMEL  161 (189)
T ss_dssp             -TSEEEESSHHHHHHHTTCCCTTCEEEEGGGCHHHHHHHTC-----CCHHHHHHHHTCCCCSCCTTCCCHHHHHHHHHHH
T ss_pred             -CCEEEECCcHHHHHHHHHhCCCCceechHhhhhhhhcccCCCCCCccHHHHHHHHcCCCCCCCCCCcCcHHHHHHHHHH
Confidence             9999999999999999998885  89999885421   22 23578999999987899987632379999999999999


Q ss_pred             HHHHHHcC
Q psy17350        514 VKLKLSKG  521 (528)
Q Consensus       514 ~~~~L~~g  521 (528)
                      |+++++.-
T Consensus       162 ~~~l~~~~  169 (189)
T 1wlj_A          162 YQISQRIR  169 (189)
T ss_dssp             HHHHHHHH
T ss_pred             HHHHHHHH
Confidence            99887653

PyMOL of 1wlj

>2p1j_A POLIII, DNA polymerase III POLC-type; structural genomics, exonuclease, PSI-2, protein structure initiative; HET: DNA; 2.50A {Thermotoga maritima MSB8}	Back alignment and structure

>2gui_A DNA polymerase III epsilon subunit; DNA polymerase proofreading domain, transferase; HET: DNA U5P; 1.60A {Escherichia coli} SCOP: c.55.3.5 PDB: 1j54_A* 1j53_A* 2ido_A* 2xy8_A*	Back alignment and structure

>1w0h_A 3'-5' exonuclease ERI1; nuclease domain, hydrolase; HET: AMP; 1.59A {Homo sapiens} SCOP: c.55.3.5	Back alignment and structure

>3mxm_B Three prime repair exonuclease 1; RNAse H-like fold, polyproline type II helix, hydrolase-DNA; HET: DNA; 1.75A {Mus musculus} SCOP: c.55.3.5 PDB: 3mxj_B 2ioc_B 3mxi_B* 3b6o_A* 2o4g_A* 3b6p_A* 2o4i_A 2oa8_A	Back alignment and structure

>1y97_A Three prime repair exonuclease 2; TREX2, hydrolase; 2.50A {Homo sapiens} SCOP: c.55.3.5	Back alignment and structure

>2xri_A ERI1 exoribonuclease 3; hydrolase, metal binding; 2.15A {Homo sapiens}	Back alignment and structure

>2igi_A Oligoribonuclease; RNAse, exoribonuclease, exonuclease, hydrolase, mRNA decay; 1.70A {Escherichia coli} SCOP: c.55.3.5 PDB: 1yta_A 1j9a_A	Back alignment and structure

>1zbh_A 3'-5' exonuclease ERI1; histone mRNA 3'-END-specific recognition, structures of 3'- exonuclease and ITS RNA complex, hydrolase/RNA complex; HET: AMP; 3.00A {Homo sapiens}	Back alignment and structure

>2f96_A Ribonuclease T; RNAse, RNT, RNAse T, tRNA hydrolase, SAD, PS protein structure initiative, midwest center for structural genomics; 2.09A {Pseudomonas aeruginosa} SCOP: c.55.3.5	Back alignment and structure

>3u3y_B Three prime repair exonuclease 1; RNAse H fold, 3' exonuclease, homodimer, hydrolase-DNA compl; HET: BU1; 2.28A {Mus musculus} PDB: 3u6f_B*	Back alignment and structure

>2gbz_A Oligoribonuclease; ORN, deddh, structural genomics, hydrolase; 2.30A {Xanthomonas campestris PV}	Back alignment and structure

>3cg7_A CRN-4, cell death-related nuclease 4; hydrolase, apoptosis, 3'-5' exonuclease, deddh; 2.50A {Caenorhabditis elegans} PDB: 3cm5_A 3cm6_A	Back alignment and structure

>1zbu_A ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase; HET: AMP; 3.00A {Homo sapiens}	Back alignment and structure

>3v9w_A Ribonuclease T; DEDD nucleases family, EXO-nucleases, hydrolase-DNA complex; HET: DNA; 1.70A {Escherichia coli} PDB: 3ngy_A 3v9u_A* 3ngz_A* 3va3_A* 3v9z_A* 3nh0_A 3nh2_A 3nh1_A* 3v9s_A* 3v9x_A* 3va0_A* 2is3_A	Back alignment and structure

>2qxf_A Exodeoxyribonuclease I; alpha-beta domain, DNAQ superfamily, SH3-like domain, produc structure, DNA damage, DNA repair, exonuclease; HET: TMP; 1.50A {Escherichia coli} SCOP: c.55.3.5 PDB: 1fxx_A* 3c94_A 3c95_A 3hl8_A* 3hp9_A*	Back alignment and structure

>3tr8_A Oligoribonuclease; transcription, hydrolase; 2.50A {Coxiella burnetii}	Back alignment and structure

>1wlj_A Interferon stimulated gene 20KDA; exoribonuclease, hydrolase; HET: U5P; 1.90A {Homo sapiens} SCOP: c.55.3.5	Back alignment and structure

>2kfn_A Klenow fragment of DNA polymerase I; complex (polymerase/DNA), exonuclease, transferase, transferase/DNA complex; HET: US1; 2.03A {Escherichia coli} SCOP: c.55.3.5 e.8.1.1 PDB: 1d9f_A* 1d9d_A* 1krp_A* 1ksp_A* 1qsl_A* 1kfs_A* 2kfz_A* 2kzm_A* 2kzz_A* 1dpi_A* 1kfd_A* 1kln_A* 1d8y_A*	Back alignment and structure

>4hec_A Putative uncharacterized protein; ssgcid, structural genomics, SEA structural genomics center for infectious disease, unknown; 1.80A {Mycobacterium tuberculosis}	Back alignment and structure

>1x9m_A DNA polymerase; DNA ploymerase, N-2-acetylaminofluorene, replication block, mutagenesis, transferase/electron transport/DNA complex; HET: DNA 2DT 8FG; 2.10A {Enterobacteria phage T7} SCOP: c.55.3.5 e.8.1.1 PDB: 1skr_A* 1skw_A* 1sl0_A* 1sks_A* 1sl2_A* 1t7p_A* 1t8e_A* 1tk0_A* 1tk5_A* 1tk8_A* 1tkd_A* 1sl1_A* 1x9s_A* 1x9w_A* 1zyq_A* 2ajq_A*	Back alignment and structure

>2p1j_A POLIII, DNA polymerase III POLC-type; structural genomics, exonuclease, PSI-2, protein structure initiative; HET: DNA; 2.50A {Thermotoga maritima MSB8}	Back alignment and structure

>2gui_A DNA polymerase III epsilon subunit; DNA polymerase proofreading domain, transferase; HET: DNA U5P; 1.60A {Escherichia coli} SCOP: c.55.3.5 PDB: 1j54_A* 1j53_A* 2ido_A* 2xy8_A*	Back alignment and structure

>4dfk_A DNA polymerase I, thermostable; DNA polymerase, transferase-DNA complex; HET: DNA DOC 0L5; 1.65A {Thermus aquaticus} PDB: 1jxe_A* 3ktq_A* 3lwl_A* 3lwm_A* 3m8s_A* 3m8r_A* 3oju_A* 3rr7_A* 3rr8_A* 3rrg_A* 3ojs_A* 3rtv_A* 3sv3_A* 3sv4_A* 3syz_A* 3sz2_A* 3t3f_A* 4df4_A* 4df8_A* 4dfj_A* ...	Back alignment and structure

>3saf_A Exosome component 10; exoribonuclease, RNA exosome, hydrolase; 2.50A {Homo sapiens} PDB: 3sag_A 3sah_A 2cpr_A	Back alignment and structure

>1y97_A Three prime repair exonuclease 2; TREX2, hydrolase; 2.50A {Homo sapiens} SCOP: c.55.3.5	Back alignment and structure

>1w0h_A 3'-5' exonuclease ERI1; nuclease domain, hydrolase; HET: AMP; 1.59A {Homo sapiens} SCOP: c.55.3.5	Back alignment and structure

>2igi_A Oligoribonuclease; RNAse, exoribonuclease, exonuclease, hydrolase, mRNA decay; 1.70A {Escherichia coli} SCOP: c.55.3.5 PDB: 1yta_A 1j9a_A	Back alignment and structure

>2f96_A Ribonuclease T; RNAse, RNT, RNAse T, tRNA hydrolase, SAD, PS protein structure initiative, midwest center for structural genomics; 2.09A {Pseudomonas aeruginosa} SCOP: c.55.3.5	Back alignment and structure

>2xri_A ERI1 exoribonuclease 3; hydrolase, metal binding; 2.15A {Homo sapiens}	Back alignment and structure

>1vk0_A Hypothetical protein; homohexamer, AT5G06450, struc genomics, protein structure initiative, center for eukaryot structural genomics, CESG; 2.10A {Arabidopsis thaliana} SCOP: c.55.3.5 PDB: 2q3s_A	Back alignment and structure

>2e6m_A Werner syndrome ATP-dependent helicase homolog; APO form, hydrolase; 2.00A {Mus musculus} PDB: 2e6l_A 2fby_A 2fbv_A 2fbx_A 2fbt_A 2fc0_A*	Back alignment and structure

>1zbh_A 3'-5' exonuclease ERI1; histone mRNA 3'-END-specific recognition, structures of 3'- exonuclease and ITS RNA complex, hydrolase/RNA complex; HET: AMP; 3.00A {Homo sapiens}	Back alignment and structure

>3mxm_B Three prime repair exonuclease 1; RNAse H-like fold, polyproline type II helix, hydrolase-DNA; HET: DNA; 1.75A {Mus musculus} SCOP: c.55.3.5 PDB: 3mxj_B 2ioc_B 3mxi_B* 3b6o_A* 2o4g_A* 3b6p_A* 2o4i_A 2oa8_A	Back alignment and structure

>1qht_A Protein (DNA polymerase); archaea, hyperthermostable, family B polymer alpha family polymerase, transferase; 2.10A {Thermococcus SP} SCOP: c.55.3.5 e.8.1.1 PDB: 1tgo_A 2xhb_A* 2vwj_A* 2vwk_A* 1wns_A* 1wn7_A 1qqc_A* 4ahc_A* 4ail_C* 3a2f_A* 2jgu_A* 1d5a_A	Back alignment and structure

>3v9w_A Ribonuclease T; DEDD nucleases family, EXO-nucleases, hydrolase-DNA complex; HET: DNA; 1.70A {Escherichia coli} PDB: 3ngy_A 3v9u_A* 3ngz_A* 3va3_A* 3v9z_A* 3nh0_A 3nh2_A 3nh1_A* 3v9s_A* 3v9x_A* 3va0_A* 2is3_A	Back alignment and structure

>1zbu_A ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase; HET: AMP; 3.00A {Homo sapiens}	Back alignment and structure

>4gmj_B CCR4-NOT transcription complex subunit 7; mRNA decay, deadenylase, RNA bindin; HET: GOL; 2.70A {Homo sapiens}	Back alignment and structure

>1noy_A Protein (DNA polymerase (E.C.2.7.7.7)); exonuclease, DNA-binding, complex (nucleotidyltransferase/DNA); HET: DNA; 2.20A {Enterobacteria phage T4} SCOP: c.55.3.5 PDB: 1noz_A*	Back alignment and structure

>2gbz_A Oligoribonuclease; ORN, deddh, structural genomics, hydrolase; 2.30A {Xanthomonas campestris PV}	Back alignment and structure

>3u3y_B Three prime repair exonuclease 1; RNAse H fold, 3' exonuclease, homodimer, hydrolase-DNA compl; HET: BU1; 2.28A {Mus musculus} PDB: 3u6f_B*	Back alignment and structure

>1yt3_A Ribonuclease D, RNAse D; exoribonuclease, exonuclease, hydrolase, tRNA processing, hydrolase,translation; 1.60A {Escherichia coli} SCOP: a.60.8.3 a.60.8.3 c.55.3.5	Back alignment and structure

>2hbj_A Exosome complex exonuclease RRP6; RNA metabolism, RNA surveillance, RNA processing, hydrolase, gene regulation; 2.10A {Saccharomyces cerevisiae} SCOP: a.60.8.4 c.55.3.5 PDB: 2hbk_A 2hbl_A* 2hbm_A*	Back alignment and structure

>3pv8_A DNA polymerase I; DNA polymerase I, protein-DNA complex, thymine-adenine, CLOS conformation; HET: DNA 2DT D3T; 1.52A {Geobacillus kaustophilus} PDB: 3px0_A* 3px4_A* 3px6_A* 3thv_A* 3ti0_A* 4dse_A* 4dsf_A* 4ds4_A* 4dqp_A* 4dqi_A* 4ds5_A* 4e0d_A* 4dqr_A* 4dqq_A* 3tan_A* 3tap_A* 3taq_A* 3tar_A* 4dqs_A* 3hp6_A* ...	Back alignment and structure

>3cg7_A CRN-4, cell death-related nuclease 4; hydrolase, apoptosis, 3'-5' exonuclease, deddh; 2.50A {Caenorhabditis elegans} PDB: 3cm5_A 3cm6_A	Back alignment and structure

>1s5j_A DNA polymerase I; replication, disulfide bonds, transferase; HET: DNA; 2.40A {Sulfolobus solfataricus} SCOP: c.55.3.5 e.8.1.1	Back alignment and structure

>2qxf_A Exodeoxyribonuclease I; alpha-beta domain, DNAQ superfamily, SH3-like domain, produc structure, DNA damage, DNA repair, exonuclease; HET: TMP; 1.50A {Escherichia coli} SCOP: c.55.3.5 PDB: 1fxx_A* 3c94_A 3c95_A 3hl8_A* 3hp9_A*	Back alignment and structure

>2p51_A SPCC18.06C protein; DEDD nuclease fold, hydrolase, gene regulation; 1.40A {Schizosaccharomyces pombe} PDB: 3g0z_A 3g10_A	Back alignment and structure

>2d5r_A CCR4-NOT transcription complex subunit 7; poly(A) deadenylase, antiproliferative protein, transcription; 2.50A {Homo sapiens} SCOP: c.55.3.9	Back alignment and structure

>3iay_A DNA polymerase delta catalytic subunit; protein-DNA complex, DNA replication, DNA-BI DNA-directed DNA polymerase, exonuclease, hydrolase; HET: DNA DOC DCP; 2.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3cym_A Uncharacterized protein BAD_0989; structural genomics, unknown function; 2.10A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID}	Back alignment and structure

>3k59_A POL II, DNA polymerase II; protein-DNA complex, DNA damage, DNA repair, DNA-binding; HET: DNA DOC DCP; 1.92A {Escherichia coli} PDB: 3k57_A* 3k58_A* 3k5l_A* 3k5m_A* 3k5n_A* 3k5o_A* 3maq_A* 1q8i_A*	Back alignment and structure

>3tr8_A Oligoribonuclease; transcription, hydrolase; 2.50A {Coxiella burnetii}	Back alignment and structure

>3qex_A DNA polymerase, GP43; difluorotoluene nucleoside; HET: DNA DOC DGT; 1.73A {Enterobacteria phage RB69} PDB: 3qei_A* 3qer_A* 3qes_A* 3qet_A* 3qep_A* 3qew_A* 3qev_A* 3s9h_A* 3sq0_A* 4dtn_A* 4dto_A* 4dtp_A* 4dtr_A* 4dts_A* 4dtu_A* 4dtx_A* 4e3s_A* 4fjm_A* 4fjl_A* 3spz_A* ...	Back alignment and structure

>1uoc_A POP2; hydrolase, DEDD nuclease, mRNA degradation, poly(A) tail, transcription regulation, repressor, phosphorylation.; 2.3A {Saccharomyces cerevisiae} SCOP: c.55.3.9	Back alignment and structure

>2a1r_A Poly(A)-specific ribonuclease PARN; DEDD, nuclease domain, hydrolase-RNA complex; 2.60A {Homo sapiens} PDB: 2a1s_A	Back alignment and structure

>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus}	Back alignment and structure

>2gv9_A DNA polymerase; polymerase alpha fold, transferase; HET: DNA; 2.68A {Human herpesvirus 1} PDB: 1dml_B*	Back alignment and structure

>1vk0_A Hypothetical protein; homohexamer, AT5G06450, struc genomics, protein structure initiative, center for eukaryot structural genomics, CESG; 2.10A {Arabidopsis thaliana} SCOP: c.55.3.5 PDB: 2q3s_A	Back alignment and structure

>2e6m_A Werner syndrome ATP-dependent helicase homolog; APO form, hydrolase; 2.00A {Mus musculus} PDB: 2e6l_A 2fby_A 2fbv_A 2fbx_A 2fbt_A 2fc0_A*	Back alignment and structure

>3saf_A Exosome component 10; exoribonuclease, RNA exosome, hydrolase; 2.50A {Homo sapiens} PDB: 3sag_A 3sah_A 2cpr_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		528
d1wlja_		173	c.55.3.5 (A:) Interferon-stimulated gene 20 kDa pr	4e-21
d1wlja_		173	c.55.3.5 (A:) Interferon-stimulated gene 20 kDa pr	1e-09

>d1wlja_ c.55.3.5 (A:) Interferon-stimulated gene 20 kDa protein, ISG20 {Human (Homo sapiens) [TaxId: 9606]} Length = 173	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Ribonuclease H-like
family: DnaQ-like 3'-5' exonuclease
domain: Interferon-stimulated gene 20 kDa protein, ISG20
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 88.5 bits (218), Expect = 4e-21
 Identities = 42/159 (26%), Positives = 66/159 (41%), Gaps = 9/159 (5%)

Query: 367 LDCEMCKTSNDQNE-LTRVTLVDEQENVVYESLVKPYNPITNYLTAYSGITRALLAPVAT 425
           +DCEM      +   L R +LV+    V+Y+  ++P   IT+Y T  SG+T   +     
Sbjct: 5   MDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATP 64

Query: 426 RLEHVQKILSELLPPDAILVGQSLNCDLHALK------MMHPYVIDTSVIFNTTGIRTHK 479
                 +IL        ++VG  L  D  ALK       ++    D  +          +
Sbjct: 65  FAVARLEILQL--LKGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHCRR 122

Query: 480 PKLKMLTSHFLGLDIQNQDGGHCSKEDAIAALRLVKLKL 518
             L++L+   L   IQN   GH S EDA A + L ++  
Sbjct: 123 VSLRVLSERLLHKSIQNSLLGHSSVEDARATMELYQISQ 161

PyMOL of d1wlja_

>d1wlja_ c.55.3.5 (A:) Interferon-stimulated gene 20 kDa protein, ISG20 {Human (Homo sapiens) [TaxId: 9606]} Length = 173	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		528
d1wlja_		173	Interferon-stimulated gene 20 kDa protein, ISG20 {	99.97
d2guia1		174	N-terminal exonuclease domain of the epsilon subun	99.87
d3b6oa1		226	Three prime repair exonuclease 1, TREX1 {Mouse (Mu	99.85
d1y97a1		228	Three prime repair exonuclease 2, TREX2 {Human (Ho	99.82
d1w0ha_		200	Exonuclease ERI1 {Human (Homo sapiens) [TaxId: 960	99.77
d2f96a1		202	Ribonuclease T {Pseudomonas aeruginosa [TaxId: 287	99.62
d2qxfa1		467	Exonuclease I {Escherichia coli K12 (Escherichia c	99.57
d2igia1		180	Oligoribonuclease {Escherichia coli [TaxId: 562]}	99.3
d1wlja_		173	Interferon-stimulated gene 20 kDa protein, ISG20 {	98.98
d1kfsa1		195	Exonuclease domain of prokaryotic DNA polymerase {	98.66
d1yt3a3		193	Ribonuclease D, catalytic domain {Escherichia coli	98.46
d2hbka2		292	Exosome complex exonuclease RRP6 {Baker's yeast (S	97.98
d1vk0a_		206	Hypothetical protein AT5G06450 {Thale-cress (Arabi	97.91
d2d5ra1		252	CCR4-NOT transcription complex subunit 7, CAF1 {Hu	97.74
d2hhva1		171	Exonuclease domain of prokaryotic DNA polymerase {	97.68
d1x9ma1		204	Exonuclease domain of T7 DNA polymerase {Bacteriop	97.63
d3b6oa1		226	Three prime repair exonuclease 1, TREX1 {Mouse (Mu	97.41
d1tgoa1		347	Exonuclease domain of family B DNA polymerases {Ar	96.97
d1y97a1		228	Three prime repair exonuclease 2, TREX2 {Human (Ho	96.88
d2guia1		174	N-terminal exonuclease domain of the epsilon subun	96.36
d1uoca_		286	Pop2 RNase D domain {Baker's yeast (Saccharomyces	96.04
d1w0ha_		200	Exonuclease ERI1 {Human (Homo sapiens) [TaxId: 960	95.95
d1q8ia1		388	Exonuclease domain of family B DNA polymerases {Es	95.68
d1s5ja1		410	Exonuclease domain of family B DNA polymerases {Su	94.73
d1yt3a3		193	Ribonuclease D, catalytic domain {Escherichia coli	90.94
d1vk0a_		206	Hypothetical protein AT5G06450 {Thale-cress (Arabi	90.29
d1noya_		372	Exonuclease domain of family B DNA polymerases {Ba	89.34
d2qxfa1		467	Exonuclease I {Escherichia coli K12 (Escherichia c	87.61
d1ih7a1		375	Exonuclease domain of family B DNA polymerases {Ba	85.19
d2f96a1		202	Ribonuclease T {Pseudomonas aeruginosa [TaxId: 287	83.13
d2hbka2		292	Exosome complex exonuclease RRP6 {Baker's yeast (S	81.87

>d1wlja_ c.55.3.5 (A:) Interferon-stimulated gene 20 kDa protein, ISG20 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Ribonuclease H-like
family: DnaQ-like 3'-5' exonuclease
domain: Interferon-stimulated gene 20 kDa protein, ISG20
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.97  E-value=2.3e-31  Score=242.37  Aligned_cols=155  Identities=27%  Similarity=0.374  Sum_probs=132.3

Q ss_pred             CeEEEeeceecCCCCcCcEE-EEEEEEeCCcEEEEEEEcCCCCCCCCceeecCCChhhhcccCCCHHHHHHHHHhcCCCC
Q psy17350        363 PLYGLDCEMCKTSNDQNELT-RVTLVDEQENVVYESLVKPYNPITNYLTAYSGITRALLAPVATRLEHVQKILSELLPPD  441 (528)
Q Consensus       363 ~~vALDcEmtgt~~g~~eLi-rIs~Vd~~G~vi~d~LVkP~~~I~dy~T~isGIT~e~L~~a~p~l~dV~~~L~~~i~~d  441 (528)
                      ++|||||||||+++++++++ .+++|+.+|+++|++||+|..+|+++++++||||+++++++ +++++++++|.++++ +
T Consensus         1 ~~v~iD~EttGl~~~~~~ii~~~~iv~~~g~~i~~~~v~p~~~i~~~~~~i~GIt~e~~~~~-~~~~~~~~~~~~~~~-~   78 (173)
T d1wlja_           1 EVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGA-TPFAVARLEILQLLK-G   78 (173)
T ss_dssp             CEEEEEEEEEEETTTTEEEEEEEEEECTTCCEEEEEEEECSSCEEECCHHHHCCCHHHHTTC-EEHHHHHHHHHHHHT-T
T ss_pred             CEEEEEEEcCCCCCCCCcEEEEEEEEEecCeEEEEEeeecccccCcceeEEecCcchhhhcC-CcHHHHHHHHHhhcc-c
Confidence            48999999999998877655 68899999999999999999999999999999999999994 999999999999998 9


Q ss_pred             cEEEEcCchhhHHHHcccCCC------EeeehhhchhcCCCCCCCCHHHHHHHhhCCcccCCCCCCChHHHHHHHHHHHH
Q psy17350        442 AILVGQSLNCDLHALKMMHPY------VIDTSVIFNTTGIRTHKPKLKMLTSHFLGLDIQNQDGGHCSKEDAIAALRLVK  515 (528)
Q Consensus       442 ~ILVGHnL~fDL~~L~~~hp~------vIDTs~L~~~~~~~~~k~sLk~La~~~Lg~~Iq~~~~~HdAlEDA~AT~eL~~  515 (528)
                      .++||||+.||+++|+...++      .+||..+++...+..++++|+.||+.|++.+++.+..+|+|++||+||++||+
T Consensus        79 ~~lv~hn~~fD~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~~~~~~~~i~~~~~~H~Al~Da~at~~l~~  158 (173)
T d1wlja_          79 KLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATMELYQ  158 (173)
T ss_dssp             SEEEESSHHHHHHHTTCCCTTCEEEEGGGCHHHHHHHTC-----CCHHHHHHHHTCCCCSCCTTCCCHHHHHHHHHHHHH
T ss_pred             ceEEeechHhHHHHHHHhhccCcccchhHHHHHHHHHhhcccCCcCHHHHHHHHhCCcccCCCCCCChHHHHHHHHHHHH
Confidence            999999999999999887653      35666666554445567899999999999999765568999999999999997


Q ss_pred             HHHH
Q psy17350        516 LKLS  519 (528)
Q Consensus       516 ~~L~  519 (528)
                      ...+
T Consensus       159 ~~~~  162 (173)
T d1wlja_         159 ISQR  162 (173)
T ss_dssp             HHHH
T ss_pred             HHHH
Confidence            6543

PyMOL of d1wlja_

>d2guia1 c.55.3.5 (A:7-180) N-terminal exonuclease domain of the epsilon subunit of DNA polymerase III {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d3b6oa1 c.55.3.5 (A:9-234) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1y97a1 c.55.3.5 (A:1-228) Three prime repair exonuclease 2, TREX2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w0ha_ c.55.3.5 (A:) Exonuclease ERI1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2f96a1 c.55.3.5 (A:19-220) Ribonuclease T {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2qxfa1 c.55.3.5 (A:8-474) Exonuclease I {Escherichia coli K12 (Escherichia coli K-12) [TaxId: 83333]}	Back information, alignment and structure

>d2igia1 c.55.3.5 (A:1-180) Oligoribonuclease {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1wlja_ c.55.3.5 (A:) Interferon-stimulated gene 20 kDa protein, ISG20 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kfsa1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1yt3a3 c.55.3.5 (A:1-193) Ribonuclease D, catalytic domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2hbka2 c.55.3.5 (A:129-420) Exosome complex exonuclease RRP6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1vk0a_ c.55.3.5 (A:) Hypothetical protein AT5G06450 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2d5ra1 c.55.3.9 (A:11-262) CCR4-NOT transcription complex subunit 7, CAF1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2hhva1 c.55.3.5 (A:298-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]}	Back information, alignment and structure

>d1x9ma1 c.55.3.5 (A:1-210) Exonuclease domain of T7 DNA polymerase {Bacteriophage T7 [TaxId: 10760]}	Back information, alignment and structure

>d3b6oa1 c.55.3.5 (A:9-234) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1tgoa1 c.55.3.5 (A:1-347) Exonuclease domain of family B DNA polymerases {Archaeon Thermococcus gorgonarius [TaxId: 71997]}	Back information, alignment and structure

>d1y97a1 c.55.3.5 (A:1-228) Three prime repair exonuclease 2, TREX2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2guia1 c.55.3.5 (A:7-180) N-terminal exonuclease domain of the epsilon subunit of DNA polymerase III {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1uoca_ c.55.3.9 (A:) Pop2 RNase D domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1w0ha_ c.55.3.5 (A:) Exonuclease ERI1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1q8ia1 c.55.3.5 (A:2-389) Exonuclease domain of family B DNA polymerases {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1s5ja1 c.55.3.5 (A:40-449) Exonuclease domain of family B DNA polymerases {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1yt3a3 c.55.3.5 (A:1-193) Ribonuclease D, catalytic domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vk0a_ c.55.3.5 (A:) Hypothetical protein AT5G06450 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1noya_ c.55.3.5 (A:) Exonuclease domain of family B DNA polymerases {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d2qxfa1 c.55.3.5 (A:8-474) Exonuclease I {Escherichia coli K12 (Escherichia coli K-12) [TaxId: 83333]}	Back information, alignment and structure

>d1ih7a1 c.55.3.5 (A:1-375) Exonuclease domain of family B DNA polymerases {Bacteriophage RB69 [TaxId: 12353]}	Back information, alignment and structure

>d2f96a1 c.55.3.5 (A:19-220) Ribonuclease T {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2hbka2 c.55.3.5 (A:129-420) Exosome complex exonuclease RRP6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure