Psyllid ID: psy17388


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270--
MKEECNEGKESWLRDFKEGQSNICLLFPGLSGAGKTSISFQIESYLIAQGIPAYALDGDNLRNGINANLAFSEEDRNENVRRAAECAKMFAECGFIALCSFVSPTAAARDRAREIHRNANLEFFEVFVNTPVEICEQRDVKGHYKKAREGKIKSFTGVSQPYEAPKNPDLILETVNVPVEKCANSVLDMIAAKGLIPARQFFFIEALPRLDIGVIDLQWVQVIAEGWSSPLKGFMREDEFLKTIHFNTLDSNVNQSVAIVLAVTGEDKQRLE
cccccccccHHHHHHHHcccccEEEEccccccccHHHHHHHHHHHHHHccccEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHcccccEEEEEEEccHHHHHHccccHHHHHHHcccccccccccccccccccccEEEEcccccHHHHHHHHHHHHHHcccccccccccccccccEEccccccHHHHHHHHccccccccccccHHHHHHHHccccccccccEEEEEEEEccHHHcccc
ccccccccccHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEcHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHcccccEEEEEEEccHHHHHccccccHHHHHHcccccccEcccEcccccccccEEEEcccccHHHHHHHHHHHHHHccccccccHHHHHccccEEEcEEEHHHHHHHHccccccccccccHHHHHHHHHHHcccccEcccccEEEEcccccHHHcc
mkeecnegkeSWLRDFKEGQSNicllfpglsgagktsISFQIESYLIAQgipayaldgdnlrnginanlafseedRNENVRRAAECAKMFAECGFIALCSFVSPTAAARDRAREIHRNANLEFFEVFVntpveiceqrdvkgHYKKAREgkiksftgvsqpyeapknpdliletvnvpvEKCANSVLDMIAakgliparqFFFIealprldigviDLQWVQVIAEGwssplkgfmredefLKTIHFNTLDSNVNQSVAIVLAVTgedkqrle
MKEECNEGKESWLRDFKEGQSNICLLFPGLSGAGKTSISFQIESYLIAQGIPAYALDGDNLRNGINANlafseedrnENVRRAAECAKMFAECGFIALCSFVSPTAAARDRAREIHRNANLEFFEVFVNTPVEIceqrdvkghykkaregkiksftgvsqpyeapKNPDLILETVNVPVEKCANSVLDMIAAKGLIPARQFFFIEALPRLDIGVIDLQWVQVIAEGWSSPLKGFMREDEFLKTIHFNTLDSNVNQSVAIVLAvtgedkqrle
MKEECNEGKESWLRDFKEGQSNICLLFPGLSGAGKTSISFQIESYLIAQGIPAYALDGDNLRNGINANLAFSEEDRNENVRRAAECAKMFAECGFIALCSFVSPTAAARDRAREIHRNANLEFFEVFVNTPVEICEQRDVKGHYKKAREGKIKSFTGVSQPYEAPKNPDLILETVNVPVEKCANSVLDMIAAKGLIPARQFFFIEALPRLDIGVIDLQWVQVIAEGWSSPLKGFMREDEFLKTIHFNTLDSNVNQSVAIVLAVTGEDKQRLE
***********WLRDFKEGQSNICLLFPGLSGAGKTSISFQIESYLIAQGIPAYALDGDNLRNGINANLAFS******NVRRAAECAKMFAECGFIALCSFVSPTAAARDRAREIHRNANLEFFEVFVNTPVEICEQRDVKGHYKKAR**KIKSFTG*********NPDLILETVNVPVEKCANSVLDMIAAKGLIPARQFFFIEALPRLDIGVIDLQWVQVIAEGWSSPLKGFMREDEFLKTIHFNTLDSNVNQSVAIVLAVT********
******************GQSNICLLFPGLSGAGKTSISFQIESYLIAQGIPAYALDGDNLRNGINANLAFSEEDRNENVRRAAECAKMFAECGFIALCSFVSPTAAARDRAREIHRNANLEFFEVFVNTPVEICEQRDVKGHYKKAREGKIKSFTGVSQPYEAPKNPDLILETVNVPVEKCANSVLDMIAAKGLIPARQFFFIEALPRLDIGVIDLQWVQVIAEGWSSPLKGFMREDEFLKTIHFNTLDSNVNQSVAIVLAVTGE******
**********SWLRDFKEGQSNICLLFPGLSGAGKTSISFQIESYLIAQGIPAYALDGDNLRNGINANLAFSEEDRNENVRRAAECAKMFAECGFIALCSFVSPTAAARDRAREIHRNANLEFFEVFVNTPVEICEQRDVKGHYKKAREGKIKSFTGVSQPYEAPKNPDLILETVNVPVEKCANSVLDMIAAKGLIPARQFFFIEALPRLDIGVIDLQWVQVIAEGWSSPLKGFMREDEFLKTIHFNTLDSNVNQSVAIVLAVTGEDKQRLE
*****************EGQSNICLLFPGLSGAGKTSISFQIESYLIAQGIPAYALDGDNLRNGINANLAFSEEDRNENVRRAAECAKMFAECGFIALCSFVSPTAAARDRAREIHRNANLEFFEVFVNTPVEICEQRDVKGHYKKAREGKIKSFTGVSQPYEAPKNPDLILETVNVPVEKCANSVLDMIAAKGLIPARQFFFIEALPRLDIGVIDLQWVQVIAEGWSSPLKGFMREDEFLKTIHFNTLDSNVNQSVAIVLAVTGE******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKEECNEGKESWLRDFKEGQSNICLLFPGLSGAGKTSISFQIESYLIAQGIPAYALDGDNLRNGINANLAFSEEDRNENVRRAAECAKMFAECGFIALCSFVSPTAAARDRAREIHRNANLEFFEVFVNTPVEICEQRDVKGHYKKAREGKIKSFTGVSQPYEAPKNPDLILETVNVPVEKCANSVLDMIAAKGLIPARQFFFIEALPRLDIGVIDLQWVQVIAEGWSSPLKGFMREDEFLKTIHFNTLDSNVNQSVAIVLAVTGEDKQRLE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query272 2.2.26 [Sep-21-2011]
Q27128 610 Bifunctional 3'-phosphoad N/A N/A 0.941 0.419 0.487 1e-73
Q60967 624 Bifunctional 3'-phosphoad yes N/A 0.897 0.391 0.505 2e-73
O95340 614 Bifunctional 3'-phosphoad yes N/A 0.897 0.397 0.498 4e-73
O43252 624 Bifunctional 3'-phosphoad no N/A 0.897 0.391 0.501 6e-73
O88428 621 Bifunctional 3'-phosphoad no N/A 0.897 0.392 0.481 3e-72
O54820 624 Bifunctional 3'-phosphoad no N/A 0.897 0.391 0.494 3e-71
Q92203206 Adenylyl-sulfate kinase O yes N/A 0.658 0.868 0.470 9e-48
Q02196202 Adenylyl-sulfate kinase O yes N/A 0.650 0.876 0.497 9e-48
Q9HGF8202 Adenylyl-sulfate kinase O N/A N/A 0.650 0.876 0.485 1e-46
Q9C2Y6202 Adenylyl-sulfate kinase O N/A N/A 0.650 0.876 0.485 1e-46
>sp|Q27128|PAPSS_URECA Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase OS=Urechis caupo PE=2 SV=1 Back     alignment and function desciption
 Score =  276 bits (706), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 134/275 (48%), Positives = 184/275 (66%), Gaps = 19/275 (6%)

Query: 17  KEGQSNICLLFPGLSGAGKTSISFQIESYLIAQGIPAYALDGDNLRNGINANLAFSEEDR 76
           + G     + F GLSGAGKT+ISF +E YL++QGIP Y+LDGDN+R+G+N NL F++EDR
Sbjct: 32  RGGFRGCTVWFTGLSGAGKTTISFALEEYLVSQGIPTYSLDGDNVRHGLNKNLGFTQEDR 91

Query: 77  NENVRRAAECAKMFAECGFIALCSFVSPTAAARDRAREIHRNANLEFFEVFVNTPVEICE 136
            EN+RR +E AK+FA+ G + L SF+SP    RD AR +H  A L FFE FV+TP+++CE
Sbjct: 92  EENIRRISEVAKLFADGGIVCLTSFISPFKRDRDLARSLHEQAGLPFFECFVDTPLDVCE 151

Query: 137 QRDVKGHYKKAREGKIKSFTGVSQPYEAPKNPDLILETVNVPVEKCANSVLDMIAAKGLI 196
           QRDVKG YKKAR G+IK FTG+ Q YE+P  P++ L   N  +++C   V+ ++   G++
Sbjct: 152 QRDVKGLYKKARAGQIKGFTGIDQQYESPDAPEIQLYAGNKSIDECVQEVVSLLQKNGVV 211

Query: 197 P------ARQFFFIEA-----------LPRLDIGVIDLQWVQVIAEGWSSPLKGFMREDE 239
           P       ++ F  E+           LP ++I  +D QWVQV++EGW++PL GFMRE E
Sbjct: 212 PESAVNIVKELFVPESGLEHAKAEIVDLPTMEITKLDTQWVQVLSEGWATPLTGFMRERE 271

Query: 240 FLKTIHFN-TLDSNV-NQSVAIVLAVTGEDKQRLE 272
           +L++ HF   LD  V NQS+ IVL V   DK RLE
Sbjct: 272 YLQSQHFGCLLDGGVTNQSIPIVLPVHTADKDRLE 306




Bifunctional enzyme with both ATP sulfurylase and APS kinase activity, which mediates two steps in the sulfate activation pathway. The first step is the transfer of a sulfate group to ATP to yield adenosine 5'-phosphosulfate (APS), and the second step is the transfer of a phosphate group from ATP to APS yielding 3'-phosphoadenylylsulfate (PAPS: activated sulfate donor used by sulfotransferase).
Urechis caupo (taxid: 6431)
EC: 2EC: .EC: 7EC: .EC: 1EC: .EC: 2EC: 5
>sp|Q60967|PAPS1_MOUSE Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Mus musculus GN=Papss1 PE=2 SV=1 Back     alignment and function description
>sp|O95340|PAPS2_HUMAN Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 OS=Homo sapiens GN=PAPSS2 PE=1 SV=2 Back     alignment and function description
>sp|O43252|PAPS1_HUMAN Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Homo sapiens GN=PAPSS1 PE=1 SV=2 Back     alignment and function description
>sp|O88428|PAPS2_MOUSE Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 OS=Mus musculus GN=Papss2 PE=1 SV=2 Back     alignment and function description
>sp|O54820|PAPS1_CAVPO Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Cavia porcellus GN=PAPSS1 PE=2 SV=1 Back     alignment and function description
>sp|Q92203|KAPS_EMENI Adenylyl-sulfate kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sD PE=3 SV=2 Back     alignment and function description
>sp|Q02196|KAPS_YEAST Adenylyl-sulfate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET14 PE=1 SV=1 Back     alignment and function description
>sp|Q9HGF8|KAPS_SACBA Adenylyl-sulfate kinase OS=Saccharomyces bayanus GN=MET14 PE=3 SV=1 Back     alignment and function description
>sp|Q9C2Y6|KAPS_SACPS Adenylyl-sulfate kinase OS=Saccharomyces pastorianus GN=MET14 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query272
322787112 420 hypothetical protein SINV_15899 [Solenop 0.904 0.585 0.546 3e-80
91094931 627 PREDICTED: similar to AGAP001256-PA [Tri 0.996 0.432 0.494 4e-79
242024762 623 adenylsulfate kinase, putative [Pediculu 0.937 0.409 0.519 7e-79
307188360 574 Bifunctional 3'-phosphoadenosine 5'-phos 0.889 0.421 0.568 9e-79
328701022 668 PREDICTED: bifunctional 3'-phosphoadenos 0.911 0.371 0.518 9e-78
307192124 631 Bifunctional 3'-phosphoadenosine 5'-phos 0.930 0.400 0.52 3e-77
195427547 658 GK16974 [Drosophila willistoni] gi|19415 0.897 0.370 0.518 9e-77
195020256 629 GH14663 [Drosophila grimshawi] gi|193898 0.897 0.387 0.503 1e-76
195128587 629 GI11647 [Drosophila mojavensis] gi|19392 0.897 0.387 0.511 2e-76
332025515 631 Bifunctional 3'-phosphoadenosine 5'-phos 0.889 0.383 0.537 2e-76
>gi|322787112|gb|EFZ13333.1| hypothetical protein SINV_15899 [Solenopsis invicta] Back     alignment and taxonomy information
 Score =  304 bits (778), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 147/269 (54%), Positives = 191/269 (71%), Gaps = 23/269 (8%)

Query: 25  LLFPGLSGAGKTSISFQIESYLIAQGIPAYALDGDNLRNGINANLAFSEEDRNENVRRAA 84
           +   GLSGAGKTSISFQ+E YL++QGIP Y+LDGDN+R G+N NL FS+EDR ENVRR A
Sbjct: 30  IWMTGLSGAGKTSISFQLEEYLVSQGIPTYSLDGDNMRTGLNRNLGFSKEDRKENVRRVA 89

Query: 85  ECAKMFAECGFIALCSFVSPTAAARDRAREIHRNANLEFFEVFVNTPVEICEQRDVKGHY 144
           E A++FA+ G I LCSFVSP AA R  AREIH NANL FFEVF+N  +++CE RDVKG Y
Sbjct: 90  EVARLFADAGIITLCSFVSPFAADRKMAREIHENANLPFFEVFINASLQVCEARDVKGLY 149

Query: 145 KKAREGKIKSFTGVSQPYEAPKNPDLILETVNVPVEKCANSVLDMIAAKGLIPA----RQ 200
           KKAR+G IK FTG+ Q Y+ P  PDL+++T N  +E+  + V++ +  K ++P     +Q
Sbjct: 150 KKARQGIIKGFTGIDQSYDVPTEPDLVVDTENATIEQSTDIVINFLQLKQIVPKACLLKQ 209

Query: 201 FFFIE----------------ALPRLDIGVIDLQWVQVIAEGWSSPLKGFMREDEFLKTI 244
           F F+E                 LP L IG +D+QW+QV+AEGW++PLKGFMRE+E+L+  
Sbjct: 210 FPFLELFVEEDRLDDVRKEMKTLPTLKIGKVDVQWLQVLAEGWAAPLKGFMRENEYLQVQ 269

Query: 245 HFNTLDSN---VNQSVAIVLAVTGEDKQR 270
           HFN L  N   +NQS+ IVLAV+  DK+R
Sbjct: 270 HFNCLYENGVTINQSIPIVLAVSTVDKER 298




Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91094931|ref|XP_970563.1| PREDICTED: similar to AGAP001256-PA [Tribolium castaneum] gi|270016688|gb|EFA13134.1| hypothetical protein TcasGA2_TC010318 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242024762|ref|XP_002432795.1| adenylsulfate kinase, putative [Pediculus humanus corporis] gi|212518304|gb|EEB20057.1| adenylsulfate kinase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307188360|gb|EFN73135.1| Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328701022|ref|XP_003241462.1| PREDICTED: bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307192124|gb|EFN75452.1| Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|195427547|ref|XP_002061838.1| GK16974 [Drosophila willistoni] gi|194157923|gb|EDW72824.1| GK16974 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195020256|ref|XP_001985157.1| GH14663 [Drosophila grimshawi] gi|193898639|gb|EDV97505.1| GH14663 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195128587|ref|XP_002008744.1| GI11647 [Drosophila mojavensis] gi|193920353|gb|EDW19220.1| GI11647 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|332025515|gb|EGI65678.1| Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query272
FB|FBgn0020389 657 Papss "PAPS synthetase" [Droso 0.665 0.275 0.532 1.4e-72
UNIPROTKB|Q90XY2 613 Q90XY2 "3'-phosphoadenosine 5' 0.639 0.283 0.531 6e-70
MGI|MGI:1330587 624 Papss1 "3'-phosphoadenosine 5' 0.658 0.286 0.513 9.8e-70
UNIPROTKB|O43252 624 PAPSS1 "Bifunctional 3'-phosph 0.658 0.286 0.513 2.6e-69
UNIPROTKB|Q3T0J0 624 PAPSS1 "Uncharacterized protei 0.658 0.286 0.513 2.6e-69
UNIPROTKB|E2QZ13 625 PAPSS1 "Uncharacterized protei 0.658 0.286 0.513 3.3e-69
UNIPROTKB|F1N085 568 PAPSS2 "Uncharacterized protei 0.621 0.297 0.520 4.2e-69
ZFIN|ZDB-GENE-010323-5 614 papss2b "3'-phosphoadenosine 5 0.621 0.275 0.532 8.7e-69
UNIPROTKB|E7ER89 618 PAPSS2 "Sulfate adenylyltransf 0.621 0.273 0.520 8.7e-69
UNIPROTKB|O95340 614 PAPSS2 "Bifunctional 3'-phosph 0.621 0.275 0.520 8.7e-69
FB|FBgn0020389 Papss "PAPS synthetase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 540 (195.1 bits), Expect = 1.4e-72, Sum P(2) = 1.4e-72
 Identities = 97/182 (53%), Positives = 138/182 (75%)

Query:    29 GLSGAGKTSISFQIESYLIAQGIPAYALDGDNLRNGINANLAFSEEDRNENVRRAAECAK 88
             GLSGAGKTSI+F++E+YL+++GIPAY LDGDN+R G+N NL F+  DR EN+RR  E AK
Sbjct:    81 GLSGAGKTSIAFELEAYLVSRGIPAYGLDGDNIRTGLNKNLGFTPADREENIRRVGEVAK 140

Query:    89 MFAECGFIALCSFVSPTAAARDRAREIHRNANLEFFEVFVNTPVEICEQRDVKGHYKKAR 148
             +FA+ G +A+CSFVSP A  R+ AR+IH++A L+F+E+FV+TP+++CE RDVKG YKKAR
Sbjct:   141 LFADSGVVAICSFVSPFADDREMARKIHKDAGLKFYEIFVDTPLDVCETRDVKGLYKKAR 200

Query:   149 EGKIKSFTGVSQPYEAPKNPDLILETVNVPVEKCANSVLDMIAAKGLIPARQFFFIEALP 208
             EG IK FTG++Q YE P+ P+L++ T    V +    ++ ++  +G+IP R    ++ LP
Sbjct:   201 EGVIKGFTGITQEYERPQMPELVVNTHGYTVRESTQKLVTLLEQEGIIP-RSLRDVDLLP 259

Query:   209 RL 210
              L
Sbjct:   260 EL 261


GO:0004781 "sulfate adenylyltransferase (ATP) activity" evidence=ISS;NAS
GO:0004020 "adenylylsulfate kinase activity" evidence=ISS;NAS
GO:0005524 "ATP binding" evidence=IEA
GO:0000103 "sulfate assimilation" evidence=IEA
GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP
UNIPROTKB|Q90XY2 Q90XY2 "3'-phosphoadenosine 5'-phosphosulfate synthase 2" [Takifugu rubripes (taxid:31033)] Back     alignment and assigned GO terms
MGI|MGI:1330587 Papss1 "3'-phosphoadenosine 5'-phosphosulfate synthase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|O43252 PAPSS1 "Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0J0 PAPSS1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QZ13 PAPSS1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1N085 PAPSS2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-010323-5 papss2b "3'-phosphoadenosine 5'-phosphosulfate synthase 2b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E7ER89 PAPSS2 "Sulfate adenylyltransferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O95340 PAPSS2 "Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A8H0A6CYSC_SHEPA2, ., 7, ., 1, ., 2, 50.42160.67270.8926yesN/A
Q64VR1CYSC_BACFR2, ., 7, ., 1, ., 2, 50.45400.63230.8514yesN/A
Q92203KAPS_EMENI2, ., 7, ., 1, ., 2, 50.47020.65800.8689yesN/A
A3D819CYSC_SHEB52, ., 7, ., 1, ., 2, 50.42850.66170.8780yesN/A
Q4L9E6CYSC_STAHJ2, ., 7, ., 1, ., 2, 50.44260.66540.9095yesN/A
Q7MPF0CYSC_VIBVY2, ., 7, ., 1, ., 2, 50.44320.66910.8792yesN/A
Q07Y94CYSC_SHEFN2, ., 7, ., 1, ., 2, 50.40740.68380.8985yesN/A
B9DLK2CYSC_STACT2, ., 7, ., 1, ., 2, 50.43710.66540.9095yesN/A
Q9P7G9KAPS_SCHPO2, ., 7, ., 1, ., 2, 50.46060.65440.8811yesN/A
Q12657KAPS_PENCH2, ., 7, ., 1, ., 2, 50.46800.66540.8578yesN/A
B8D0S4CYSC_HALOH2, ., 7, ., 1, ., 2, 50.47450.63600.9351yesN/A
A6WJU6CYSC_SHEB82, ., 7, ., 1, ., 2, 50.42700.67270.8926yesN/A
Q5LES5CYSC_BACFN2, ., 7, ., 1, ., 2, 50.45400.63230.8514yesN/A
Q88X60CYSC_LACPL2, ., 7, ., 1, ., 2, 50.48570.61390.8067yesN/A
Q97MT8CYSC_CLOAB2, ., 7, ., 1, ., 2, 50.42930.63970.87yesN/A
Q60967PAPS1_MOUSE2, ., 7, ., 1, ., 2, 50.50570.89700.3910yesN/A
A5G863CYSC_GEOUR2, ., 7, ., 1, ., 2, 50.40800.63230.8269yesN/A
Q0HFM7CYSC_SHESM2, ., 7, ., 1, ., 2, 50.43710.66170.8780yesN/A
Q8CR04CYSC_STAES2, ., 7, ., 1, ., 2, 50.42520.63230.8643yesN/A
Q49UM5CYSC_STAS12, ., 7, ., 1, ., 2, 50.40320.67640.9019yesN/A
A6KXG9CYSC_BACV82, ., 7, ., 1, ., 2, 50.45930.6250.8333yesN/A
Q9K7H6CYSC2_BACHD2, ., 7, ., 1, ., 2, 50.46660.65440.8557yesN/A
B0TTD2CYSC_SHEHH2, ., 7, ., 1, ., 2, 50.42700.67270.8926yesN/A
Q8AAQ1CYSC_BACTN2, ., 7, ., 1, ., 2, 50.46850.63600.8606yesN/A
Q9KP21CYSC_VIBCH2, ., 7, ., 1, ., 2, 50.45190.64330.8139yesN/A
Q7VE24CYSC_PROMA2, ., 7, ., 1, ., 2, 50.41010.64700.8756yesN/A
A0KTI5CYSC_SHESA2, ., 7, ., 1, ., 2, 50.44130.65070.8634yesN/A
A4WDV5CYSC_ENT382, ., 7, ., 1, ., 2, 50.42620.66170.8955yesN/A
Q12QM6CYSC_SHEDO2, ., 7, ., 1, ., 2, 50.42020.68380.9073yesN/A
Q02196KAPS_YEAST2, ., 7, ., 1, ., 2, 50.49710.65070.8762yesN/A
A1U3X8CYSC_MARAV2, ., 7, ., 1, ., 2, 50.43180.63600.8693yesN/A
O06735CYSC2_BACSU2, ., 7, ., 1, ., 2, 50.43250.64700.8844yesN/A
B9M543CYSC_GEOSF2, ., 7, ., 1, ., 2, 50.450.65440.8768yesN/A
Q8DE75CYSC_VIBVU2, ., 7, ., 1, ., 2, 50.44320.66910.8792yesN/A
Q8ZBP3CYSC_YERPE2, ., 7, ., 1, ., 2, 50.41080.66910.8544yesN/A
A5N960CYSC_CLOK52, ., 7, ., 1, ., 2, 50.45850.65440.8944yesN/A
A1S9N4CYSC_SHEAM2, ., 7, ., 1, ., 2, 50.43780.67270.9242yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.1.250.824
3rd Layer2.7.10.766

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query272
cd02027149 cd02027, APSK, Adenosine 5'-phosphosulfate kinase 3e-80
pfam01583157 pfam01583, APS_kinase, Adenylylsulphate kinase 9e-80
COG0529197 COG0529, CysC, Adenylylsulfate kinase and related 1e-77
PRK05506632 PRK05506, PRK05506, bifunctional sulfate adenylylt 4e-74
PRK03846198 PRK03846, PRK03846, adenylylsulfate kinase; Provis 9e-68
TIGR00455184 TIGR00455, apsK, adenylylsulfate kinase (apsK) 4e-66
PRK00889175 PRK00889, PRK00889, adenylylsulfate kinase; Provis 3e-54
PRK05537568 PRK05537, PRK05537, bifunctional sulfate adenylylt 4e-51
cd00517 353 cd00517, ATPS, ATP-sulfurylase 5e-19
pfam14306159 pfam14306, PUA_2, PUA-like domain 1e-18
PRK05541176 PRK05541, PRK05541, adenylylsulfate kinase; Provis 2e-17
TIGR00339 383 TIGR00339, sopT, ATP sulphurylase 3e-12
pfam13671143 pfam13671, AAA_33, AAA domain 1e-05
cd02021150 cd02021, GntK, Gluconate kinase (GntK) catalyzes t 5e-05
PRK04149 391 PRK04149, sat, sulfate adenylyltransferase; Review 6e-05
>gnl|CDD|238985 cd02027, APSK, Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
 Score =  238 bits (609), Expect = 3e-80
 Identities = 81/151 (53%), Positives = 109/151 (72%), Gaps = 2/151 (1%)

Query: 24  CLLFPGLSGAGKTSISFQIESYLIAQGIPAYALDGDNLRNGINANLAFSEEDRNENVRRA 83
            +   GLSG+GK++I+  +E  L  +G P Y LDGDN+R+G+N +L FS EDR EN+RR 
Sbjct: 1   VIWLTGLSGSGKSTIARALEEKLFQRGRPVYVLDGDNVRHGLNKDLGFSREDREENIRRI 60

Query: 84  AECAKMFAECGFIALCSFVSPTAAARDRAREIHRNANLEFFEVFVNTPVEICEQRDVKGH 143
           AE AK+ A+ G I + +F+SP    R+ AR+I      +F EVFV+TP+E+CEQRD KG 
Sbjct: 61  AEVAKLLADAGLIVIAAFISPYREDREAARKII--GGGDFLEVFVDTPLEVCEQRDPKGL 118

Query: 144 YKKAREGKIKSFTGVSQPYEAPKNPDLILET 174
           YKKAR G+IK FTG+  PYEAP+NPDL+L+T
Sbjct: 119 YKKARAGEIKGFTGIDDPYEAPENPDLVLDT 149


The end-product PAPS is a biologically "activated" sulfate form important for the assimilation of inorganic sulfate. Length = 149

>gnl|CDD|216586 pfam01583, APS_kinase, Adenylylsulphate kinase Back     alignment and domain information
>gnl|CDD|223603 COG0529, CysC, Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|180120 PRK05506, PRK05506, bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>gnl|CDD|179661 PRK03846, PRK03846, adenylylsulfate kinase; Provisional Back     alignment and domain information
>gnl|CDD|129547 TIGR00455, apsK, adenylylsulfate kinase (apsK) Back     alignment and domain information
>gnl|CDD|179157 PRK00889, PRK00889, adenylylsulfate kinase; Provisional Back     alignment and domain information
>gnl|CDD|180124 PRK05537, PRK05537, bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>gnl|CDD|173895 cd00517, ATPS, ATP-sulfurylase Back     alignment and domain information
>gnl|CDD|206474 pfam14306, PUA_2, PUA-like domain Back     alignment and domain information
>gnl|CDD|235498 PRK05541, PRK05541, adenylylsulfate kinase; Provisional Back     alignment and domain information
>gnl|CDD|232928 TIGR00339, sopT, ATP sulphurylase Back     alignment and domain information
>gnl|CDD|222307 pfam13671, AAA_33, AAA domain Back     alignment and domain information
>gnl|CDD|238979 cd02021, GntK, Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>gnl|CDD|235227 PRK04149, sat, sulfate adenylyltransferase; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 272
KOG4238|consensus 627 100.0
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 100.0
KOG0635|consensus207 100.0
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 100.0
PRK03846198 adenylylsulfate kinase; Provisional 99.94
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 99.94
PF14306160 PUA_2: PUA-like domain; PDB: 1M8P_C 1I2D_B 2OFW_G 99.94
PRK00889175 adenylylsulfate kinase; Provisional 99.93
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 99.92
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 99.91
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 99.89
PRK04149 391 sat sulfate adenylyltransferase; Reviewed 99.88
cd00517 353 ATPS ATP-sulfurylase. ATP-sulfurylase (ATPS), also 99.87
TIGR00339 383 sopT ATP sulphurylase. Members of this family also 99.87
COG2046 397 MET3 ATP sulfurylase (sulfate adenylyltransferase) 99.87
PRK05541176 adenylylsulfate kinase; Provisional 99.86
PRK05537 568 bifunctional sulfate adenylyltransferase subunit 1 99.84
PRK06762166 hypothetical protein; Provisional 99.83
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 99.82
PF07931174 CPT: Chloramphenicol phosphotransferase-like prote 99.79
COG3265161 GntK Gluconate kinase [Carbohydrate transport and 99.78
KOG3354|consensus191 99.78
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 99.77
COG0703172 AroK Shikimate kinase [Amino acid transport and me 99.74
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 99.72
COG4088261 Predicted nucleotide kinase [Nucleotide transport 99.7
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 99.7
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 99.7
PRK13948182 shikimate kinase; Provisional 99.7
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 99.69
PRK00131175 aroK shikimate kinase; Reviewed 99.67
PRK11545163 gntK gluconate kinase 1; Provisional 99.67
PRK13946184 shikimate kinase; Provisional 99.65
COG0645170 Predicted kinase [General function prediction only 99.63
PRK05057172 aroK shikimate kinase I; Reviewed 99.63
PRK13947171 shikimate kinase; Provisional 99.62
PRK13949169 shikimate kinase; Provisional 99.61
PRK09825176 idnK D-gluconate kinase; Provisional 99.6
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 99.58
PHA02530300 pseT polynucleotide kinase; Provisional 99.56
PLN02199303 shikimate kinase 99.55
TIGR01663526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 99.54
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 99.54
PRK08233182 hypothetical protein; Provisional 99.54
PRK00625173 shikimate kinase; Provisional 99.53
PRK04182180 cytidylate kinase; Provisional 99.53
PRK08154309 anaerobic benzoate catabolism transcriptional regu 99.53
PRK03731171 aroL shikimate kinase II; Reviewed 99.51
PRK03839180 putative kinase; Provisional 99.51
PRK14021 542 bifunctional shikimate kinase/3-dehydroquinate syn 99.49
PRK13973213 thymidylate kinase; Provisional 99.49
PLN02924220 thymidylate kinase 99.48
PRK00698205 tmk thymidylate kinase; Validated 99.46
PRK14532188 adenylate kinase; Provisional 99.45
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 99.45
PRK14527191 adenylate kinase; Provisional 99.44
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 99.44
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 99.44
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and m 99.43
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 99.43
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 99.43
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Pr 99.41
COG1936180 Predicted nucleotide kinase (related to CMP and AM 99.4
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 99.4
PRK13975196 thymidylate kinase; Provisional 99.39
COG0283222 Cmk Cytidylate kinase [Nucleotide transport and me 99.39
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 99.39
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 99.38
PRK06217183 hypothetical protein; Validated 99.38
PRK05416288 glmZ(sRNA)-inactivating NTPase; Provisional 99.36
COG3896205 Chloramphenicol 3-O-phosphotransferase [Defense me 99.34
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 99.33
PRK14531183 adenylate kinase; Provisional 99.33
PRK01184184 hypothetical protein; Provisional 99.32
KOG3062|consensus281 99.32
PRK13976209 thymidylate kinase; Provisional 99.31
PRK07933213 thymidylate kinase; Validated 99.29
PLN02200234 adenylate kinase family protein 99.28
PRK14530215 adenylate kinase; Provisional 99.28
COG4639168 Predicted kinase [General function prediction only 99.27
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 99.27
PRK13951 488 bifunctional shikimate kinase/3-dehydroquinate syn 99.25
PRK08356195 hypothetical protein; Provisional 99.23
PRK00023225 cmk cytidylate kinase; Provisional 99.21
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 99.21
PRK13974212 thymidylate kinase; Provisional 99.21
PRK12339197 2-phosphoglycerate kinase; Provisional 99.2
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 99.19
PRK00279215 adk adenylate kinase; Reviewed 99.18
PRK05480209 uridine/cytidine kinase; Provisional 99.18
PRK04040188 adenylate kinase; Provisional 99.17
PRK11860661 bifunctional 3-phosphoshikimate 1-carboxyvinyltran 99.17
PRK12338319 hypothetical protein; Provisional 99.17
PF02223186 Thymidylate_kin: Thymidylate kinase; InterPro: IPR 99.15
PRK02496184 adk adenylate kinase; Provisional 99.14
PRK14730195 coaE dephospho-CoA kinase; Provisional 99.13
PRK06547172 hypothetical protein; Provisional 99.13
PRK00081194 coaE dephospho-CoA kinase; Reviewed 99.11
PRK06696223 uridine kinase; Validated 99.11
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO 99.11
PRK13808333 adenylate kinase; Provisional 99.1
PF03668284 ATP_bind_2: P-loop ATPase protein family; InterPro 99.1
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 99.1
KOG3347|consensus176 99.1
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 99.09
PRK14737186 gmk guanylate kinase; Provisional 99.08
PRK14528186 adenylate kinase; Provisional 99.08
TIGR00152188 dephospho-CoA kinase. This model produces scores i 99.06
PRK14733204 coaE dephospho-CoA kinase; Provisional 99.06
PRK08118167 topology modulation protein; Reviewed 99.06
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 99.06
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 99.05
PRK06761282 hypothetical protein; Provisional 99.05
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 99.04
PRK07667193 uridine kinase; Provisional 99.03
PRK12269 863 bifunctional cytidylate kinase/ribosomal protein S 99.03
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 99.02
PRK00300205 gmk guanylate kinase; Provisional 99.02
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.01
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 99.01
PRK14738206 gmk guanylate kinase; Provisional 98.99
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 98.98
PRK14734200 coaE dephospho-CoA kinase; Provisional 98.98
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 98.97
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 98.97
PRK07261171 topology modulation protein; Provisional 98.96
COG3709192 Uncharacterized component of phosphonate metabolis 98.96
PRK14731208 coaE dephospho-CoA kinase; Provisional 98.94
PTZ00451244 dephospho-CoA kinase; Provisional 98.94
PLN02422232 dephospho-CoA kinase 98.93
PTZ00301210 uridine kinase; Provisional 98.93
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 98.91
PLN02674244 adenylate kinase 98.91
PF01591222 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR0130 98.91
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 98.89
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 98.89
PTZ00088229 adenylate kinase 1; Provisional 98.87
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 98.87
TIGR00235207 udk uridine kinase. Model contains a number of lon 98.87
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 98.87
COG1660286 Predicted P-loop-containing kinase [General functi 98.84
PRK14526211 adenylate kinase; Provisional 98.84
PRK14732196 coaE dephospho-CoA kinase; Provisional 98.82
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 98.82
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 98.79
PRK03333 395 coaE dephospho-CoA kinase/protein folding accessor 98.79
KOG3079|consensus195 98.78
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 98.78
PRK14529223 adenylate kinase; Provisional 98.77
PRK12337475 2-phosphoglycerate kinase; Provisional 98.76
KOG3220|consensus225 98.73
PF01121180 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th 98.73
PRK15453290 phosphoribulokinase; Provisional 98.71
PLN02348395 phosphoribulokinase 98.71
PLN02459261 probable adenylate kinase 98.69
KOG0636|consensus 466 98.68
PLN02842 505 nucleotide kinase 98.68
PRK09270229 nucleoside triphosphate hydrolase domain-containin 98.67
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 98.66
PLN02165334 adenylate isopentenyltransferase 98.64
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 98.62
PRK05439311 pantothenate kinase; Provisional 98.61
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 98.61
PRK14490 369 putative bifunctional molybdopterin-guanine dinucl 98.58
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 98.58
PLN02772398 guanylate kinase 98.53
PRK07429327 phosphoribulokinase; Provisional 98.53
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 98.53
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport 98.52
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 98.52
PHA03132580 thymidine kinase; Provisional 98.48
PRK04220301 2-phosphoglycerate kinase; Provisional 98.48
PRK00091307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 98.38
PHA00729226 NTP-binding motif containing protein 98.33
PLN02318 656 phosphoribulokinase/uridine kinase 98.31
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involve 98.29
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 98.24
TIGR03707230 PPK2_P_aer polyphosphate kinase 2, PA0141 family. 98.22
PF08303168 tRNA_lig_kinase: tRNA ligase kinase domain; InterP 98.21
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 98.2
KOG4622|consensus291 98.15
KOG3327|consensus208 98.13
PF13189179 Cytidylate_kin2: Cytidylate kinase-like family; PD 98.12
PLN02748 468 tRNA dimethylallyltransferase 98.09
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 98.08
TIGR00174287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 98.07
PRK10867433 signal recognition particle protein; Provisional 98.06
PF00004132 AAA: ATPase family associated with various cellula 98.04
TIGR03709264 PPK2_rel_1 polyphosphate:nucleotide phosphotransfe 98.02
PRK00771437 signal recognition particle protein Srp54; Provisi 98.02
cd01394218 radB RadB. The archaeal protein radB shares simila 98.0
TIGR03708 493 poly_P_AMP_trns polyphosphate:AMP phosphotransfera 98.0
PRK08084235 DNA replication initiation factor; Provisional 97.99
PRK09361225 radB DNA repair and recombination protein RadB; Pr 97.98
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 97.98
PLN02840 421 tRNA dimethylallyltransferase 97.96
KOG1384|consensus348 97.95
PF03976228 PPK2: Polyphosphate kinase 2 (PPK2); InterPro: IPR 97.95
cd03115173 SRP The signal recognition particle (SRP) mediates 97.95
TIGR00064272 ftsY signal recognition particle-docking protein F 97.95
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 97.93
KOG3877|consensus393 97.93
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.92
COG4185187 Uncharacterized protein conserved in bacteria [Fun 97.92
smart00382148 AAA ATPases associated with a variety of cellular 97.92
TIGR00959428 ffh signal recognition particle protein. This mode 97.92
PRK14974336 cell division protein FtsY; Provisional 97.91
COG1618179 Predicted nucleotide kinase [Nucleotide transport 97.9
PRK10416318 signal recognition particle-docking protein FtsY; 97.88
PRK04296190 thymidine kinase; Provisional 97.88
PRK13768253 GTPase; Provisional 97.87
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.86
PRK09435332 membrane ATPase/protein kinase; Provisional 97.82
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 97.81
CHL00181287 cbbX CbbX; Provisional 97.81
KOG3308|consensus225 97.8
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 97.79
PRK091692316 hypothetical protein; Validated 97.77
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 97.74
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 97.72
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.72
KOG2134|consensus422 97.72
PRK08727233 hypothetical protein; Validated 97.72
cd02034116 CooC The accessory protein CooC, which contains a 97.71
PLN02796347 D-glycerate 3-kinase 97.69
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.68
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.68
COG2256 436 MGS1 ATPase related to the helicase subunit of the 97.68
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 97.67
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 97.66
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 97.66
PLN03046460 D-glycerate 3-kinase; Provisional 97.66
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.64
PF13173128 AAA_14: AAA domain 97.64
COG0552340 FtsY Signal recognition particle GTPase [Intracell 97.61
KOG0744|consensus423 97.61
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 97.6
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 97.59
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 97.59
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 97.59
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 97.59
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 97.58
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.58
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 97.57
PRK08116268 hypothetical protein; Validated 97.56
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 97.56
TIGR01223182 Pmev_kin_anim phosphomevalonate kinase, animal typ 97.56
PRK05642234 DNA replication initiation factor; Validated 97.55
COG4240300 Predicted kinase [General function prediction only 97.54
KOG1532|consensus366 97.54
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.54
PRK14729300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 97.54
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 97.53
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 97.53
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.52
COG1341398 Predicted GTPase or GTP-binding protein [General f 97.52
PRK12377248 putative replication protein; Provisional 97.51
PRK12402337 replication factor C small subunit 2; Reviewed 97.51
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 97.5
KOG0733|consensus 802 97.49
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transf 97.49
COG4619223 ABC-type uncharacterized transport system, ATPase 97.49
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 97.47
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 97.47
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 97.47
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 97.47
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.46
cd03116159 MobB Molybdenum is an essential trace element in t 97.46
PF1324576 AAA_19: Part of AAA domain 97.46
cd03114148 ArgK-like The function of this protein family is u 97.46
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 97.45
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.44
PRK08903227 DnaA regulatory inactivator Hda; Validated 97.44
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 97.44
PRK05973237 replicative DNA helicase; Provisional 97.44
PRK04195 482 replication factor C large subunit; Provisional 97.43
PRK04328249 hypothetical protein; Provisional 97.43
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 97.41
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthes 97.41
PLN03025319 replication factor C subunit; Provisional 97.41
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 97.41
PRK09183259 transposase/IS protein; Provisional 97.4
KOG0780|consensus 483 97.39
PRK06893229 DNA replication initiation factor; Validated 97.39
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 97.38
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 97.37
PRK14489366 putative bifunctional molybdopterin-guanine dinucl 97.37
PRK00440319 rfc replication factor C small subunit; Reviewed 97.37
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 97.36
cd02033329 BchX Chlorophyllide reductase converts chlorophyll 97.35
TIGR03708493 poly_P_AMP_trns polyphosphate:AMP phosphotransfera 97.35
PRK14493274 putative bifunctional molybdopterin-guanine dinucl 97.35
PRK09087226 hypothetical protein; Validated 97.35
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 97.35
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 97.35
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.33
TIGR02236310 recomb_radA DNA repair and recombination protein R 97.33
PRK08181269 transposase; Validated 97.33
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 97.32
COG1126240 GlnQ ABC-type polar amino acid transport system, A 97.32
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 97.31
PHA02544316 44 clamp loader, small subunit; Provisional 97.31
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 97.31
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 97.3
PRK06526254 transposase; Provisional 97.3
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 97.29
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 97.29
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 97.29
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.29
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 97.29
CHL00195489 ycf46 Ycf46; Provisional 97.29
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 97.29
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 97.28
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 97.28
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 97.28
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 97.28
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.28
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 97.28
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.28
PRK06835329 DNA replication protein DnaC; Validated 97.27
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 97.27
PTZ00202550 tuzin; Provisional 97.26
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.24
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.24
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 97.24
PF05729166 NACHT: NACHT domain 97.23
KOG1533|consensus290 97.23
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 97.23
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 97.23
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.23
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 97.21
PRK06921266 hypothetical protein; Provisional 97.21
PRK03992389 proteasome-activating nucleotidase; Provisional 97.2
PRK14494229 putative molybdopterin-guanine dinucleotide biosyn 97.2
TIGR00665434 DnaB replicative DNA helicase. This model describe 97.19
PRK15455 644 PrkA family serine protein kinase; Provisional 97.19
TIGR02012321 tigrfam_recA protein RecA. This model describes or 97.18
KOG2004|consensus 906 97.17
KOG0738|consensus491 97.17
PRK06067234 flagellar accessory protein FlaH; Validated 97.17
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 97.17
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 97.17
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 97.16
PRK13342 413 recombination factor protein RarA; Reviewed 97.16
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 97.16
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 97.15
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 97.15
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 97.15
PRK13886241 conjugal transfer protein TraL; Provisional 97.14
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 97.14
PHA02575227 1 deoxynucleoside monophosphate kinase; Provisiona 97.14
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 97.13
PRK06620214 hypothetical protein; Validated 97.12
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). 97.12
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 97.11
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 97.11
cd02035217 ArsA ArsA ATPase functionas as an efflux pump loca 97.11
KOG4235|consensus244 97.11
KOG3078|consensus235 97.1
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 97.09
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 97.09
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 97.08
cd01918149 HprK_C HprK/P, the bifunctional histidine-containi 97.08
TIGR00362405 DnaA chromosomal replication initiator protein Dna 97.08
TIGR01526325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 97.08
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 97.08
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 97.08
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 97.08
PRK00149450 dnaA chromosomal replication initiation protein; R 97.08
PRK14087450 dnaA chromosomal replication initiation protein; P 97.07
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 97.07
PRK13695174 putative NTPase; Provisional 97.06
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 97.05
COG2884223 FtsE Predicted ATPase involved in cell division [C 97.05
PRK12422445 chromosomal replication initiation protein; Provis 97.05
COG1855604 ATPase (PilT family) [General function prediction 97.05
PF01656195 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai 97.05
cd00983325 recA RecA is a bacterial enzyme which has roles in 97.05
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 97.04
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 97.04
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 97.04
PF1355562 AAA_29: P-loop containing region of AAA domain 97.04
PRK07952244 DNA replication protein DnaC; Validated 97.03
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 97.03
PRK10646153 ADP-binding protein; Provisional 97.03
PRK08099399 bifunctional DNA-binding transcriptional repressor 97.03
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.02
cd01393226 recA_like RecA is a bacterial enzyme which has rol 97.02
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 97.01
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 97.01
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 97.0
cd02117212 NifH_like This family contains the NifH (iron prot 97.0
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 96.99
PF07726131 AAA_3: ATPase family associated with various cellu 96.98
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 96.98
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 96.98
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 96.98
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 96.97
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 96.97
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 96.96
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.96
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 96.96
cd02032267 Bchl_like This family of proteins contains bchL an 96.95
cd01128249 rho_factor Transcription termination factor rho is 96.95
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 96.95
PRK08939306 primosomal protein DnaI; Reviewed 96.94
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 96.94
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 96.94
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 96.94
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 96.94
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 96.94
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 96.93
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 96.92
PHA02244383 ATPase-like protein 96.91
COG1136226 SalX ABC-type antimicrobial peptide transport syst 96.91
COG3911183 Predicted ATPase [General function prediction only 96.9
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 96.9
TIGR00101199 ureG urease accessory protein UreG. This model rep 96.9
cd02036179 MinD Bacterial cell division requires the formatio 96.89
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 96.89
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 96.89
PRK00411394 cdc6 cell division control protein 6; Reviewed 96.88
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 96.87
PRK11823 446 DNA repair protein RadA; Provisional 96.87
PRK06851367 hypothetical protein; Provisional 96.86
PRK09354349 recA recombinase A; Provisional 96.85
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 96.85
KOG0730|consensus693 96.85
PF00005137 ABC_tran: ABC transporter This structure is on hol 96.84
PRK14086617 dnaA chromosomal replication initiation protein; P 96.83
PF02224157 Cytidylate_kin: Cytidylate kinase; InterPro: IPR01 96.83
PRK05595444 replicative DNA helicase; Provisional 96.83
TIGR01287275 nifH nitrogenase iron protein. This model describe 96.82
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 96.82
PRK05748448 replicative DNA helicase; Provisional 96.81
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 96.8
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 96.8
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 96.8
cd02040270 NifH NifH gene encodes component II (iron protein) 96.8
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 96.78
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 96.78
PF01712146 dNK: Deoxynucleoside kinase; InterPro: IPR002624 T 96.78
CHL00176 638 ftsH cell division protein; Validated 96.77
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 96.77
PRK06851367 hypothetical protein; Provisional 96.76
cd03269210 ABC_putative_ATPase This subfamily is involved in 96.75
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 96.75
COG0802149 Predicted ATPase or kinase [General function predi 96.75
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 96.73
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 96.73
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 96.73
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 96.73
PRK13764602 ATPase; Provisional 96.73
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 96.72
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 96.72
PRK14088440 dnaA chromosomal replication initiation protein; P 96.71
PRK05636505 replicative DNA helicase; Provisional 96.71
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 96.7
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 96.7
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 96.7
PRK12608380 transcription termination factor Rho; Provisional 96.7
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 96.7
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 96.69
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 96.69
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 96.69
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 96.68
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 96.68
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 96.67
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 96.67
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 96.67
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 96.67
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 96.66
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 96.66
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 96.66
PRK08760476 replicative DNA helicase; Provisional 96.65
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 96.65
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 96.65
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 96.64
PRK13185270 chlL protochlorophyllide reductase iron-sulfur ATP 96.64
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 96.64
PRK13341 725 recombination factor protein RarA/unknown domain f 96.64
PF02374305 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ 96.64
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 96.63
PRK09165497 replicative DNA helicase; Provisional 96.63
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 96.63
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 96.63
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 96.63
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 96.62
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 96.62
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 96.62
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 96.62
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 96.62
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 96.62
COG1123539 ATPase components of various ABC-type transport sy 96.61
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 96.61
TIGR02016296 BchX chlorophyllide reductase iron protein subunit 96.61
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 96.6
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 96.6
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 96.6
PRK08506472 replicative DNA helicase; Provisional 96.6
>KOG4238|consensus Back     alignment and domain information
Probab=100.00  E-value=5e-52  Score=362.68  Aligned_cols=255  Identities=53%  Similarity=0.969  Sum_probs=245.7

Q ss_pred             cCCCCeEEEEEcCCCCCHHHHHHHHHHHHHHcCCCEEEecCccccccccccCCCCHHHHHHHHHHHHHHHHHHHhCCCeE
Q psy17388         18 EGQSNICLLFPGLSGAGKTSISFQIESYLIAQGIPAYALDGDNLRNGINANLAFSEEDRNENVRRAAECAKMFAECGFIA   97 (272)
Q Consensus        18 ~~~~~~lI~l~G~~GsGKSTlAr~La~~L~~~g~~~~~ld~D~i~~~l~~~~~~~~~~~~~~~~~i~~~~~~~~~~g~~V   97 (272)
                      .+.++..||++|++|+||||++-+|.+.|...|++++.+|+|++|.++.++++|++++|++.+++++++++.+.++|.++
T Consensus        46 ~gfrgctvw~tglsgagkttis~ale~~l~~~gipcy~ldgdnirhgl~knlgfs~edreenirriaevaklfadaglvc  125 (627)
T KOG4238|consen   46 GGFRGCTVWLTGLSGAGKTTISFALEEYLVSHGIPCYSLDGDNIRHGLNKNLGFSPEDREENIRRIAEVAKLFADAGLVC  125 (627)
T ss_pred             CCccceeEEeeccCCCCcceeehHHHHHHHhcCCcccccCcchhhhhhhhccCCCchhHHHHHHHHHHHHHHHhcCCcee
Confidence            44689999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEcCCCCcHHHHHHHHHHHHhCCCceEEEEEeCCHHHHHHhhhhhhhhhhhhccccccccccccCCCCCCCcEEEeCCCC
Q psy17388         98 LCSFVSPTAAARDRAREIHRNANLEFFEVFVNTPVEICEQRDVKGHYKKAREGKIKSFTGVSQPYEAPKNPDLILETVNV  177 (272)
Q Consensus        98 I~d~~~~~~~~r~~~~~~~~~~g~~~~~V~L~~~~e~~~~Rl~~r~~~~~r~~~~~~~~~~~~~ye~~~~~~~~Idt~~~  177 (272)
                      |.++++|+..+|...+++...++++|+.||++++.++|.+|..+.+|+++|.+++.+|+++++.||+|+.|+++++++..
T Consensus       126 itsfispf~~dr~~arkihe~~~l~f~ev~v~a~l~vceqrd~k~lykkaragei~gftgids~ye~pe~~e~vl~t~~~  205 (627)
T KOG4238|consen  126 ITSFISPFAKDRENARKIHESAGLPFFEVFVDAPLNVCEQRDVKGLYKKARAGEIKGFTGIDSDYEKPETPERVLKTNLS  205 (627)
T ss_pred             eehhcChhhhhhhhhhhhhcccCCceEEEEecCchhhhhhcChHHHHhhhhccccccccccccccCCCCChhHHhhcCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHHhCCCCCCch------hhh-----------hccCCceecCchhHHHHHHHhhccccCccCCCCHHHH
Q psy17388        178 PVEKCANSVLDMIAAKGLIPARQ------FFF-----------IEALPRLDIGVIDLQWVQVIAEGWSSPLKGFMREDEF  240 (272)
Q Consensus       178 ~~ee~~~~I~~~L~~~~~~~~~~------l~~-----------~~~~~~~~~~~~~~~~~~~~~~g~~~pl~gfm~~~~~  240 (272)
                      ++.+|++++++.|++++++|.+.      |||           +.+||.+.|++.+++|+++||+||.+||+|||++.+|
T Consensus       206 ~v~~cvqqvve~lq~~~ivp~~~~~~v~elfv~e~~l~~~~~eae~lp~l~itkvdlqwvqvlaegwatpl~gfmrerey  285 (627)
T KOG4238|consen  206 TVSDCVQQVVELLQEQNIVPYTIIKDVHELFVPENKLDHVRAEAETLPSLSITKVDLQWVQVLAEGWATPLKGFMREREY  285 (627)
T ss_pred             hHHHHHHHHHHHHHhcCCChhhhhHHHHHHcCCccHHHHHHhhhccCCcceeeehhHHHHHHHHhhccccchhHHHHHHH
Confidence            99999999999999999999776      454           7889999999999999999999999999999999999


Q ss_pred             HhhhhhcccCCC-------CccceeEEEecChhhhhhcC
Q psy17388        241 LKTIHFNTLDSN-------VNQSVAIVLAVTGEDKQRLE  272 (272)
Q Consensus       241 ~~v~~~~~l~~~-------~~~~~pi~l~~~~~~~~~~~  272 (272)
                      .+|+|+-.|.||       ...||||||+++.|++.+||
T Consensus       286 lq~mhf~~lld~khaf~g~in~sipivl~~s~e~k~~le  324 (627)
T KOG4238|consen  286 LQVMHFDTLLDGKHAFDGVINMSIPIVLPVSAEDKTRLE  324 (627)
T ss_pred             HHHhhhhhhhcccccccccccccccEEEecchhhhhccc
Confidence            999999999987       78999999999999999886



>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0635|consensus Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>PF14306 PUA_2: PUA-like domain; PDB: 1M8P_C 1I2D_B 2OFW_G 1X6V_B 1XNJ_A 1XJQ_B 2QJF_A 2OFX_B 1J70_B 1G8F_A Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK04149 sat sulfate adenylyltransferase; Reviewed Back     alignment and domain information
>cd00517 ATPS ATP-sulfurylase Back     alignment and domain information
>TIGR00339 sopT ATP sulphurylase Back     alignment and domain information
>COG2046 MET3 ATP sulfurylase (sulfate adenylyltransferase) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae Back     alignment and domain information
>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3354|consensus Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>COG0645 Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>PLN02924 thymidylate kinase Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>COG3896 Chloramphenicol 3-O-phosphotransferase [Defense mechanisms] Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>KOG3062|consensus Back     alignment and domain information
>PRK13976 thymidylate kinase; Provisional Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>COG4639 Predicted kinase [General function prediction only] Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>PRK13974 thymidylate kinase; Provisional Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>KOG3347|consensus Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PTZ00451 dephospho-CoA kinase; Provisional Back     alignment and domain information
>PLN02422 dephospho-CoA kinase Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>PF01591 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR013079 6-Phosphofructo-2-kinase (2 Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>COG1660 Predicted P-loop-containing kinase [General function prediction only] Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PRK14732 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional Back     alignment and domain information
>KOG3079|consensus Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>KOG3220|consensus Back     alignment and domain information
>PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>KOG0636|consensus Back     alignment and domain information
>PLN02842 nucleotide kinase Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PHA03132 thymidine kinase; Provisional Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03707 PPK2_P_aer polyphosphate kinase 2, PA0141 family Back     alignment and domain information
>PF08303 tRNA_lig_kinase: tRNA ligase kinase domain; InterPro: IPR015966 This entry represents a kinase domain found in fungal tRNA ligases [] Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>KOG4622|consensus Back     alignment and domain information
>KOG3327|consensus Back     alignment and domain information
>PF13189 Cytidylate_kin2: Cytidylate kinase-like family; PDB: 3FDI_A Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR03709 PPK2_rel_1 polyphosphate:nucleotide phosphotransferase, PPK2 family Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>TIGR03708 poly_P_AMP_trns polyphosphate:AMP phosphotransferase Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>KOG1384|consensus Back     alignment and domain information
>PF03976 PPK2: Polyphosphate kinase 2 (PPK2); InterPro: IPR022488 This presumed domain is found in one or two copies per protein Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>KOG3877|consensus Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>COG4185 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>KOG3308|consensus Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PRK09169 hypothetical protein; Validated Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>KOG2134|consensus Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR01223 Pmev_kin_anim phosphomevalonate kinase, animal type Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>COG4240 Predicted kinase [General function prediction only] Back     alignment and domain information
>KOG1532|consensus Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>KOG0780|consensus Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>cd02033 BchX Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring Back     alignment and domain information
>TIGR03708 poly_P_AMP_trns polyphosphate:AMP phosphotransferase Back     alignment and domain information
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>KOG1533|consensus Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>KOG2004|consensus Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK13886 conjugal transfer protein TraL; Provisional Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PHA02575 1 deoxynucleoside monophosphate kinase; Provisional Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell Back     alignment and domain information
>KOG4235|consensus Back     alignment and domain information
>KOG3078|consensus Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>cd02032 Bchl_like This family of proteins contains bchL and chlL Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG3911 Predicted ATPase [General function prediction only] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF02224 Cytidylate_kin: Cytidylate kinase; InterPro: IPR011994 Cytidylate kinase (2 Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF01712 dNK: Deoxynucleoside kinase; InterPro: IPR002624 This family consists of various deoxynucleoside kinases including cytidine (2 Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>COG0802 Predicted ATPase or kinase [General function prediction only] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>TIGR02016 BchX chlorophyllide reductase iron protein subunit X Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query272
1x6v_B 630 The Crystal Structure Of Human 3'-Phosphoadenosine- 4e-74
2ofx_A207 Crystal Structure Of The Apsk Domain Of Human Papss 2e-53
2ofw_A208 Crystal Structure Of The Apsk Domain Of Human Papss 4e-53
2pey_A179 Crystal Strucutre Of Deletion Mutant Of Aps-Kinase 2e-52
2ax4_A198 Crystal Structure Of The Kinase Domain Of Human 3'- 4e-51
1d6j_A211 Crystal Structure Of Adenosine 5'-Phosphosulfate (A 2e-47
3cr7_A197 Crystal Structure Of N-Terminal Truncation Of Aps K 2e-47
3uie_A200 Crystal Structure Of Adenosine 5'-Phosphosulfate Ki 6e-35
2gks_A546 Crystal Structure Of The Bi-Functional Atp Sulfuryl 7e-33
2yvu_A186 Crystal Structure Of Ape1195 Length = 186 3e-30
3cr8_A552 Hexameric Aps Kinase From Thiobacillus Denitrifican 7e-26
1m8p_A573 Crystal Structure Of P. Chrysogenum Atp Sulfurylase 7e-19
1i2d_A573 Crystal Structure Of Atp Sulfurylase From Penicilli 8e-19
2qjf_A 405 Crystal Structure Of Atp-Sulfurylase Domain Of Huma 7e-17
>pdb|1X6V|B Chain B, The Crystal Structure Of Human 3'-Phosphoadenosine-5'- Phosphosulfate Synthetase 1 Length = 630 Back     alignment and structure

Iteration: 1

Score = 274 bits (701), Expect = 4e-74, Method: Compositional matrix adjust. Identities = 132/263 (50%), Positives = 176/263 (66%), Gaps = 19/263 (7%) Query: 29 GLSGAGKTSISFQIESYLIAQGIPAYALDGDNLRNGINANLAFSEEDRNENVRRAAECAK 88 GLSGAGKT++S +E YL+ GIP Y LDGDN+R G+N NL FS EDR ENVRR AE AK Sbjct: 59 GLSGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAK 118 Query: 89 MFAECGFIALCSFVSPTAAARDRAREIHRNANLEFFEVFVNTPVEICEQRDVKGHYKKAR 148 +FA+ G + + SF+SP R+ AR+IH A+L FFEVFV+ P+ +CEQRDVKG YKKAR Sbjct: 119 LFADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKAR 178 Query: 149 EGKIKSFTGVSQPYEAPKNPDLILETVNVPVEKCANSVLDMIAAKGLIPARQFFFI---- 204 G+IK FTG+ YE P+ P+L+L+T + V C V++++ + ++P + + Sbjct: 179 AGEIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVPVDASYEVKELY 238 Query: 205 -------------EALPRLDIGVIDLQWVQVIAEGWSSPLKGFMREDEFLKTIHFNT-LD 250 E LP L I +D+QWVQV+AEGW++PL GFMRE E+L+ +HF+ LD Sbjct: 239 VPENKLHLAKTDAETLPALKINKVDMQWVQVLAEGWATPLNGFMREREYLQCLHFDCLLD 298 Query: 251 SNV-NQSVAIVLAVTGEDKQRLE 272 V N SV IVL T EDK+RL+ Sbjct: 299 GGVINLSVPIVLTATHEDKERLD 321
>pdb|2OFX|A Chain A, Crystal Structure Of The Apsk Domain Of Human Papss1 In Complex With Adpmg And Paps Length = 207 Back     alignment and structure
>pdb|2OFW|A Chain A, Crystal Structure Of The Apsk Domain Of Human Papss1 Complexed With 2 Aps Molecules Length = 208 Back     alignment and structure
>pdb|2PEY|A Chain A, Crystal Strucutre Of Deletion Mutant Of Aps-Kinase Domain Of Human Paps-Synthetase 1 Length = 179 Back     alignment and structure
>pdb|2AX4|A Chain A, Crystal Structure Of The Kinase Domain Of Human 3'- Phosphoadenosine 5'-Phosphosulphate Synthetase 2 Length = 198 Back     alignment and structure
>pdb|1D6J|A Chain A, Crystal Structure Of Adenosine 5'-Phosphosulfate (Aps) Kinase From Penicillium Chrysogenum Length = 211 Back     alignment and structure
>pdb|3CR7|A Chain A, Crystal Structure Of N-Terminal Truncation Of Aps Kinase From Penicillium Chrysogenum: Ternary Structure With Adp And Paps Length = 197 Back     alignment and structure
>pdb|3UIE|A Chain A, Crystal Structure Of Adenosine 5'-Phosphosulfate Kinase From Arabidopsis Thaliana In Complex With Amppnp And Aps Length = 200 Back     alignment and structure
>pdb|2GKS|A Chain A, Crystal Structure Of The Bi-Functional Atp Sulfurylase-Aps Kinase From Aquifex Aeolicus, A Chemolithotrophic Thermophile Length = 546 Back     alignment and structure
>pdb|2YVU|A Chain A, Crystal Structure Of Ape1195 Length = 186 Back     alignment and structure
>pdb|3CR8|A Chain A, Hexameric Aps Kinase From Thiobacillus Denitrificans Length = 552 Back     alignment and structure
>pdb|1M8P|A Chain A, Crystal Structure Of P. Chrysogenum Atp Sulfurylase In The T-State Length = 573 Back     alignment and structure
>pdb|1I2D|A Chain A, Crystal Structure Of Atp Sulfurylase From Penicillium Chrysogenum Length = 573 Back     alignment and structure
>pdb|2QJF|A Chain A, Crystal Structure Of Atp-Sulfurylase Domain Of Human Paps Synthetase 1 Length = 405 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query272
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 1e-103
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 1e-94
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 2e-94
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 9e-92
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 3e-91
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 2e-72
3cr8_A 552 Sulfate adenylyltranferase, adenylylsulfate kinase 1e-16
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 3e-67
2gks_A 546 Bifunctional SAT/APS kinase; transferase, sulfuryl 2e-18
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 4e-66
1m8p_A 573 Sulfate adenylyltransferase; rossmann fold, phosph 8e-17
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 1e-24
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 6e-15
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 1e-12
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 6e-12
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 9e-11
1g8f_A 511 Sulfate adenylyltransferase; alpha-beta protein, b 3e-10
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 3e-10
1r6x_A 395 ATP:sulfate adenylyltransferase; APS kinase-like d 3e-10
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 1e-09
1v47_A 349 ATP sulfurylase; product binding complex, zinc, ri 1e-09
1jhd_A 396 Sulfate adenylyltransferase; sulfurylase, APS, che 2e-08
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 8e-08
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 9e-06
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 2e-05
2vli_A183 Antibiotic resistance protein; transferase, tunica 4e-04
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 5e-04
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Length = 630 Back     alignment and structure
 Score =  312 bits (802), Expect = e-103
 Identities = 131/275 (47%), Positives = 177/275 (64%), Gaps = 19/275 (6%)

Query: 17  KEGQSNICLLFPGLSGAGKTSISFQIESYLIAQGIPAYALDGDNLRNGINANLAFSEEDR 76
           + G     +   GLSGAGKT++S  +E YL+  GIP Y LDGDN+R G+N NL FS EDR
Sbjct: 47  RGGFRGCTVWLTGLSGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDR 106

Query: 77  NENVRRAAECAKMFAECGFIALCSFVSPTAAARDRAREIHRNANLEFFEVFVNTPVEICE 136
            ENVRR AE AK+FA+ G + + SF+SP    R+ AR+IH  A+L FFEVFV+ P+ +CE
Sbjct: 107 EENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCE 166

Query: 137 QRDVKGHYKKAREGKIKSFTGVSQPYEAPKNPDLILETVNVPVEKCANSVLDMIAAKGLI 196
           QRDVKG YKKAR G+IK FTG+   YE P+ P+L+L+T +  V  C   V++++  + ++
Sbjct: 167 QRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIV 226

Query: 197 P---------------ARQFFFIEA--LPRLDIGVIDLQWVQVIAEGWSSPLKGFMREDE 239
           P                      +A  LP L I  +D+QWVQV+AEGW++PL GFMRE E
Sbjct: 227 PVDASYEVKELYVPENKLHLAKTDAETLPALKINKVDMQWVQVLAEGWATPLNGFMRERE 286

Query: 240 FLKTIHFNTL--DSNVNQSVAIVLAVTGEDKQRLE 272
           +L+ +HF+ L     +N SV IVL  T EDK+RL+
Sbjct: 287 YLQCLHFDCLLDGGVINLSVPIVLTATHEDKERLD 321


>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Length = 179 Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Length = 186 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} PDB: 4fxp_A* Length = 200 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Length = 211 Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Length = 552 Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Length = 552 Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Length = 546 Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Length = 546 Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Length = 573 Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Length = 573 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Length = 260 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Length = 193 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Length = 178 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Length = 200 Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Length = 175 Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Length = 511 Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Length = 189 Back     alignment and structure
>1r6x_A ATP:sulfate adenylyltransferase; APS kinase-like domain; 1.40A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 Length = 395 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Length = 191 Back     alignment and structure
>1v47_A ATP sulfurylase; product binding complex, zinc, riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; HET: ADX; 2.49A {Thermus thermophilus} SCOP: b.122.1.3 c.26.1.5 Length = 349 Back     alignment and structure
>1jhd_A Sulfate adenylyltransferase; sulfurylase, APS, chemoautotroph, bromide; 1.70A {Sulfur-oxidizing endosymbiont ofriftia pachyptila} SCOP: b.122.1.3 c.26.1.5 Length = 396 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Length = 202 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Length = 181 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Length = 301 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} PDB: 2axp_A* Length = 173 Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Length = 183 Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Length = 469 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query272
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 100.0
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 99.94
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 99.94
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 99.93
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 99.93
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 99.93
1r6x_A 395 ATP:sulfate adenylyltransferase; APS kinase-like d 99.89
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 99.88
1v47_A 349 ATP sulfurylase; product binding complex, zinc, ri 99.87
1jhd_A 396 Sulfate adenylyltransferase; sulfurylase, APS, che 99.87
1g8f_A 511 Sulfate adenylyltransferase; alpha-beta protein, b 99.86
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 99.86
3cr8_A 552 Sulfate adenylyltranferase, adenylylsulfate kinase 99.86
2gks_A 546 Bifunctional SAT/APS kinase; transferase, sulfuryl 99.86
1m8p_A 573 Sulfate adenylyltransferase; rossmann fold, phosph 99.85
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 99.81
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 99.8
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 99.77
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 99.76
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 99.76
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 99.75
2vli_A183 Antibiotic resistance protein; transferase, tunica 99.72
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 99.72
3vaa_A199 Shikimate kinase, SK; structural genomics, center 99.66
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 99.62
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 99.62
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 99.61
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 99.58
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 99.58
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 99.57
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 99.57
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 99.56
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 99.56
1via_A175 Shikimate kinase; structural genomics, transferase 99.56
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 99.55
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 99.55
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 99.55
1kag_A173 SKI, shikimate kinase I; transferase, structural g 99.54
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 99.54
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 99.53
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 99.53
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 99.53
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 99.52
3r20_A233 Cytidylate kinase; structural genomics, seattle st 99.52
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 99.51
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 99.51
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 99.51
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 99.51
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 99.5
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 99.5
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 99.49
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 99.49
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 99.49
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 99.49
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 99.49
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 99.47
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 99.47
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 99.47
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 99.46
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 99.45
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 99.45
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 99.45
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 99.44
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 99.43
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 99.43
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 99.42
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 99.42
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 99.41
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 99.41
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 99.4
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 99.4
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 99.39
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 99.39
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 99.39
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 99.38
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 99.35
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 99.34
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 99.34
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 99.33
3tlx_A243 Adenylate kinase 2; structural genomics, structura 99.33
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 99.31
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 99.31
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 99.3
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 99.28
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 99.28
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 99.27
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 99.27
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 99.27
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 99.26
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 99.25
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 99.25
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 99.23
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 99.22
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 99.17
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 99.17
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 99.15
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 99.14
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 99.14
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 99.13
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 99.12
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 99.1
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 99.1
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 99.09
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 99.01
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 99.0
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 98.97
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 98.96
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 98.94
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 98.89
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 98.83
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 98.78
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 98.78
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 98.73
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 98.72
3ch4_B202 Pmkase, phosphomevalonate kinase; parallel beta-sh 98.71
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 98.7
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 98.67
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 98.67
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 98.67
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 98.67
3czq_A304 Putative polyphosphate kinase 2; structural genomi 98.59
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 98.52
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 98.52
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 98.49
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 98.45
1p6x_A334 Thymidine kinase; P-loop, LID, transferase; HET: T 98.43
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 98.4
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 98.31
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 98.26
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 98.22
3czp_A 500 Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2 98.22
1of1_A376 Thymidine kinase; transferase, antiviral drug, enz 98.19
1e2k_A331 Thymidine kinase; transferase, antiviral drug, enz 98.16
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 98.13
3czp_A500 Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2 98.11
1osn_A341 Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, tra 98.02
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 97.95
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 97.94
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 97.92
3bos_A242 Putative DNA replication factor; P-loop containing 97.9
3rhf_A289 Putative polyphosphate kinase 2 family protein; PS 97.88
1xjc_A169 MOBB protein homolog; structural genomics, midwest 97.86
1vma_A306 Cell division protein FTSY; TM0570, structural gen 97.84
1dek_A241 Deoxynucleoside monophosphate kinase; transferase, 97.82
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.81
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 97.8
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 97.78
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.74
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 97.73
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 97.73
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 97.7
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 97.7
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 97.69
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.68
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 97.66
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 97.66
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 97.64
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.64
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 97.63
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 97.62
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 97.6
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 97.59
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.58
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 97.57
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 97.56
2xxa_A433 Signal recognition particle protein; protein trans 97.56
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 97.54
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 97.53
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.53
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.53
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 97.52
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 97.52
2og2_A359 Putative signal recognition particle receptor; nuc 97.51
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 97.51
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 97.49
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 97.49
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.49
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 97.48
2chg_A226 Replication factor C small subunit; DNA-binding pr 97.48
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 97.47
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 97.46
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 97.46
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 97.45
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.45
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 97.44
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.43
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 97.43
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 97.43
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 97.42
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 97.42
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 97.41
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 97.41
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 97.4
3end_A307 Light-independent protochlorophyllide reductase ir 97.39
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 97.39
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.39
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 97.39
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 97.38
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 97.38
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.37
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 97.37
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 97.37
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 97.37
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 97.36
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 97.35
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 97.34
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 97.33
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 97.33
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 97.32
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 97.31
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 97.3
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 97.3
2www_A349 Methylmalonic aciduria type A protein, mitochondri 97.29
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 97.29
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 97.29
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 97.29
2qgz_A308 Helicase loader, putative primosome component; str 97.28
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 97.28
1u94_A356 RECA protein, recombinase A; homologous recombinat 97.27
2v1u_A387 Cell division control protein 6 homolog; DNA repli 97.26
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 97.25
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 97.24
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 97.24
2r6a_A454 DNAB helicase, replicative helicase; replication, 97.24
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 97.24
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 97.23
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 97.23
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 97.22
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 97.21
2eyu_A261 Twitching motility protein PILT; pilus retraction 97.21
2r62_A268 Cell division protease FTSH homolog; ATPase domain 97.2
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 97.2
4a74_A231 DNA repair and recombination protein RADA; hydrola 97.2
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 97.18
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 97.18
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 97.17
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 97.17
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 97.16
1kjw_A295 Postsynaptic density protein 95; protein-protein i 97.15
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 97.14
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 97.14
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 97.13
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 97.12
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 97.12
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 97.11
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 97.1
3iqw_A334 Tail-anchored protein targeting factor GET3; ATPas 97.1
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 97.09
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.08
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 97.08
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 97.08
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 97.08
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 97.07
1xp8_A366 RECA protein, recombinase A; recombination, radior 97.06
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 97.06
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 97.02
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 97.02
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 97.01
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 97.0
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 97.0
2woo_A329 ATPase GET3; tail-anchored, membrane protein, targ 96.98
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 96.97
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 96.97
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 96.97
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 96.96
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 96.95
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 96.95
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 96.94
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 96.93
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 96.93
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 96.91
2woj_A354 ATPase GET3; tail-anchored, membrane protein, targ 96.91
3io3_A348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 96.9
3pvs_A 447 Replication-associated recombination protein A; ma 96.89
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 96.88
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 96.88
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 96.88
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 96.87
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 96.86
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 96.85
1tue_A212 Replication protein E1; helicase, replication, E1E 96.84
2z43_A324 DNA repair and recombination protein RADA; archaea 96.83
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 96.81
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 96.81
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 96.79
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 96.79
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 96.78
2ewv_A372 Twitching motility protein PILT; pilus retraction 96.78
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 96.76
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 96.74
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 96.74
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 96.74
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 96.73
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 96.73
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 96.72
2hf9_A226 Probable hydrogenase nickel incorporation protein 96.72
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chrom 96.72
1b0u_A262 Histidine permease; ABC transporter, transport pro 96.71
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 96.71
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 96.7
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 96.69
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 96.69
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 96.68
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 96.68
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 96.68
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 96.67
3io5_A333 Recombination and repair protein; storage dimer, i 96.67
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 96.66
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 96.66
2ghi_A260 Transport protein; multidrug resistance protein, M 96.65
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 96.65
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 96.65
1ji0_A240 ABC transporter; ATP binding protein, structural g 96.64
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 96.63
2r44_A331 Uncharacterized protein; putative ATPase, structur 96.63
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 96.62
1g6h_A257 High-affinity branched-chain amino acid transport 96.62
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 96.61
1p9r_A418 General secretion pathway protein E; bacterial typ 96.61
1ojl_A304 Transcriptional regulatory protein ZRAR; response 96.6
1sgw_A214 Putative ABC transporter; structural genomics, P p 96.6
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 96.59
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 96.59
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 96.59
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 96.58
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 96.58
2xkx_A721 Disks large homolog 4; structural protein, scaffol 96.58
2chq_A319 Replication factor C small subunit; DNA-binding pr 96.57
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 96.57
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 96.57
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 96.56
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 96.56
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 96.55
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 96.55
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 96.53
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 96.53
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 96.52
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 96.51
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 96.5
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 96.49
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 96.49
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 96.48
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 96.47
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 96.46
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 96.42
2oze_A298 ORF delta'; para, walker type atpases, DNA segrega 96.41
3co5_A143 Putative two-component system transcriptional RES 96.41
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 96.4
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 96.39
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 96.38
3cwq_A209 Para family chromosome partitioning protein; alpha 96.36
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 96.36
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 96.35
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 96.34
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 96.34
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 96.34
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 96.33
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 96.32
1byi_A224 Dethiobiotin synthase; biotin synthesis, cyclo-lig 96.32
3fwy_A314 Light-independent protochlorophyllide reductase I 96.31
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 96.31
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 96.3
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 96.3
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 96.27
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 96.26
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 96.24
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 96.24
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 96.24
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 96.23
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 96.22
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 96.2
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 96.19
2xj4_A286 MIPZ; replication, cell division, ATPase, WACA; 1. 96.18
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 96.17
3kta_A182 Chromosome segregation protein SMC; structural mai 96.16
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 96.16
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 96.14
2fna_A357 Conserved hypothetical protein; structural genomic 96.12
3qxc_A242 Dethiobiotin synthetase; DTBS, structural genomics 96.08
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 96.08
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 96.07
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 96.07
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 96.06
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 96.06
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 96.05
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 96.02
2wji_A165 Ferrous iron transport protein B homolog; membrane 96.0
1ihu_A589 Arsenical pump-driving ATPase; aluminum fluoride, 95.99
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 95.97
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 95.96
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 95.93
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 95.93
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 95.92
3of5_A228 Dethiobiotin synthetase; structural genomics, cent 95.91
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 95.91
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 95.9
1knx_A312 Probable HPR(Ser) kinase/phosphatase; HPR kinase, 95.87
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 95.85
3ez2_A398 Plasmid partition protein A; type IA, DNA binding, 95.84
2oap_1511 GSPE-2, type II secretion system protein; hexameri 95.83
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 95.81
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 95.79
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 95.78
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 95.76
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 95.71
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 95.71
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 95.69
3igf_A 374 ALL4481 protein; two-domained protein consisting o 95.69
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 95.68
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 95.63
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 95.62
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 95.62
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 95.62
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 95.6
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 95.6
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 95.59
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 95.58
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 95.57
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 95.54
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 95.54
3pg5_A 361 Uncharacterized protein; structural genomics, PSI- 95.53
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 95.52
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 95.52
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 95.5
2ged_A193 SR-beta, signal recognition particle receptor beta 95.49
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 95.44
2gno_A305 DNA polymerase III, gamma subunit-related protein; 95.42
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 95.41
3ez9_A403 Para; DNA binding, winged-HTH, partition, biosynth 95.41
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 95.4
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 95.39
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 95.38
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 95.36
1nrj_B218 SR-beta, signal recognition particle receptor beta 95.36
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 95.35
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 95.34
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 95.34
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 95.3
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 95.3
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 95.29
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 95.29
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 95.29
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 95.27
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 95.26
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 95.25
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 95.24
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 95.21
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 95.21
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 95.18
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 95.18
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 95.17
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 95.17
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 95.17
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 95.14
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 95.14
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 95.14
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 95.12
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 95.11
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 95.11
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 95.09
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 95.09
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 95.09
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 95.08
3fgn_A251 Dethiobiotin synthetase; biotin biosynthesis, BIOD 95.08
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 95.08
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 95.07
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 95.06
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 95.05
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 95.04
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 95.02
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 95.01
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 95.01
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 95.0
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 94.99
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 94.98
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 94.98
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 94.97
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 94.97
3lxx_A239 GTPase IMAP family member 4; structural genomics c 94.96
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 94.96
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 94.96
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 94.96
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 94.95
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 94.94
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 94.92
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 94.92
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 94.92
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 94.91
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 94.9
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 94.9
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 94.89
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 94.88
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 94.88
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 94.87
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 94.87
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 94.86
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 94.85
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 94.81
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 94.81
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 94.79
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
Probab=100.00  E-value=9e-53  Score=403.36  Aligned_cols=263  Identities=50%  Similarity=0.934  Sum_probs=230.4

Q ss_pred             cccchhhhhhhcCC----CCeEEEEEcCCCCCHHHHHHHHHHHHHHcCCCEEEecCccccccccccCCCCHHHHHHHHHH
Q psy17388          7 EGKESWLRDFKEGQ----SNICLLFPGLSGAGKTSISFQIESYLIAQGIPAYALDGDNLRNGINANLAFSEEDRNENVRR   82 (272)
Q Consensus         7 ~~~~~~~r~~~~~~----~~~lI~l~G~~GsGKSTlAr~La~~L~~~g~~~~~ld~D~i~~~l~~~~~~~~~~~~~~~~~   82 (272)
                      ++.++  |+.+.++    +|++|+|+|+|||||||+|++|+++|...|++++.+|+|.++..+..+.+|+..++.+++++
T Consensus        35 v~~~~--r~~~~~~~~~~~g~lIvLtGlsGSGKSTlAr~La~~L~~~G~~~v~lDgD~iR~~L~~~~~fs~~dree~~r~  112 (630)
T 1x6v_B           35 VSRNK--RGQVVGTRGGFRGCTVWLTGLSGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRR  112 (630)
T ss_dssp             CCHHH--HHHHSSSSSSCCCEEEEEECSTTSSHHHHHHHHHHHHHHTTCCEEEESHHHHTTTTTTTCCSSHHHHHHHHHH
T ss_pred             CCHHH--HHHHhCCCccCCCCEEEEEeCCCCCHHHHHHHHHHHHHhcCCeEEEechHHhhhccCccccCChhhhHHHHHH
Confidence            44444  4555554    89999999999999999999999999888889999999999888776677887888889988


Q ss_pred             HHHHHHHHHhCCCeEEEcCCCCcHHHHHHHHHHHHhCCCceEEEEEeCCHHHHHHhhhhhhhhhhhhccccccccccccC
Q psy17388         83 AAECAKMFAECGFIALCSFVSPTAAARDRAREIHRNANLEFFEVFVNTPVEICEQRDVKGHYKKAREGKIKSFTGVSQPY  162 (272)
Q Consensus        83 i~~~~~~~~~~g~~VI~d~~~~~~~~r~~~~~~~~~~g~~~~~V~L~~~~e~~~~Rl~~r~~~~~r~~~~~~~~~~~~~y  162 (272)
                      +.++++.++++|.+||+++.+++...++.+++++...+.++++|||+||++++.+|+.++.+++.|.+++..+..++..|
T Consensus       113 i~eva~~~l~~G~iVI~d~~s~~~~~r~~~r~ll~~~g~p~~vV~Ldap~Evl~~Rl~r~ly~~aR~~~~~~~~~~~~~Y  192 (630)
T 1x6v_B          113 IAEVAKLFADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEY  192 (630)
T ss_dssp             HHHHHHHHHHTTCEEEEECCCCCHHHHHHHHHHHHTTTCCEEEEEEECCHHHHHHHCTTSHHHHHTTC----CBTTTBCC
T ss_pred             HHHHHHHHHhCCCEEEEeCchhhHHHHHHHHHHHHhCCCCeEEEEEECCHHHHHHHhccccchhhhhhhHHHHHHhhhhh
Confidence            88888888899999999988887778889999888888889999999999999999988877777777666777788899


Q ss_pred             CCCCCCcEEEeCCCCCHHHHHHHHHHHHHhCCCCCCch------hhh-----------hccCCceecCchhHHHHHHHhh
Q psy17388        163 EAPKNPDLILETVNVPVEKCANSVLDMIAAKGLIPARQ------FFF-----------IEALPRLDIGVIDLQWVQVIAE  225 (272)
Q Consensus       163 e~~~~~~~~Idt~~~~~ee~~~~I~~~L~~~~~~~~~~------l~~-----------~~~~~~~~~~~~~~~~~~~~~~  225 (272)
                      +.|..++++|||++.++++++++|++.|...+++|-|+      |++           +..||+|.|+++++|||++|++
T Consensus       193 e~p~~~dlvIDts~~s~eevv~~Il~~L~~~~~ip~G~~~~l~~l~v~~~~~~~~~~~a~~l~~i~l~~~~~~dlell~~  272 (630)
T 1x6v_B          193 EKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVPVDASYEVKELYVPENKLHLAKTDAETLPALKINKVDMQWVQVLAE  272 (630)
T ss_dssp             CCCSSCSEEEETTSSCHHHHHHHHHHHHHHTTSSCCCCCCSCCCCBCCGGGHHHHHHHHHTSCEEECCHHHHHHHHHHHH
T ss_pred             cccCCCcEEEECCCCCHHHHHHHHHHHHHhcCcccccCcccceecccChHHHHHHHHhhccCCEEEECHHHHHHHHHHhc
Confidence            98878899999998999999999999999999999863      343           7789999999999999999999


Q ss_pred             ccccCccCCCCHHHHHhhhhhcccCCC--CccceeEEEecChhhhhhc
Q psy17388        226 GWSSPLKGFMREDEFLKTIHFNTLDSN--VNQSVAIVLAVTGEDKQRL  271 (272)
Q Consensus       226 g~~~pl~gfm~~~~~~~v~~~~~l~~~--~~~~~pi~l~~~~~~~~~~  271 (272)
                      ||||||+|||+++||+||+++|||+||  ++|||||||+|++++++.|
T Consensus       273 G~fsPL~GfM~~~dy~~v~~~~~l~~g~~~~~~iPi~L~v~~~~~~~l  320 (630)
T 1x6v_B          273 GWATPLNGFMREREYLQCLHFDCLLDGGVINLSVPIVLTATHEDKERL  320 (630)
T ss_dssp             TTTTTCCSSCCHHHHHHHHHHSEECTTSCEECCSCCCEEECHHHHHHH
T ss_pred             CCccCchhhCCHHHHHHHHHhCEeCCCCeeeeeeEEEEeCCHHHHhhC
Confidence            999999999999999999999999996  7999999999999988765



>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1r6x_A ATP:sulfate adenylyltransferase; APS kinase-like domain; 1.40A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>1v47_A ATP sulfurylase; product binding complex, zinc, riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; HET: ADX; 2.49A {Thermus thermophilus} SCOP: b.122.1.3 c.26.1.5 Back     alignment and structure
>1jhd_A Sulfate adenylyltransferase; sulfurylase, APS, chemoautotroph, bromide; 1.70A {Sulfur-oxidizing endosymbiont ofriftia pachyptila} SCOP: b.122.1.3 c.26.1.5 Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3czq_A Putative polyphosphate kinase 2; structural genomics, APC6299, PSI-2, structure initiative; HET: MSE GOL; 2.23A {Sinorhizobium meliloti} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1p6x_A Thymidine kinase; P-loop, LID, transferase; HET: THM; 2.00A {Equid herpesvirus 4} SCOP: c.37.1.1 PDB: 1p72_A* 1p73_A* 1p75_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural protein structure initiative, midwest center for structural genomics; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 Back     alignment and structure
>1e2k_A Thymidine kinase; transferase, antiviral drug, enzyme-prodrug gene therapy, sugar ring pucker; HET: TMC; 1.7A {Herpes simplex virus} SCOP: c.37.1.1 PDB: 1e2i_A* 1e2h_A* 1e2m_A* 1e2n_A* 1e2p_A* 1ki2_A* 1ki3_A* 1ki4_A* 1ki6_B* 1ki7_A* 1ki8_A* 3rdp_A* 2ki5_A* 1kim_A* 1qhi_A* 1p7c_A* 1vtk_A* 2vtk_A* 3vtk_A* 3f0t_A* ... Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural protein structure initiative, midwest center for structural genomics; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1osn_A Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, transferase; HET: BVP ADP; 3.20A {Human herpesvirus 3} SCOP: c.37.1.1 Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3rhf_A Putative polyphosphate kinase 2 family protein; PSI-biology, MCSG, structural genomics, midwest center for S genomics; HET: PGE FLC PG4; 2.45A {Arthrobacter aurescens} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1dek_A Deoxynucleoside monophosphate kinase; transferase, phosphotransferase; HET: DGP; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 PDB: 1del_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3qxc_A Dethiobiotin synthetase; DTBS, structural genomics, ATP BIND biology, protein structure initiative, midwest center for S genomics, MCSG; HET: ATP; 1.34A {Helicobacter pylori} PDB: 3mle_A* 3qxh_A* 3qxj_A* 3qxs_A* 3qxx_A* 3qy0_A* 2qmo_A Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3of5_A Dethiobiotin synthetase; structural genomics, center for structural genomics of infec diseases, csgid, ligase; 1.52A {Francisella tularensis subsp} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3fgn_A Dethiobiotin synthetase; biotin biosynthesis, BIOD, ATP-BIND ligase, magnesium, nucleotide-binding; 1.85A {Mycobacterium tuberculosis} PDB: 3fmf_A* 3fmi_A* 3fpa_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 272
d1m7ga_208 c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (A 3e-52
d1x6va3195 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kin 3e-34
d1m8pa3183 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal d 6e-28
d1qhxa_178 c.37.1.3 (A:) Chloramphenicol phosphotransferase { 3e-19
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 1e-16
d1g8fa3122 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal d 5e-14
d1knqa_171 c.37.1.17 (A:) Gluconate kinase {Escherichia coli 6e-13
d1np6a_170 c.37.1.10 (A:) Molybdopterin-guanine dinucleotide 2e-12
d1v47a1132 b.122.1.3 (A:4-135) ATP sulfurylase N-terminal dom 4e-12
d1x6va1161 b.122.1.3 (A:229-389) ATP sulfurylase N-terminal d 6e-12
d1bifa1213 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fruct 7e-12
d1g8fa1167 b.122.1.3 (A:2-168) ATP sulfurylase N-terminal dom 9e-12
d1m8pa1170 b.122.1.3 (A:1-170) ATP sulfurylase N-terminal dom 9e-12
d1jhda1173 b.122.1.3 (A:1-173) ATP sulfurylase N-terminal dom 4e-10
d2bdta1176 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {B 2e-09
d1kaga_169 c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia 8e-09
d1ly1a_152 c.37.1.1 (A:) Polynucleotide kinase, kinase domain 1e-05
d1nksa_194 c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobu 4e-05
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Length = 208 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Adenosine-5'phosphosulfate kinase (APS kinase)
domain: Adenosine-5'phosphosulfate kinase (APS kinase)
species: Fungus (Penicillium chrysogenum) [TaxId: 5076]
 Score =  167 bits (423), Expect = 3e-52
 Identities = 87/188 (46%), Positives = 123/188 (65%), Gaps = 7/188 (3%)

Query: 19  GQSNICLLFPGLSGAGKTSISFQIESYLIAQG-IPAYALDGDNLRNGINANLAFSEEDRN 77
            Q  + +   GLS +GK++++ ++E  L+    + AY LDGDN+R G+N +L FSE DRN
Sbjct: 21  NQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRN 80

Query: 78  ENVRRAAECAKMFAECGFIALCSFVSPTAAARDRAREIH------RNANLEFFEVFVNTP 131
           EN+RR AE AK+FA+   IA+ SF+SP    RD AR++H          L F EV+V+ P
Sbjct: 81  ENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVATPGEETGLPFVEVYVDVP 140

Query: 132 VEICEQRDVKGHYKKAREGKIKSFTGVSQPYEAPKNPDLILETVNVPVEKCANSVLDMIA 191
           VE+ EQRD KG YKKAREG IK FTG+S PYEAP NP++ ++   +PV+     ++D + 
Sbjct: 141 VEVAEQRDPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNYELPVQDAVKQIIDYLD 200

Query: 192 AKGLIPAR 199
            KG +PA+
Sbjct: 201 TKGYLPAK 208


>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Length = 195 Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Length = 183 Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 122 Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Length = 171 Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Length = 170 Back     information, alignment and structure
>d1v47a1 b.122.1.3 (A:4-135) ATP sulfurylase N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 132 Back     information, alignment and structure
>d1x6va1 b.122.1.3 (A:229-389) ATP sulfurylase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 213 Back     information, alignment and structure
>d1g8fa1 b.122.1.3 (A:2-168) ATP sulfurylase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 167 Back     information, alignment and structure
>d1m8pa1 b.122.1.3 (A:1-170) ATP sulfurylase N-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Length = 170 Back     information, alignment and structure
>d1jhda1 b.122.1.3 (A:1-173) ATP sulfurylase N-terminal domain {Sulfur-oxidizing endosymbiont of Riftia pachyptila [TaxId: 35843]} Length = 173 Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Length = 176 Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Length = 169 Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Length = 152 Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 194 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query272
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 100.0
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 99.93
d1g8fa1167 ATP sulfurylase N-terminal domain {Baker's yeast ( 99.92
d1m8pa1170 ATP sulfurylase N-terminal domain {Fungus (Penicil 99.91
d1x6va1161 ATP sulfurylase N-terminal domain {Human (Homo sap 99.91
d1jhda1173 ATP sulfurylase N-terminal domain {Sulfur-oxidizin 99.91
d1v47a1132 ATP sulfurylase N-terminal domain {Thermus thermop 99.9
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 99.89
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 99.82
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 99.81
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 99.8
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 99.76
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 99.76
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 99.69
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 99.64
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 99.63
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 99.62
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 99.61
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 99.61
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 99.59
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 99.59
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 99.52
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 99.52
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 99.46
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 99.46
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 99.45
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 99.41
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 99.41
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 99.37
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 99.35
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 99.34
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 99.33
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 99.33
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 99.31
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 99.28
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 99.26
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 99.26
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 99.25
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 99.24
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 99.23
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 99.2
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 99.07
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 99.01
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 98.96
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 98.95
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 98.92
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 98.91
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 98.91
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 98.87
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 98.87
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 98.86
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 98.84
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 98.8
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 98.78
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 98.6
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 98.57
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 98.54
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 98.5
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 98.47
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 98.35
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 98.3
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 98.28
d2qy9a2211 GTPase domain of the signal recognition particle r 98.26
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 98.26
d1ls1a2207 GTPase domain of the signal sequence recognition p 98.18
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 98.17
d1vmaa2213 GTPase domain of the signal recognition particle r 98.16
d1j8yf2211 GTPase domain of the signal sequence recognition p 98.06
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.06
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 98.04
d1okkd2207 GTPase domain of the signal recognition particle r 98.02
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 97.98
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 97.95
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 97.94
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 97.88
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 97.85
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 97.83
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 97.81
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 97.74
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 97.73
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 97.65
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 97.62
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 97.6
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 97.59
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 97.59
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 97.53
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 97.51
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 97.47
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 97.47
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 97.46
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 97.44
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 97.42
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.4
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 97.4
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.39
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 97.35
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 97.34
d1svma_362 Papillomavirus large T antigen helicase domain {Si 97.32
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 97.32
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 97.3
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 97.28
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 97.28
d1kjwa2199 Guanylate kinase-like domain of Psd-95 {Rat (Rattu 97.24
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.22
d2axpa1164 Hypothetical protein YorR {Bacillus subtilis [TaxI 97.22
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.21
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 97.19
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 97.17
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 97.12
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 97.12
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 97.05
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 97.02
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 96.93
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 96.88
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 96.88
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 96.87
d2awna2232 Maltose transport protein MalK, N-terminal domain 96.87
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 96.86
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 96.86
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 96.86
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 96.85
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 96.84
d1g2912240 Maltose transport protein MalK, N-terminal domain 96.83
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 96.83
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 96.81
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 96.8
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 96.73
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 96.72
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.72
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 96.71
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 96.71
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 96.7
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 96.69
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 96.64
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 96.61
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 96.6
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 96.6
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 96.6
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 96.54
d2hyda1255 Putative multidrug export ATP-binding/permease pro 96.53
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 96.51
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 96.5
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 96.43
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 96.43
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 96.4
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 96.35
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 96.35
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 96.35
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 96.33
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 96.32
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 96.31
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 96.23
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 96.18
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 96.14
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 96.04
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 96.04
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 96.03
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.92
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.89
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 95.69
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.69
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 95.68
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 95.66
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.64
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 95.6
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 95.56
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 95.55
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.42
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 95.4
d1nrjb_209 Signal recognition particle receptor beta-subunit 95.36
d2fh5b1207 Signal recognition particle receptor beta-subunit 95.32
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 95.3
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 95.28
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 95.24
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 95.24
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.23
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 95.21
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 95.19
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 95.18
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 95.17
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.16
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 95.13
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 95.1
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 95.06
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 95.01
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 95.0
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 94.99
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.99
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 94.97
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 94.96
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 94.88
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 94.87
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 94.84
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 94.82
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 94.82
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 94.79
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 94.79
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 94.77
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 94.77
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 94.76
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 94.7
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 94.68
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 94.65
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 94.64
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 94.64
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 94.57
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 94.55
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 94.51
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 94.51
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 94.46
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 94.46
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 94.45
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 94.39
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 94.34
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 94.33
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 94.31
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 94.3
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 94.24
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 94.24
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 94.23
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 94.21
d1tuea_205 Replication protein E1 helicase domain {Human papi 94.18
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 94.13
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 94.04
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 94.03
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 94.02
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 94.01
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 93.96
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 93.86
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 93.84
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 93.82
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 93.78
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 93.69
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 93.58
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 93.53
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 93.46
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 93.43
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 93.34
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 93.32
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 93.25
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 93.22
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 93.16
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 93.02
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 92.84
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 92.67
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 92.61
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 92.54
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 92.5
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 92.39
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 92.35
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 92.15
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 92.07
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 92.07
d2olra1313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 92.04
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 91.98
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 91.91
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 91.81
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 91.79
d1ii2a1323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 91.67
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 91.33
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 91.3
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 91.23
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 91.07
d1j3ba1318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 90.98
d1xpua3289 Transcription termination factor Rho, ATPase domai 90.96
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 90.85
d1kk8a2 789 Myosin S1, motor domain {Bay scallop (Aequipecten 90.82
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 90.79
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 90.23
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 90.1
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 90.03
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 89.89
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 89.65
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 88.75
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 88.67
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 88.43
d1j6ua3207 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 87.22
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 87.15
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 86.77
d1e8ca3234 UDP-N-acetylmuramyl tripeptide synthetase MurE {Es 86.59
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 85.53
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 85.21
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 84.94
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 84.87
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 84.82
d1gg4a4214 UDP-murNac-tripeptide D-alanyl-D-alanine-adding en 84.6
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 83.9
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 83.85
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 83.18
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 82.75
d2jfga3204 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 82.43
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 82.28
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 81.33
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Adenosine-5'phosphosulfate kinase (APS kinase)
domain: Adenosine-5'phosphosulfate kinase (APS kinase)
species: Fungus (Penicillium chrysogenum) [TaxId: 5076]
Probab=100.00  E-value=1.1e-32  Score=230.44  Aligned_cols=186  Identities=47%  Similarity=0.826  Sum_probs=172.5

Q ss_pred             hhhhhcCCCCeEEEEEcCCCCCHHHHHHHHHHHHHH-cCCCEEEecCccccccccccCCCCHHHHHHHHHHHHHHHHHHH
Q psy17388         13 LRDFKEGQSNICLLFPGLSGAGKTSISFQIESYLIA-QGIPAYALDGDNLRNGINANLAFSEEDRNENVRRAAECAKMFA   91 (272)
Q Consensus        13 ~r~~~~~~~~~lI~l~G~~GsGKSTlAr~La~~L~~-~g~~~~~ld~D~i~~~l~~~~~~~~~~~~~~~~~i~~~~~~~~   91 (272)
                      .|..+.+++|.+|||+|+|||||||+|++|+++|.. .++++.++|+|.+|..+..+.+|+..++...+.++..++..+.
T Consensus        15 ~r~~~~~~kg~vIwltGlsGsGKTTia~~L~~~l~~~~~~~~~~ldgD~iR~~l~~~l~ys~~~r~~~~~r~~~~a~~~~   94 (208)
T d1m7ga_          15 ERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFA   94 (208)
T ss_dssp             HHHHHHTSSCEEEEEECSTTSSHHHHHHHHHHHHHHHHCCCEEEECHHHHTTTTTTTCCSSHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHhCCCCeEEEEECCCCCCHHHHHHHHHHHHHHhcCceEEEEcchHHHHhhcCCCCCChhHHHHHHHHHHHHHHHHh
Confidence            467888899999999999999999999999988854 5778999999999999988899999999999999999999999


Q ss_pred             hCCCeEEEcCCCCcHHHHHHHHHHHH------hCCCceEEEEEeCCHHHHHHhhhhhhhhhhhhccccccccccccCCCC
Q psy17388         92 ECGFIALCSFVSPTAAARDRAREIHR------NANLEFFEVFVNTPVEICEQRDVKGHYKKAREGKIKSFTGVSQPYEAP  165 (272)
Q Consensus        92 ~~g~~VI~d~~~~~~~~r~~~~~~~~------~~g~~~~~V~L~~~~e~~~~Rl~~r~~~~~r~~~~~~~~~~~~~ye~~  165 (272)
                      .+|..||++.+++....|+.++++..      ..+.+++.|||+||.++|.+|..++.|.+...+.+.++.+++..|++|
T Consensus        95 ~~g~~viv~~i~~~~~~R~~~r~i~~~~~~~~~~~~~~~eVyv~~~le~~~~Rd~k~~y~~~~~~~~~~~~gvd~~ye~P  174 (208)
T d1m7ga_          95 DSNSIAITSFISPYRKDRDTARQLHEVATPGEETGLPFVEVYVDVPVEVAEQRDPKGLYKKAREGVIKEFTGISAPYEAP  174 (208)
T ss_dssp             HTTCEEEEECCCCCHHHHHHHHHHHHCCCTTCSCCCCEEEEEEECCHHHHHTSCTTCHHHHHHHTSSSSCBTTTBCCCCC
T ss_pred             ccCCceeeecccccHHHHHHHHHHhhhhccchhcCCceEEEEEcCCHHHHHHhhcccchhhhhcCcccceecccccCCCC
Confidence            99999999999999999999988763      356789999999999999999999999998888888999999999999


Q ss_pred             CCCcEEEeCCCCCHHHHHHHHHHHHHhCCCCCC
Q psy17388        166 KNPDLILETVNVPVEKCANSVLDMIAAKGLIPA  198 (272)
Q Consensus       166 ~~~~~~Idt~~~~~ee~~~~I~~~L~~~~~~~~  198 (272)
                      ..++++|||+..++++++++|++.|.++|+||+
T Consensus       175 ~~~dl~Idt~~~s~~e~~~~Ii~~L~~~~~i~~  207 (208)
T d1m7ga_         175 ANPEVHVKNYELPVQDAVKQIIDYLDTKGYLPA  207 (208)
T ss_dssp             SSCSEEEECSSSCHHHHHHHHHHHHHHTTCSCC
T ss_pred             CCCcEEEeCCCCCHHHHHHHHHHHHHHcCCCCC
Confidence            999999999999999999999999999999986



>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8fa1 b.122.1.3 (A:2-168) ATP sulfurylase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m8pa1 b.122.1.3 (A:1-170) ATP sulfurylase N-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1x6va1 b.122.1.3 (A:229-389) ATP sulfurylase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jhda1 b.122.1.3 (A:1-173) ATP sulfurylase N-terminal domain {Sulfur-oxidizing endosymbiont of Riftia pachyptila [TaxId: 35843]} Back     information, alignment and structure
>d1v47a1 b.122.1.3 (A:4-135) ATP sulfurylase N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2axpa1 c.37.1.1 (A:2-165) Hypothetical protein YorR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1j6ua3 c.72.2.1 (A:89-295) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1e8ca3 c.72.2.1 (A:104-337) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1gg4a4 c.72.2.1 (A:99-312) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2jfga3 c.72.2.1 (A:94-297) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure