Psyllid ID: psy17388
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 272 | ||||||
| 322787112 | 420 | hypothetical protein SINV_15899 [Solenop | 0.904 | 0.585 | 0.546 | 3e-80 | |
| 91094931 | 627 | PREDICTED: similar to AGAP001256-PA [Tri | 0.996 | 0.432 | 0.494 | 4e-79 | |
| 242024762 | 623 | adenylsulfate kinase, putative [Pediculu | 0.937 | 0.409 | 0.519 | 7e-79 | |
| 307188360 | 574 | Bifunctional 3'-phosphoadenosine 5'-phos | 0.889 | 0.421 | 0.568 | 9e-79 | |
| 328701022 | 668 | PREDICTED: bifunctional 3'-phosphoadenos | 0.911 | 0.371 | 0.518 | 9e-78 | |
| 307192124 | 631 | Bifunctional 3'-phosphoadenosine 5'-phos | 0.930 | 0.400 | 0.52 | 3e-77 | |
| 195427547 | 658 | GK16974 [Drosophila willistoni] gi|19415 | 0.897 | 0.370 | 0.518 | 9e-77 | |
| 195020256 | 629 | GH14663 [Drosophila grimshawi] gi|193898 | 0.897 | 0.387 | 0.503 | 1e-76 | |
| 195128587 | 629 | GI11647 [Drosophila mojavensis] gi|19392 | 0.897 | 0.387 | 0.511 | 2e-76 | |
| 332025515 | 631 | Bifunctional 3'-phosphoadenosine 5'-phos | 0.889 | 0.383 | 0.537 | 2e-76 |
| >gi|322787112|gb|EFZ13333.1| hypothetical protein SINV_15899 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
Score = 304 bits (778), Expect = 3e-80, Method: Compositional matrix adjust.
Identities = 147/269 (54%), Positives = 191/269 (71%), Gaps = 23/269 (8%)
Query: 25 LLFPGLSGAGKTSISFQIESYLIAQGIPAYALDGDNLRNGINANLAFSEEDRNENVRRAA 84
+ GLSGAGKTSISFQ+E YL++QGIP Y+LDGDN+R G+N NL FS+EDR ENVRR A
Sbjct: 30 IWMTGLSGAGKTSISFQLEEYLVSQGIPTYSLDGDNMRTGLNRNLGFSKEDRKENVRRVA 89
Query: 85 ECAKMFAECGFIALCSFVSPTAAARDRAREIHRNANLEFFEVFVNTPVEICEQRDVKGHY 144
E A++FA+ G I LCSFVSP AA R AREIH NANL FFEVF+N +++CE RDVKG Y
Sbjct: 90 EVARLFADAGIITLCSFVSPFAADRKMAREIHENANLPFFEVFINASLQVCEARDVKGLY 149
Query: 145 KKAREGKIKSFTGVSQPYEAPKNPDLILETVNVPVEKCANSVLDMIAAKGLIPA----RQ 200
KKAR+G IK FTG+ Q Y+ P PDL+++T N +E+ + V++ + K ++P +Q
Sbjct: 150 KKARQGIIKGFTGIDQSYDVPTEPDLVVDTENATIEQSTDIVINFLQLKQIVPKACLLKQ 209
Query: 201 FFFIE----------------ALPRLDIGVIDLQWVQVIAEGWSSPLKGFMREDEFLKTI 244
F F+E LP L IG +D+QW+QV+AEGW++PLKGFMRE+E+L+
Sbjct: 210 FPFLELFVEEDRLDDVRKEMKTLPTLKIGKVDVQWLQVLAEGWAAPLKGFMRENEYLQVQ 269
Query: 245 HFNTLDSN---VNQSVAIVLAVTGEDKQR 270
HFN L N +NQS+ IVLAV+ DK+R
Sbjct: 270 HFNCLYENGVTINQSIPIVLAVSTVDKER 298
|
Source: Solenopsis invicta Species: Solenopsis invicta Genus: Solenopsis Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|91094931|ref|XP_970563.1| PREDICTED: similar to AGAP001256-PA [Tribolium castaneum] gi|270016688|gb|EFA13134.1| hypothetical protein TcasGA2_TC010318 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|242024762|ref|XP_002432795.1| adenylsulfate kinase, putative [Pediculus humanus corporis] gi|212518304|gb|EEB20057.1| adenylsulfate kinase, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|307188360|gb|EFN73135.1| Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|328701022|ref|XP_003241462.1| PREDICTED: bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|307192124|gb|EFN75452.1| Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|195427547|ref|XP_002061838.1| GK16974 [Drosophila willistoni] gi|194157923|gb|EDW72824.1| GK16974 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|195020256|ref|XP_001985157.1| GH14663 [Drosophila grimshawi] gi|193898639|gb|EDV97505.1| GH14663 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|195128587|ref|XP_002008744.1| GI11647 [Drosophila mojavensis] gi|193920353|gb|EDW19220.1| GI11647 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|332025515|gb|EGI65678.1| Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 272 | ||||||
| FB|FBgn0020389 | 657 | Papss "PAPS synthetase" [Droso | 0.665 | 0.275 | 0.532 | 1.4e-72 | |
| UNIPROTKB|Q90XY2 | 613 | Q90XY2 "3'-phosphoadenosine 5' | 0.639 | 0.283 | 0.531 | 6e-70 | |
| MGI|MGI:1330587 | 624 | Papss1 "3'-phosphoadenosine 5' | 0.658 | 0.286 | 0.513 | 9.8e-70 | |
| UNIPROTKB|O43252 | 624 | PAPSS1 "Bifunctional 3'-phosph | 0.658 | 0.286 | 0.513 | 2.6e-69 | |
| UNIPROTKB|Q3T0J0 | 624 | PAPSS1 "Uncharacterized protei | 0.658 | 0.286 | 0.513 | 2.6e-69 | |
| UNIPROTKB|E2QZ13 | 625 | PAPSS1 "Uncharacterized protei | 0.658 | 0.286 | 0.513 | 3.3e-69 | |
| UNIPROTKB|F1N085 | 568 | PAPSS2 "Uncharacterized protei | 0.621 | 0.297 | 0.520 | 4.2e-69 | |
| ZFIN|ZDB-GENE-010323-5 | 614 | papss2b "3'-phosphoadenosine 5 | 0.621 | 0.275 | 0.532 | 8.7e-69 | |
| UNIPROTKB|E7ER89 | 618 | PAPSS2 "Sulfate adenylyltransf | 0.621 | 0.273 | 0.520 | 8.7e-69 | |
| UNIPROTKB|O95340 | 614 | PAPSS2 "Bifunctional 3'-phosph | 0.621 | 0.275 | 0.520 | 8.7e-69 |
| FB|FBgn0020389 Papss "PAPS synthetase" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 540 (195.1 bits), Expect = 1.4e-72, Sum P(2) = 1.4e-72
Identities = 97/182 (53%), Positives = 138/182 (75%)
Query: 29 GLSGAGKTSISFQIESYLIAQGIPAYALDGDNLRNGINANLAFSEEDRNENVRRAAECAK 88
GLSGAGKTSI+F++E+YL+++GIPAY LDGDN+R G+N NL F+ DR EN+RR E AK
Sbjct: 81 GLSGAGKTSIAFELEAYLVSRGIPAYGLDGDNIRTGLNKNLGFTPADREENIRRVGEVAK 140
Query: 89 MFAECGFIALCSFVSPTAAARDRAREIHRNANLEFFEVFVNTPVEICEQRDVKGHYKKAR 148
+FA+ G +A+CSFVSP A R+ AR+IH++A L+F+E+FV+TP+++CE RDVKG YKKAR
Sbjct: 141 LFADSGVVAICSFVSPFADDREMARKIHKDAGLKFYEIFVDTPLDVCETRDVKGLYKKAR 200
Query: 149 EGKIKSFTGVSQPYEAPKNPDLILETVNVPVEKCANSVLDMIAAKGLIPARQFFFIEALP 208
EG IK FTG++Q YE P+ P+L++ T V + ++ ++ +G+IP R ++ LP
Sbjct: 201 EGVIKGFTGITQEYERPQMPELVVNTHGYTVRESTQKLVTLLEQEGIIP-RSLRDVDLLP 259
Query: 209 RL 210
L
Sbjct: 260 EL 261
|
|
| UNIPROTKB|Q90XY2 Q90XY2 "3'-phosphoadenosine 5'-phosphosulfate synthase 2" [Takifugu rubripes (taxid:31033)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1330587 Papss1 "3'-phosphoadenosine 5'-phosphosulfate synthase 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O43252 PAPSS1 "Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3T0J0 PAPSS1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QZ13 PAPSS1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N085 PAPSS2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-010323-5 papss2b "3'-phosphoadenosine 5'-phosphosulfate synthase 2b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7ER89 PAPSS2 "Sulfate adenylyltransferase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O95340 PAPSS2 "Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 272 | |||
| cd02027 | 149 | cd02027, APSK, Adenosine 5'-phosphosulfate kinase | 3e-80 | |
| pfam01583 | 157 | pfam01583, APS_kinase, Adenylylsulphate kinase | 9e-80 | |
| COG0529 | 197 | COG0529, CysC, Adenylylsulfate kinase and related | 1e-77 | |
| PRK05506 | 632 | PRK05506, PRK05506, bifunctional sulfate adenylylt | 4e-74 | |
| PRK03846 | 198 | PRK03846, PRK03846, adenylylsulfate kinase; Provis | 9e-68 | |
| TIGR00455 | 184 | TIGR00455, apsK, adenylylsulfate kinase (apsK) | 4e-66 | |
| PRK00889 | 175 | PRK00889, PRK00889, adenylylsulfate kinase; Provis | 3e-54 | |
| PRK05537 | 568 | PRK05537, PRK05537, bifunctional sulfate adenylylt | 4e-51 | |
| cd00517 | 353 | cd00517, ATPS, ATP-sulfurylase | 5e-19 | |
| pfam14306 | 159 | pfam14306, PUA_2, PUA-like domain | 1e-18 | |
| PRK05541 | 176 | PRK05541, PRK05541, adenylylsulfate kinase; Provis | 2e-17 | |
| TIGR00339 | 383 | TIGR00339, sopT, ATP sulphurylase | 3e-12 | |
| pfam13671 | 143 | pfam13671, AAA_33, AAA domain | 1e-05 | |
| cd02021 | 150 | cd02021, GntK, Gluconate kinase (GntK) catalyzes t | 5e-05 | |
| PRK04149 | 391 | PRK04149, sat, sulfate adenylyltransferase; Review | 6e-05 |
| >gnl|CDD|238985 cd02027, APSK, Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
Score = 238 bits (609), Expect = 3e-80
Identities = 81/151 (53%), Positives = 109/151 (72%), Gaps = 2/151 (1%)
Query: 24 CLLFPGLSGAGKTSISFQIESYLIAQGIPAYALDGDNLRNGINANLAFSEEDRNENVRRA 83
+ GLSG+GK++I+ +E L +G P Y LDGDN+R+G+N +L FS EDR EN+RR
Sbjct: 1 VIWLTGLSGSGKSTIARALEEKLFQRGRPVYVLDGDNVRHGLNKDLGFSREDREENIRRI 60
Query: 84 AECAKMFAECGFIALCSFVSPTAAARDRAREIHRNANLEFFEVFVNTPVEICEQRDVKGH 143
AE AK+ A+ G I + +F+SP R+ AR+I +F EVFV+TP+E+CEQRD KG
Sbjct: 61 AEVAKLLADAGLIVIAAFISPYREDREAARKII--GGGDFLEVFVDTPLEVCEQRDPKGL 118
Query: 144 YKKAREGKIKSFTGVSQPYEAPKNPDLILET 174
YKKAR G+IK FTG+ PYEAP+NPDL+L+T
Sbjct: 119 YKKARAGEIKGFTGIDDPYEAPENPDLVLDT 149
|
The end-product PAPS is a biologically "activated" sulfate form important for the assimilation of inorganic sulfate. Length = 149 |
| >gnl|CDD|216586 pfam01583, APS_kinase, Adenylylsulphate kinase | Back alignment and domain information |
|---|
| >gnl|CDD|223603 COG0529, CysC, Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|180120 PRK05506, PRK05506, bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179661 PRK03846, PRK03846, adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129547 TIGR00455, apsK, adenylylsulfate kinase (apsK) | Back alignment and domain information |
|---|
| >gnl|CDD|179157 PRK00889, PRK00889, adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180124 PRK05537, PRK05537, bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|173895 cd00517, ATPS, ATP-sulfurylase | Back alignment and domain information |
|---|
| >gnl|CDD|206474 pfam14306, PUA_2, PUA-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|235498 PRK05541, PRK05541, adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|232928 TIGR00339, sopT, ATP sulphurylase | Back alignment and domain information |
|---|
| >gnl|CDD|222307 pfam13671, AAA_33, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|238979 cd02021, GntK, Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >gnl|CDD|235227 PRK04149, sat, sulfate adenylyltransferase; Reviewed | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 272 | |||
| KOG4238|consensus | 627 | 100.0 | ||
| COG0529 | 197 | CysC Adenylylsulfate kinase and related kinases [I | 100.0 | |
| KOG0635|consensus | 207 | 100.0 | ||
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 100.0 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 99.94 | |
| TIGR00455 | 184 | apsK adenylylsulfate kinase (apsK). Important resi | 99.94 | |
| PF14306 | 160 | PUA_2: PUA-like domain; PDB: 1M8P_C 1I2D_B 2OFW_G | 99.94 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 99.93 | |
| PRK05537 | 568 | bifunctional sulfate adenylyltransferase subunit 1 | 99.92 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 99.91 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 99.89 | |
| PRK04149 | 391 | sat sulfate adenylyltransferase; Reviewed | 99.88 | |
| cd00517 | 353 | ATPS ATP-sulfurylase. ATP-sulfurylase (ATPS), also | 99.87 | |
| TIGR00339 | 383 | sopT ATP sulphurylase. Members of this family also | 99.87 | |
| COG2046 | 397 | MET3 ATP sulfurylase (sulfate adenylyltransferase) | 99.87 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 99.86 | |
| PRK05537 | 568 | bifunctional sulfate adenylyltransferase subunit 1 | 99.84 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 99.83 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 99.82 | |
| PF07931 | 174 | CPT: Chloramphenicol phosphotransferase-like prote | 99.79 | |
| COG3265 | 161 | GntK Gluconate kinase [Carbohydrate transport and | 99.78 | |
| KOG3354|consensus | 191 | 99.78 | ||
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 99.77 | |
| COG0703 | 172 | AroK Shikimate kinase [Amino acid transport and me | 99.74 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 99.72 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 99.7 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 99.7 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 99.7 | |
| PRK13948 | 182 | shikimate kinase; Provisional | 99.7 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 99.69 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 99.67 | |
| PRK11545 | 163 | gntK gluconate kinase 1; Provisional | 99.67 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 99.65 | |
| COG0645 | 170 | Predicted kinase [General function prediction only | 99.63 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 99.63 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 99.62 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 99.61 | |
| PRK09825 | 176 | idnK D-gluconate kinase; Provisional | 99.6 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 99.58 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 99.56 | |
| PLN02199 | 303 | shikimate kinase | 99.55 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 99.54 | |
| TIGR03575 | 340 | selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti | 99.54 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 99.54 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 99.53 | |
| PRK04182 | 180 | cytidylate kinase; Provisional | 99.53 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 99.53 | |
| PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 99.51 | |
| PRK03839 | 180 | putative kinase; Provisional | 99.51 | |
| PRK14021 | 542 | bifunctional shikimate kinase/3-dehydroquinate syn | 99.49 | |
| PRK13973 | 213 | thymidylate kinase; Provisional | 99.49 | |
| PLN02924 | 220 | thymidylate kinase | 99.48 | |
| PRK00698 | 205 | tmk thymidylate kinase; Validated | 99.46 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 99.45 | |
| TIGR02173 | 171 | cyt_kin_arch cytidylate kinase, putative. Proteins | 99.45 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 99.44 | |
| PF01202 | 158 | SKI: Shikimate kinase; InterPro: IPR000623 Shikima | 99.44 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 99.44 | |
| COG0125 | 208 | Tmk Thymidylate kinase [Nucleotide transport and m | 99.43 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 99.43 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 99.43 | |
| PRK13477 | 512 | bifunctional pantoate ligase/cytidylate kinase; Pr | 99.41 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 99.4 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 99.4 | |
| PRK13975 | 196 | thymidylate kinase; Provisional | 99.39 | |
| COG0283 | 222 | Cmk Cytidylate kinase [Nucleotide transport and me | 99.39 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 99.39 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 99.38 | |
| PRK06217 | 183 | hypothetical protein; Validated | 99.38 | |
| PRK05416 | 288 | glmZ(sRNA)-inactivating NTPase; Provisional | 99.36 | |
| COG3896 | 205 | Chloramphenicol 3-O-phosphotransferase [Defense me | 99.34 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 99.33 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 99.33 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 99.32 | |
| KOG3062|consensus | 281 | 99.32 | ||
| PRK13976 | 209 | thymidylate kinase; Provisional | 99.31 | |
| PRK07933 | 213 | thymidylate kinase; Validated | 99.29 | |
| PLN02200 | 234 | adenylate kinase family protein | 99.28 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 99.28 | |
| COG4639 | 168 | Predicted kinase [General function prediction only | 99.27 | |
| PF06414 | 199 | Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e | 99.27 | |
| PRK13951 | 488 | bifunctional shikimate kinase/3-dehydroquinate syn | 99.25 | |
| PRK08356 | 195 | hypothetical protein; Provisional | 99.23 | |
| PRK00023 | 225 | cmk cytidylate kinase; Provisional | 99.21 | |
| TIGR00017 | 217 | cmk cytidylate kinase. This family consists of cyt | 99.21 | |
| PRK13974 | 212 | thymidylate kinase; Provisional | 99.21 | |
| PRK12339 | 197 | 2-phosphoglycerate kinase; Provisional | 99.2 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 99.19 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 99.18 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 99.18 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 99.17 | |
| PRK11860 | 661 | bifunctional 3-phosphoshikimate 1-carboxyvinyltran | 99.17 | |
| PRK12338 | 319 | hypothetical protein; Provisional | 99.17 | |
| PF02223 | 186 | Thymidylate_kin: Thymidylate kinase; InterPro: IPR | 99.15 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 99.14 | |
| PRK14730 | 195 | coaE dephospho-CoA kinase; Provisional | 99.13 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 99.13 | |
| PRK00081 | 194 | coaE dephospho-CoA kinase; Reviewed | 99.11 | |
| PRK06696 | 223 | uridine kinase; Validated | 99.11 | |
| cd02030 | 219 | NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO | 99.11 | |
| PRK13808 | 333 | adenylate kinase; Provisional | 99.1 | |
| PF03668 | 284 | ATP_bind_2: P-loop ATPase protein family; InterPro | 99.1 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 99.1 | |
| KOG3347|consensus | 176 | 99.1 | ||
| cd01673 | 193 | dNK Deoxyribonucleoside kinase (dNK) catalyzes the | 99.09 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 99.08 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 99.08 | |
| TIGR00152 | 188 | dephospho-CoA kinase. This model produces scores i | 99.06 | |
| PRK14733 | 204 | coaE dephospho-CoA kinase; Provisional | 99.06 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 99.06 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 99.06 | |
| COG1428 | 216 | Deoxynucleoside kinases [Nucleotide transport and | 99.05 | |
| PRK06761 | 282 | hypothetical protein; Provisional | 99.05 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 99.04 | |
| PRK07667 | 193 | uridine kinase; Provisional | 99.03 | |
| PRK12269 | 863 | bifunctional cytidylate kinase/ribosomal protein S | 99.03 | |
| COG0237 | 201 | CoaE Dephospho-CoA kinase [Coenzyme metabolism] | 99.02 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 99.02 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 99.01 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 99.01 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 98.99 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 98.98 | |
| PRK14734 | 200 | coaE dephospho-CoA kinase; Provisional | 98.98 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 98.97 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 98.97 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 98.96 | |
| COG3709 | 192 | Uncharacterized component of phosphonate metabolis | 98.96 | |
| PRK14731 | 208 | coaE dephospho-CoA kinase; Provisional | 98.94 | |
| PTZ00451 | 244 | dephospho-CoA kinase; Provisional | 98.94 | |
| PLN02422 | 232 | dephospho-CoA kinase | 98.93 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 98.93 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 98.91 | |
| PLN02674 | 244 | adenylate kinase | 98.91 | |
| PF01591 | 222 | 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR0130 | 98.91 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 98.89 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 98.89 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 98.87 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 98.87 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 98.87 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 98.87 | |
| COG1660 | 286 | Predicted P-loop-containing kinase [General functi | 98.84 | |
| PRK14526 | 211 | adenylate kinase; Provisional | 98.84 | |
| PRK14732 | 196 | coaE dephospho-CoA kinase; Provisional | 98.82 | |
| PF00625 | 183 | Guanylate_kin: Guanylate kinase; InterPro: IPR0081 | 98.82 | |
| cd02022 | 179 | DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 | 98.79 | |
| PRK03333 | 395 | coaE dephospho-CoA kinase/protein folding accessor | 98.79 | |
| KOG3079|consensus | 195 | 98.78 | ||
| smart00072 | 184 | GuKc Guanylate kinase homologues. Active enzymes c | 98.78 | |
| PRK14529 | 223 | adenylate kinase; Provisional | 98.77 | |
| PRK12337 | 475 | 2-phosphoglycerate kinase; Provisional | 98.76 | |
| KOG3220|consensus | 225 | 98.73 | ||
| PF01121 | 180 | CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th | 98.73 | |
| PRK15453 | 290 | phosphoribulokinase; Provisional | 98.71 | |
| PLN02348 | 395 | phosphoribulokinase | 98.71 | |
| PLN02459 | 261 | probable adenylate kinase | 98.69 | |
| KOG0636|consensus | 466 | 98.68 | ||
| PLN02842 | 505 | nucleotide kinase | 98.68 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 98.67 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 98.66 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 98.64 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 98.62 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 98.61 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 98.61 | |
| PRK14490 | 369 | putative bifunctional molybdopterin-guanine dinucl | 98.58 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 98.58 | |
| PLN02772 | 398 | guanylate kinase | 98.53 | |
| PRK07429 | 327 | phosphoribulokinase; Provisional | 98.53 | |
| cd02029 | 277 | PRK_like Phosphoribulokinase-like (PRK-like) is a | 98.53 | |
| COG2074 | 299 | 2-phosphoglycerate kinase [Carbohydrate transport | 98.52 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 98.52 | |
| PHA03132 | 580 | thymidine kinase; Provisional | 98.48 | |
| PRK04220 | 301 | 2-phosphoglycerate kinase; Provisional | 98.48 | |
| PRK00091 | 307 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 98.38 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 98.33 | |
| PLN02318 | 656 | phosphoribulokinase/uridine kinase | 98.31 | |
| cd02026 | 273 | PRK Phosphoribulokinase (PRK) is an enzyme involve | 98.29 | |
| COG2019 | 189 | AdkA Archaeal adenylate kinase [Nucleotide transpo | 98.24 | |
| TIGR03707 | 230 | PPK2_P_aer polyphosphate kinase 2, PA0141 family. | 98.22 | |
| PF08303 | 168 | tRNA_lig_kinase: tRNA ligase kinase domain; InterP | 98.21 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 98.2 | |
| KOG4622|consensus | 291 | 98.15 | ||
| KOG3327|consensus | 208 | 98.13 | ||
| PF13189 | 179 | Cytidylate_kin2: Cytidylate kinase-like family; PD | 98.12 | |
| PLN02748 | 468 | tRNA dimethylallyltransferase | 98.09 | |
| COG1072 | 283 | CoaA Panthothenate kinase [Coenzyme metabolism] | 98.08 | |
| TIGR00174 | 287 | miaA tRNA isopentenyltransferase (miaA). Catalyzes | 98.07 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 98.06 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 98.04 | |
| TIGR03709 | 264 | PPK2_rel_1 polyphosphate:nucleotide phosphotransfe | 98.02 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 98.02 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 98.0 | |
| TIGR03708 | 493 | poly_P_AMP_trns polyphosphate:AMP phosphotransfera | 98.0 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 97.99 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 97.98 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 97.98 | |
| PLN02840 | 421 | tRNA dimethylallyltransferase | 97.96 | |
| KOG1384|consensus | 348 | 97.95 | ||
| PF03976 | 228 | PPK2: Polyphosphate kinase 2 (PPK2); InterPro: IPR | 97.95 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 97.95 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 97.95 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 97.93 | |
| KOG3877|consensus | 393 | 97.93 | ||
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 97.92 | |
| COG4185 | 187 | Uncharacterized protein conserved in bacteria [Fun | 97.92 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 97.92 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 97.92 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 97.91 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 97.9 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 97.88 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 97.88 | |
| PRK13768 | 253 | GTPase; Provisional | 97.87 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.86 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 97.82 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 97.81 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 97.81 | |
| KOG3308|consensus | 225 | 97.8 | ||
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 97.79 | |
| PRK09169 | 2316 | hypothetical protein; Validated | 97.77 | |
| COG0541 | 451 | Ffh Signal recognition particle GTPase [Intracellu | 97.74 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 97.72 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 97.72 | |
| KOG2134|consensus | 422 | 97.72 | ||
| PRK08727 | 233 | hypothetical protein; Validated | 97.72 | |
| cd02034 | 116 | CooC The accessory protein CooC, which contains a | 97.71 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 97.69 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 97.68 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 97.68 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 97.68 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 97.67 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 97.66 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 97.66 | |
| PLN03046 | 460 | D-glycerate 3-kinase; Provisional | 97.66 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 97.64 | |
| PF13173 | 128 | AAA_14: AAA domain | 97.64 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 97.61 | |
| KOG0744|consensus | 423 | 97.61 | ||
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 97.6 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 97.59 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 97.59 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 97.59 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 97.59 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 97.58 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 97.58 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 97.57 | |
| PRK08116 | 268 | hypothetical protein; Validated | 97.56 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 97.56 | |
| TIGR01223 | 182 | Pmev_kin_anim phosphomevalonate kinase, animal typ | 97.56 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 97.55 | |
| COG4240 | 300 | Predicted kinase [General function prediction only | 97.54 | |
| KOG1532|consensus | 366 | 97.54 | ||
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 97.54 | |
| PRK14729 | 300 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 97.54 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 97.53 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 97.53 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 97.52 | |
| COG1341 | 398 | Predicted GTPase or GTP-binding protein [General f | 97.52 | |
| PRK12377 | 248 | putative replication protein; Provisional | 97.51 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 97.51 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 97.5 | |
| KOG0733|consensus | 802 | 97.49 | ||
| COG0324 | 308 | MiaA tRNA delta(2)-isopentenylpyrophosphate transf | 97.49 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 97.49 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 97.47 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 97.47 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 97.47 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 97.47 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 97.46 | |
| cd03116 | 159 | MobB Molybdenum is an essential trace element in t | 97.46 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 97.46 | |
| cd03114 | 148 | ArgK-like The function of this protein family is u | 97.46 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 97.45 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 97.44 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 97.44 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 97.44 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 97.44 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 97.43 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 97.43 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 97.41 | |
| COG1763 | 161 | MobB Molybdopterin-guanine dinucleotide biosynthes | 97.41 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 97.41 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 97.41 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 97.4 | |
| KOG0780|consensus | 483 | 97.39 | ||
| PRK06893 | 229 | DNA replication initiation factor; Validated | 97.39 | |
| PF02367 | 123 | UPF0079: Uncharacterised P-loop hydrolase UPF0079; | 97.38 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 97.37 | |
| PRK14489 | 366 | putative bifunctional molybdopterin-guanine dinucl | 97.37 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 97.37 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 97.36 | |
| cd02033 | 329 | BchX Chlorophyllide reductase converts chlorophyll | 97.35 | |
| TIGR03708 | 493 | poly_P_AMP_trns polyphosphate:AMP phosphotransfera | 97.35 | |
| PRK14493 | 274 | putative bifunctional molybdopterin-guanine dinucl | 97.35 | |
| PRK09087 | 226 | hypothetical protein; Validated | 97.35 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 97.35 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 97.35 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 97.33 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 97.33 | |
| PRK08181 | 269 | transposase; Validated | 97.33 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 97.32 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 97.32 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 97.31 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 97.31 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 97.31 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 97.3 | |
| PRK06526 | 254 | transposase; Provisional | 97.3 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 97.29 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 97.29 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 97.29 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 97.29 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 97.29 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 97.29 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 97.29 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 97.28 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 97.28 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 97.28 | |
| PF01745 | 233 | IPT: Isopentenyl transferase; InterPro: IPR002648 | 97.28 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 97.28 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 97.28 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 97.28 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 97.27 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 97.27 | |
| PTZ00202 | 550 | tuzin; Provisional | 97.26 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 97.24 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.24 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 97.24 | |
| PF05729 | 166 | NACHT: NACHT domain | 97.23 | |
| KOG1533|consensus | 290 | 97.23 | ||
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 97.23 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 97.23 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 97.23 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 97.21 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 97.21 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 97.2 | |
| PRK14494 | 229 | putative molybdopterin-guanine dinucleotide biosyn | 97.2 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 97.19 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 97.19 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 97.18 | |
| KOG2004|consensus | 906 | 97.17 | ||
| KOG0738|consensus | 491 | 97.17 | ||
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 97.17 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 97.17 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 97.17 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 97.16 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 97.16 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 97.16 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 97.15 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 97.15 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 97.15 | |
| PRK13886 | 241 | conjugal transfer protein TraL; Provisional | 97.14 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 97.14 | |
| PHA02575 | 227 | 1 deoxynucleoside monophosphate kinase; Provisiona | 97.14 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 97.13 | |
| PRK06620 | 214 | hypothetical protein; Validated | 97.12 | |
| cd00550 | 254 | ArsA_ATPase Oxyanion-translocating ATPase (ArsA). | 97.12 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 97.11 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 97.11 | |
| cd02035 | 217 | ArsA ArsA ATPase functionas as an efflux pump loca | 97.11 | |
| KOG4235|consensus | 244 | 97.11 | ||
| KOG3078|consensus | 235 | 97.1 | ||
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 97.09 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 97.09 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 97.08 | |
| cd01918 | 149 | HprK_C HprK/P, the bifunctional histidine-containi | 97.08 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 97.08 | |
| TIGR01526 | 325 | nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr | 97.08 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 97.08 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 97.08 | |
| COG5192 | 1077 | BMS1 GTP-binding protein required for 40S ribosome | 97.08 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 97.08 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 97.07 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 97.07 | |
| PRK13695 | 174 | putative NTPase; Provisional | 97.06 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 97.05 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 97.05 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 97.05 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 97.05 | |
| PF01656 | 195 | CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai | 97.05 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 97.05 | |
| PF02492 | 178 | cobW: CobW/HypB/UreG, nucleotide-binding domain; I | 97.04 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 97.04 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 97.04 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 97.04 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 97.03 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 97.03 | |
| PRK10646 | 153 | ADP-binding protein; Provisional | 97.03 | |
| PRK08099 | 399 | bifunctional DNA-binding transcriptional repressor | 97.03 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 97.02 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 97.02 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 97.01 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 97.01 | |
| cd02037 | 169 | MRP-like MRP (Multiple Resistance and pH adaptatio | 97.0 | |
| cd02117 | 212 | NifH_like This family contains the NifH (iron prot | 97.0 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 96.99 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 96.98 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 96.98 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 96.98 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 96.98 | |
| COG0378 | 202 | HypB Ni2+-binding GTPase involved in regulation of | 96.97 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 96.97 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 96.96 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 96.96 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 96.96 | |
| cd02032 | 267 | Bchl_like This family of proteins contains bchL an | 96.95 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 96.95 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 96.95 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 96.94 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 96.94 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 96.94 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 96.94 | |
| COG3640 | 255 | CooC CO dehydrogenase maturation factor [Cell divi | 96.94 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 96.94 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 96.93 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 96.92 | |
| PHA02244 | 383 | ATPase-like protein | 96.91 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 96.91 | |
| COG3911 | 183 | Predicted ATPase [General function prediction only | 96.9 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 96.9 | |
| TIGR00101 | 199 | ureG urease accessory protein UreG. This model rep | 96.9 | |
| cd02036 | 179 | MinD Bacterial cell division requires the formatio | 96.89 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 96.89 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 96.89 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 96.88 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 96.87 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 96.87 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 96.86 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 96.85 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 96.85 | |
| KOG0730|consensus | 693 | 96.85 | ||
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 96.84 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 96.83 | |
| PF02224 | 157 | Cytidylate_kin: Cytidylate kinase; InterPro: IPR01 | 96.83 | |
| PRK05595 | 444 | replicative DNA helicase; Provisional | 96.83 | |
| TIGR01287 | 275 | nifH nitrogenase iron protein. This model describe | 96.82 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 96.82 | |
| PRK05748 | 448 | replicative DNA helicase; Provisional | 96.81 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 96.8 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 96.8 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 96.8 | |
| cd02040 | 270 | NifH NifH gene encodes component II (iron protein) | 96.8 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 96.78 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 96.78 | |
| PF01712 | 146 | dNK: Deoxynucleoside kinase; InterPro: IPR002624 T | 96.78 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 96.77 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 96.77 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 96.76 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 96.75 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 96.75 | |
| COG0802 | 149 | Predicted ATPase or kinase [General function predi | 96.75 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 96.73 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 96.73 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 96.73 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 96.73 | |
| PRK13764 | 602 | ATPase; Provisional | 96.73 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 96.72 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 96.72 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 96.71 | |
| PRK05636 | 505 | replicative DNA helicase; Provisional | 96.71 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 96.7 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 96.7 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 96.7 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 96.7 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 96.7 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 96.69 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 96.69 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 96.69 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 96.68 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 96.68 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 96.67 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 96.67 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 96.67 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 96.67 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 96.66 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 96.66 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 96.66 | |
| PRK08760 | 476 | replicative DNA helicase; Provisional | 96.65 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 96.65 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 96.65 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 96.64 | |
| PRK13185 | 270 | chlL protochlorophyllide reductase iron-sulfur ATP | 96.64 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 96.64 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 96.64 | |
| PF02374 | 305 | ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ | 96.64 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 96.63 | |
| PRK09165 | 497 | replicative DNA helicase; Provisional | 96.63 | |
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 96.63 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 96.63 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 96.63 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 96.62 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 96.62 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 96.62 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 96.62 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 96.62 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 96.62 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 96.61 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 96.61 | |
| TIGR02016 | 296 | BchX chlorophyllide reductase iron protein subunit | 96.61 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 96.6 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 96.6 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 96.6 | |
| PRK08506 | 472 | replicative DNA helicase; Provisional | 96.6 |
| >KOG4238|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=5e-52 Score=362.68 Aligned_cols=255 Identities=53% Similarity=0.969 Sum_probs=245.7
Q ss_pred cCCCCeEEEEEcCCCCCHHHHHHHHHHHHHHcCCCEEEecCccccccccccCCCCHHHHHHHHHHHHHHHHHHHhCCCeE
Q psy17388 18 EGQSNICLLFPGLSGAGKTSISFQIESYLIAQGIPAYALDGDNLRNGINANLAFSEEDRNENVRRAAECAKMFAECGFIA 97 (272)
Q Consensus 18 ~~~~~~lI~l~G~~GsGKSTlAr~La~~L~~~g~~~~~ld~D~i~~~l~~~~~~~~~~~~~~~~~i~~~~~~~~~~g~~V 97 (272)
.+.++..||++|++|+||||++-+|.+.|...|++++.+|+|++|.++.++++|++++|++.+++++++++.+.++|.++
T Consensus 46 ~gfrgctvw~tglsgagkttis~ale~~l~~~gipcy~ldgdnirhgl~knlgfs~edreenirriaevaklfadaglvc 125 (627)
T KOG4238|consen 46 GGFRGCTVWLTGLSGAGKTTISFALEEYLVSHGIPCYSLDGDNIRHGLNKNLGFSPEDREENIRRIAEVAKLFADAGLVC 125 (627)
T ss_pred CCccceeEEeeccCCCCcceeehHHHHHHHhcCCcccccCcchhhhhhhhccCCCchhHHHHHHHHHHHHHHHhcCCcee
Confidence 44689999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEcCCCCcHHHHHHHHHHHHhCCCceEEEEEeCCHHHHHHhhhhhhhhhhhhccccccccccccCCCCCCCcEEEeCCCC
Q psy17388 98 LCSFVSPTAAARDRAREIHRNANLEFFEVFVNTPVEICEQRDVKGHYKKAREGKIKSFTGVSQPYEAPKNPDLILETVNV 177 (272)
Q Consensus 98 I~d~~~~~~~~r~~~~~~~~~~g~~~~~V~L~~~~e~~~~Rl~~r~~~~~r~~~~~~~~~~~~~ye~~~~~~~~Idt~~~ 177 (272)
|.++++|+..+|...+++...++++|+.||++++.++|.+|..+.+|+++|.+++.+|+++++.||+|+.|+++++++..
T Consensus 126 itsfispf~~dr~~arkihe~~~l~f~ev~v~a~l~vceqrd~k~lykkaragei~gftgids~ye~pe~~e~vl~t~~~ 205 (627)
T KOG4238|consen 126 ITSFISPFAKDRENARKIHESAGLPFFEVFVDAPLNVCEQRDVKGLYKKARAGEIKGFTGIDSDYEKPETPERVLKTNLS 205 (627)
T ss_pred eehhcChhhhhhhhhhhhhcccCCceEEEEecCchhhhhhcChHHHHhhhhccccccccccccccCCCCChhHHhhcCCc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CHHHHHHHHHHHHHhCCCCCCch------hhh-----------hccCCceecCchhHHHHHHHhhccccCccCCCCHHHH
Q psy17388 178 PVEKCANSVLDMIAAKGLIPARQ------FFF-----------IEALPRLDIGVIDLQWVQVIAEGWSSPLKGFMREDEF 240 (272)
Q Consensus 178 ~~ee~~~~I~~~L~~~~~~~~~~------l~~-----------~~~~~~~~~~~~~~~~~~~~~~g~~~pl~gfm~~~~~ 240 (272)
++.+|++++++.|++++++|.+. ||| +.+||.+.|++.+++|+++||+||.+||+|||++.+|
T Consensus 206 ~v~~cvqqvve~lq~~~ivp~~~~~~v~elfv~e~~l~~~~~eae~lp~l~itkvdlqwvqvlaegwatpl~gfmrerey 285 (627)
T KOG4238|consen 206 TVSDCVQQVVELLQEQNIVPYTIIKDVHELFVPENKLDHVRAEAETLPSLSITKVDLQWVQVLAEGWATPLKGFMREREY 285 (627)
T ss_pred hHHHHHHHHHHHHHhcCCChhhhhHHHHHHcCCccHHHHHHhhhccCCcceeeehhHHHHHHHHhhccccchhHHHHHHH
Confidence 99999999999999999999776 454 7889999999999999999999999999999999999
Q ss_pred HhhhhhcccCCC-------CccceeEEEecChhhhhhcC
Q psy17388 241 LKTIHFNTLDSN-------VNQSVAIVLAVTGEDKQRLE 272 (272)
Q Consensus 241 ~~v~~~~~l~~~-------~~~~~pi~l~~~~~~~~~~~ 272 (272)
.+|+|+-.|.|| ...||||||+++.|++.+||
T Consensus 286 lq~mhf~~lld~khaf~g~in~sipivl~~s~e~k~~le 324 (627)
T KOG4238|consen 286 LQVMHFDTLLDGKHAFDGVINMSIPIVLPVSAEDKTRLE 324 (627)
T ss_pred HHHhhhhhhhcccccccccccccccEEEecchhhhhccc
Confidence 999999999987 78999999999999999886
|
|
| >COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0635|consensus | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00455 apsK adenylylsulfate kinase (apsK) | Back alignment and domain information |
|---|
| >PF14306 PUA_2: PUA-like domain; PDB: 1M8P_C 1I2D_B 2OFW_G 1X6V_B 1XNJ_A 1XJQ_B 2QJF_A 2OFX_B 1J70_B 1G8F_A | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >PRK04149 sat sulfate adenylyltransferase; Reviewed | Back alignment and domain information |
|---|
| >cd00517 ATPS ATP-sulfurylase | Back alignment and domain information |
|---|
| >TIGR00339 sopT ATP sulphurylase | Back alignment and domain information |
|---|
| >COG2046 MET3 ATP sulfurylase (sulfate adenylyltransferase) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae | Back alignment and domain information |
|---|
| >COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3354|consensus | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK11545 gntK gluconate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0645 Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09825 idnK D-gluconate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02199 shikimate kinase | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04182 cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK13973 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02924 thymidylate kinase | Back alignment and domain information |
|---|
| >PRK00698 tmk thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02173 cyt_kin_arch cytidylate kinase, putative | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >PRK13975 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional | Back alignment and domain information |
|---|
| >COG3896 Chloramphenicol 3-O-phosphotransferase [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3062|consensus | Back alignment and domain information |
|---|
| >PRK13976 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07933 thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG4639 Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] | Back alignment and domain information |
|---|
| >PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK08356 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00023 cmk cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00017 cmk cytidylate kinase | Back alignment and domain information |
|---|
| >PRK13974 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12339 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12338 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14730 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00081 coaE dephospho-CoA kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) | Back alignment and domain information |
|---|
| >PRK13808 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >KOG3347|consensus | Back alignment and domain information |
|---|
| >cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00152 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >PRK14733 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06761 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14734 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14731 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00451 dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02422 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02674 adenylate kinase | Back alignment and domain information |
|---|
| >PF01591 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR013079 6-Phosphofructo-2-kinase (2 | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >COG1660 Predicted P-loop-containing kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14526 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14732 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 | Back alignment and domain information |
|---|
| >cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 | Back alignment and domain information |
|---|
| >PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG3079|consensus | Back alignment and domain information |
|---|
| >smart00072 GuKc Guanylate kinase homologues | Back alignment and domain information |
|---|
| >PRK14529 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12337 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3220|consensus | Back alignment and domain information |
|---|
| >PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 | Back alignment and domain information |
|---|
| >PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >PLN02348 phosphoribulokinase | Back alignment and domain information |
|---|
| >PLN02459 probable adenylate kinase | Back alignment and domain information |
|---|
| >KOG0636|consensus | Back alignment and domain information |
|---|
| >PLN02842 nucleotide kinase | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >PLN02772 guanylate kinase | Back alignment and domain information |
|---|
| >PRK07429 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >PHA03132 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04220 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PLN02318 phosphoribulokinase/uridine kinase | Back alignment and domain information |
|---|
| >cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03707 PPK2_P_aer polyphosphate kinase 2, PA0141 family | Back alignment and domain information |
|---|
| >PF08303 tRNA_lig_kinase: tRNA ligase kinase domain; InterPro: IPR015966 This entry represents a kinase domain found in fungal tRNA ligases [] | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >KOG4622|consensus | Back alignment and domain information |
|---|
| >KOG3327|consensus | Back alignment and domain information |
|---|
| >PF13189 Cytidylate_kin2: Cytidylate kinase-like family; PDB: 3FDI_A | Back alignment and domain information |
|---|
| >PLN02748 tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR00174 miaA tRNA isopentenyltransferase (miaA) | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >TIGR03709 PPK2_rel_1 polyphosphate:nucleotide phosphotransferase, PPK2 family | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >TIGR03708 poly_P_AMP_trns polyphosphate:AMP phosphotransferase | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >PLN02840 tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >KOG1384|consensus | Back alignment and domain information |
|---|
| >PF03976 PPK2: Polyphosphate kinase 2 (PPK2); InterPro: IPR022488 This presumed domain is found in one or two copies per protein | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >KOG3877|consensus | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >COG4185 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >KOG3308|consensus | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >PRK09169 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >KOG2134|consensus | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PLN03046 D-glycerate 3-kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0744|consensus | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >TIGR01223 Pmev_kin_anim phosphomevalonate kinase, animal type | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >COG4240 Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1532|consensus | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >KOG0733|consensus | Back alignment and domain information |
|---|
| >COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >cd03114 ArgK-like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >KOG0780|consensus | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >cd02033 BchX Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring | Back alignment and domain information |
|---|
| >TIGR03708 poly_P_AMP_trns polyphosphate:AMP phosphotransferase | Back alignment and domain information |
|---|
| >PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >KOG1533|consensus | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >KOG2004|consensus | Back alignment and domain information |
|---|
| >KOG0738|consensus | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK13886 conjugal transfer protein TraL; Provisional | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PHA02575 1 deoxynucleoside monophosphate kinase; Provisional | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell | Back alignment and domain information |
|---|
| >KOG4235|consensus | Back alignment and domain information |
|---|
| >KOG3078|consensus | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK10646 ADP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >cd02032 Bchl_like This family of proteins contains bchL and chlL | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG3911 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >TIGR00101 ureG urease accessory protein UreG | Back alignment and domain information |
|---|
| >cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >KOG0730|consensus | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF02224 Cytidylate_kin: Cytidylate kinase; InterPro: IPR011994 Cytidylate kinase (2 | Back alignment and domain information |
|---|
| >PRK05595 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR01287 nifH nitrogenase iron protein | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05748 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF01712 dNK: Deoxynucleoside kinase; InterPro: IPR002624 This family consists of various deoxynucleoside kinases including cytidine (2 | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >COG0802 Predicted ATPase or kinase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK05636 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK08760 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >PRK09165 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >TIGR02016 BchX chlorophyllide reductase iron protein subunit X | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PRK08506 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 272 | ||||
| 1x6v_B | 630 | The Crystal Structure Of Human 3'-Phosphoadenosine- | 4e-74 | ||
| 2ofx_A | 207 | Crystal Structure Of The Apsk Domain Of Human Papss | 2e-53 | ||
| 2ofw_A | 208 | Crystal Structure Of The Apsk Domain Of Human Papss | 4e-53 | ||
| 2pey_A | 179 | Crystal Strucutre Of Deletion Mutant Of Aps-Kinase | 2e-52 | ||
| 2ax4_A | 198 | Crystal Structure Of The Kinase Domain Of Human 3'- | 4e-51 | ||
| 1d6j_A | 211 | Crystal Structure Of Adenosine 5'-Phosphosulfate (A | 2e-47 | ||
| 3cr7_A | 197 | Crystal Structure Of N-Terminal Truncation Of Aps K | 2e-47 | ||
| 3uie_A | 200 | Crystal Structure Of Adenosine 5'-Phosphosulfate Ki | 6e-35 | ||
| 2gks_A | 546 | Crystal Structure Of The Bi-Functional Atp Sulfuryl | 7e-33 | ||
| 2yvu_A | 186 | Crystal Structure Of Ape1195 Length = 186 | 3e-30 | ||
| 3cr8_A | 552 | Hexameric Aps Kinase From Thiobacillus Denitrifican | 7e-26 | ||
| 1m8p_A | 573 | Crystal Structure Of P. Chrysogenum Atp Sulfurylase | 7e-19 | ||
| 1i2d_A | 573 | Crystal Structure Of Atp Sulfurylase From Penicilli | 8e-19 | ||
| 2qjf_A | 405 | Crystal Structure Of Atp-Sulfurylase Domain Of Huma | 7e-17 |
| >pdb|1X6V|B Chain B, The Crystal Structure Of Human 3'-Phosphoadenosine-5'- Phosphosulfate Synthetase 1 Length = 630 | Back alignment and structure |
|
| >pdb|2OFX|A Chain A, Crystal Structure Of The Apsk Domain Of Human Papss1 In Complex With Adpmg And Paps Length = 207 | Back alignment and structure |
| >pdb|2OFW|A Chain A, Crystal Structure Of The Apsk Domain Of Human Papss1 Complexed With 2 Aps Molecules Length = 208 | Back alignment and structure |
| >pdb|2PEY|A Chain A, Crystal Strucutre Of Deletion Mutant Of Aps-Kinase Domain Of Human Paps-Synthetase 1 Length = 179 | Back alignment and structure |
| >pdb|2AX4|A Chain A, Crystal Structure Of The Kinase Domain Of Human 3'- Phosphoadenosine 5'-Phosphosulphate Synthetase 2 Length = 198 | Back alignment and structure |
| >pdb|1D6J|A Chain A, Crystal Structure Of Adenosine 5'-Phosphosulfate (Aps) Kinase From Penicillium Chrysogenum Length = 211 | Back alignment and structure |
| >pdb|3CR7|A Chain A, Crystal Structure Of N-Terminal Truncation Of Aps Kinase From Penicillium Chrysogenum: Ternary Structure With Adp And Paps Length = 197 | Back alignment and structure |
| >pdb|3UIE|A Chain A, Crystal Structure Of Adenosine 5'-Phosphosulfate Kinase From Arabidopsis Thaliana In Complex With Amppnp And Aps Length = 200 | Back alignment and structure |
| >pdb|2GKS|A Chain A, Crystal Structure Of The Bi-Functional Atp Sulfurylase-Aps Kinase From Aquifex Aeolicus, A Chemolithotrophic Thermophile Length = 546 | Back alignment and structure |
| >pdb|2YVU|A Chain A, Crystal Structure Of Ape1195 Length = 186 | Back alignment and structure |
| >pdb|3CR8|A Chain A, Hexameric Aps Kinase From Thiobacillus Denitrificans Length = 552 | Back alignment and structure |
| >pdb|1M8P|A Chain A, Crystal Structure Of P. Chrysogenum Atp Sulfurylase In The T-State Length = 573 | Back alignment and structure |
| >pdb|1I2D|A Chain A, Crystal Structure Of Atp Sulfurylase From Penicillium Chrysogenum Length = 573 | Back alignment and structure |
| >pdb|2QJF|A Chain A, Crystal Structure Of Atp-Sulfurylase Domain Of Human Paps Synthetase 1 Length = 405 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 272 | |||
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 1e-103 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 1e-94 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 2e-94 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 9e-92 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 3e-91 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 2e-72 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 1e-16 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 3e-67 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 2e-18 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 4e-66 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 8e-17 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 1e-24 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 6e-15 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 1e-12 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 6e-12 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 9e-11 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 3e-10 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 3e-10 | |
| 1r6x_A | 395 | ATP:sulfate adenylyltransferase; APS kinase-like d | 3e-10 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 1e-09 | |
| 1v47_A | 349 | ATP sulfurylase; product binding complex, zinc, ri | 1e-09 | |
| 1jhd_A | 396 | Sulfate adenylyltransferase; sulfurylase, APS, che | 2e-08 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 8e-08 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 4e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-06 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 9e-06 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 2e-05 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 4e-04 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 5e-04 |
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Length = 630 | Back alignment and structure |
|---|
Score = 312 bits (802), Expect = e-103
Identities = 131/275 (47%), Positives = 177/275 (64%), Gaps = 19/275 (6%)
Query: 17 KEGQSNICLLFPGLSGAGKTSISFQIESYLIAQGIPAYALDGDNLRNGINANLAFSEEDR 76
+ G + GLSGAGKT++S +E YL+ GIP Y LDGDN+R G+N NL FS EDR
Sbjct: 47 RGGFRGCTVWLTGLSGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDR 106
Query: 77 NENVRRAAECAKMFAECGFIALCSFVSPTAAARDRAREIHRNANLEFFEVFVNTPVEICE 136
ENVRR AE AK+FA+ G + + SF+SP R+ AR+IH A+L FFEVFV+ P+ +CE
Sbjct: 107 EENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCE 166
Query: 137 QRDVKGHYKKAREGKIKSFTGVSQPYEAPKNPDLILETVNVPVEKCANSVLDMIAAKGLI 196
QRDVKG YKKAR G+IK FTG+ YE P+ P+L+L+T + V C V++++ + ++
Sbjct: 167 QRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIV 226
Query: 197 P---------------ARQFFFIEA--LPRLDIGVIDLQWVQVIAEGWSSPLKGFMREDE 239
P +A LP L I +D+QWVQV+AEGW++PL GFMRE E
Sbjct: 227 PVDASYEVKELYVPENKLHLAKTDAETLPALKINKVDMQWVQVLAEGWATPLNGFMRERE 286
Query: 240 FLKTIHFNTL--DSNVNQSVAIVLAVTGEDKQRLE 272
+L+ +HF+ L +N SV IVL T EDK+RL+
Sbjct: 287 YLQCLHFDCLLDGGVINLSVPIVLTATHEDKERLD 321
|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Length = 179 | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Length = 186 | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} PDB: 4fxp_A* Length = 200 | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Length = 211 | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Length = 552 | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Length = 552 | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Length = 546 | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Length = 546 | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Length = 573 | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Length = 573 | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Length = 260 | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Length = 193 | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Length = 178 | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Length = 200 | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Length = 175 | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Length = 511 | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Length = 189 | Back alignment and structure |
|---|
| >1r6x_A ATP:sulfate adenylyltransferase; APS kinase-like domain; 1.40A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 Length = 395 | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Length = 191 | Back alignment and structure |
|---|
| >1v47_A ATP sulfurylase; product binding complex, zinc, riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; HET: ADX; 2.49A {Thermus thermophilus} SCOP: b.122.1.3 c.26.1.5 Length = 349 | Back alignment and structure |
|---|
| >1jhd_A Sulfate adenylyltransferase; sulfurylase, APS, chemoautotroph, bromide; 1.70A {Sulfur-oxidizing endosymbiont ofriftia pachyptila} SCOP: b.122.1.3 c.26.1.5 Length = 396 | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Length = 202 | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Length = 181 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Length = 301 | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} PDB: 2axp_A* Length = 173 | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Length = 183 | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Length = 469 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 272 | |||
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 100.0 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 99.94 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 99.94 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 99.93 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 99.93 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 99.93 | |
| 1r6x_A | 395 | ATP:sulfate adenylyltransferase; APS kinase-like d | 99.89 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 99.88 | |
| 1v47_A | 349 | ATP sulfurylase; product binding complex, zinc, ri | 99.87 | |
| 1jhd_A | 396 | Sulfate adenylyltransferase; sulfurylase, APS, che | 99.87 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 99.86 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 99.86 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 99.86 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 99.86 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 99.85 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 99.81 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 99.8 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 99.77 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 99.76 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 99.76 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 99.75 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 99.72 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 99.72 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 99.66 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 99.62 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 99.62 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 99.61 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 99.58 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 99.58 | |
| 3hdt_A | 223 | Putative kinase; structura genomics, PSI-2, protei | 99.57 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 99.57 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 99.56 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 99.56 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 99.56 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 99.55 | |
| 3fdi_A | 201 | Uncharacterized protein; cytidylate kinase like pr | 99.55 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 99.55 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 99.54 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 99.54 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 99.53 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 99.53 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 99.53 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 99.52 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 99.52 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 99.51 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 99.51 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 99.51 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 99.51 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 99.5 | |
| 4hlc_A | 205 | DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri | 99.5 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 99.49 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 99.49 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 99.49 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 99.49 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 99.49 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 99.47 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 99.47 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 99.47 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 99.46 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 99.45 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 99.45 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 99.45 | |
| 3hjn_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 99.44 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 99.43 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 99.43 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 99.42 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 99.42 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 99.41 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 99.41 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 99.4 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 99.4 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 99.39 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 99.39 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 99.39 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 99.38 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 99.35 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 99.34 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 99.34 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 99.33 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 99.33 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 99.31 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 99.31 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 99.3 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 99.28 | |
| 3tmk_A | 216 | Thymidylate kinase; phosphotransferase; HET: T5A; | 99.28 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 99.27 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 99.27 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 99.27 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 99.26 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 99.25 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 99.25 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 99.23 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 99.22 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 99.17 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 99.17 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 99.15 | |
| 4i1u_A | 210 | Dephospho-COA kinase; structural genomics, niaid, | 99.14 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 99.14 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 99.13 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 99.12 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 99.1 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 99.1 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 99.09 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 99.01 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 99.0 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 98.97 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 98.96 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 98.94 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 98.89 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 98.83 | |
| 3gmt_A | 230 | Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle | 98.78 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 98.78 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 98.73 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 98.72 | |
| 3ch4_B | 202 | Pmkase, phosphomevalonate kinase; parallel beta-sh | 98.71 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 98.7 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 98.67 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 98.67 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 98.67 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 98.67 | |
| 3czq_A | 304 | Putative polyphosphate kinase 2; structural genomi | 98.59 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 98.52 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 98.52 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 98.49 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 98.45 | |
| 1p6x_A | 334 | Thymidine kinase; P-loop, LID, transferase; HET: T | 98.43 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 98.4 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 98.31 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 98.26 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 98.22 | |
| 3czp_A | 500 | Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2 | 98.22 | |
| 1of1_A | 376 | Thymidine kinase; transferase, antiviral drug, enz | 98.19 | |
| 1e2k_A | 331 | Thymidine kinase; transferase, antiviral drug, enz | 98.16 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 98.13 | |
| 3czp_A | 500 | Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2 | 98.11 | |
| 1osn_A | 341 | Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, tra | 98.02 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 97.95 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 97.94 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 97.92 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 97.9 | |
| 3rhf_A | 289 | Putative polyphosphate kinase 2 family protein; PS | 97.88 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 97.86 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 97.84 | |
| 1dek_A | 241 | Deoxynucleoside monophosphate kinase; transferase, | 97.82 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 97.81 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 97.8 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 97.78 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 97.74 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 97.73 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 97.73 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 97.7 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 97.7 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 97.69 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 97.68 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 97.66 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 97.66 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 97.64 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 97.64 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 97.63 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 97.62 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 97.6 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 97.59 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 97.58 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 97.57 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 97.56 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 97.56 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 97.54 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 97.53 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 97.53 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 97.53 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 97.52 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 97.52 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 97.51 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 97.51 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 97.49 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 97.49 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 97.49 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 97.48 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 97.48 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 97.47 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 97.46 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.46 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 97.45 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 97.45 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 97.44 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 97.43 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 97.43 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 97.43 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 97.42 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 97.42 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 97.41 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 97.41 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 97.4 | |
| 3end_A | 307 | Light-independent protochlorophyllide reductase ir | 97.39 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 97.39 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 97.39 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 97.39 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 97.38 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 97.38 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 97.37 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 97.37 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 97.37 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 97.37 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 97.36 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 97.35 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 97.34 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 97.33 | |
| 3zq6_A | 324 | Putative arsenical pump-driving ATPase; tail-ancho | 97.33 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 97.32 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 97.31 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 97.3 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 97.3 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 97.29 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 97.29 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 97.29 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 97.29 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 97.28 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 97.28 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 97.27 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 97.26 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 97.25 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 97.24 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 97.24 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 97.24 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 97.24 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 97.23 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 97.23 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 97.22 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 97.21 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 97.21 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 97.2 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 97.2 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 97.2 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 97.18 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 97.18 | |
| 3cio_A | 299 | ETK, tyrosine-protein kinase ETK; WZC, escherichia | 97.17 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 97.17 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 97.16 | |
| 1kjw_A | 295 | Postsynaptic density protein 95; protein-protein i | 97.15 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 97.14 | |
| 3bfv_A | 271 | CAPA1, CAPB2, membrane protein CAPA1, protein tyro | 97.14 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 97.13 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 97.12 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 97.12 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 97.11 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.1 | |
| 3iqw_A | 334 | Tail-anchored protein targeting factor GET3; ATPas | 97.1 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 97.09 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 97.08 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 97.08 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 97.08 | |
| 3ug7_A | 349 | Arsenical pump-driving ATPase; tail-anchored, memb | 97.08 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 97.07 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 97.06 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 97.06 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 97.02 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 97.02 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 97.01 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 97.0 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 97.0 | |
| 2woo_A | 329 | ATPase GET3; tail-anchored, membrane protein, targ | 96.98 | |
| 3la6_A | 286 | Tyrosine-protein kinase WZC; P-loop protein, nucle | 96.97 | |
| 3kjh_A | 254 | CO dehydrogenase/acetyl-COA synthase complex, acce | 96.97 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 96.97 | |
| 2ph1_A | 262 | Nucleotide-binding protein; alpha-beta protein, st | 96.96 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 96.95 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 96.95 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 96.94 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 96.93 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 96.93 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 96.91 | |
| 2woj_A | 354 | ATPase GET3; tail-anchored, membrane protein, targ | 96.91 | |
| 3io3_A | 348 | DEHA2D07832P; chaperone, membrane traffic, ATPase; | 96.9 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 96.89 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 96.88 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 96.88 | |
| 2afh_E | 289 | Nitrogenase iron protein 1; nitrogen fixation, iro | 96.88 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 96.87 | |
| 1cp2_A | 269 | CP2, nitrogenase iron protein; oxidoreductase; 1.9 | 96.86 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 96.85 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 96.84 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 96.83 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 96.81 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 96.81 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 96.79 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 96.79 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 96.78 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 96.78 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 96.76 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 96.74 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 96.74 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 96.74 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 96.73 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 96.73 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 96.72 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 96.72 | |
| 1wcv_1 | 257 | SOJ, segregation protein; ATPase, bacterial, chrom | 96.72 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 96.71 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 96.71 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 96.7 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 96.69 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 96.69 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 96.68 | |
| 1g3q_A | 237 | MIND ATPase, cell division inhibitor; alpha-beta-a | 96.68 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 96.68 | |
| 4dzz_A | 206 | Plasmid partitioning protein PARF; deviant walker | 96.67 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 96.67 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 96.66 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 96.66 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 96.65 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 96.65 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 96.65 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 96.64 | |
| 3fkq_A | 373 | NTRC-like two-domain protein; RER070207001320, str | 96.63 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 96.63 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 96.62 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 96.62 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 96.61 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 96.61 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 96.6 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 96.6 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 96.59 | |
| 3tvt_A | 292 | Disks large 1 tumor suppressor protein; DLG, SRC-h | 96.59 | |
| 3q9l_A | 260 | Septum site-determining protein MIND; ATPase, bact | 96.59 | |
| 1hyq_A | 263 | MIND, cell division inhibitor (MIND-1); MINC, FTSZ | 96.58 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 96.58 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 96.58 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 96.57 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 96.57 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 96.57 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 96.56 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 96.56 | |
| 3ea0_A | 245 | ATPase, para family; alpha-beta-alpha sandwich, st | 96.55 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 96.55 | |
| 3k9g_A | 267 | PF-32 protein; ssgcid, SBRI, decode biostructures, | 96.53 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 96.53 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 96.52 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 96.51 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 96.5 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 96.49 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 96.49 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 96.48 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 96.47 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 96.46 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 96.42 | |
| 2oze_A | 298 | ORF delta'; para, walker type atpases, DNA segrega | 96.41 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 96.41 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 96.4 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 96.39 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 96.38 | |
| 3cwq_A | 209 | Para family chromosome partitioning protein; alpha | 96.36 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 96.36 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 96.35 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 96.34 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 96.34 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 96.34 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 96.33 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 96.32 | |
| 1byi_A | 224 | Dethiobiotin synthase; biotin synthesis, cyclo-lig | 96.32 | |
| 3fwy_A | 314 | Light-independent protochlorophyllide reductase I | 96.31 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 96.31 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 96.3 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 96.3 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 96.27 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 96.26 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 96.24 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 96.24 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 96.24 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 96.23 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 96.22 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 96.2 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 96.19 | |
| 2xj4_A | 286 | MIPZ; replication, cell division, ATPase, WACA; 1. | 96.18 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 96.17 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 96.16 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 96.16 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 96.14 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 96.12 | |
| 3qxc_A | 242 | Dethiobiotin synthetase; DTBS, structural genomics | 96.08 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 96.08 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 96.07 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 96.07 | |
| 1ko7_A | 314 | HPR kinase/phosphatase; protein kinase, phosphotra | 96.06 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 96.06 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 96.05 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 96.02 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 96.0 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 95.99 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 95.97 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 95.96 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 95.93 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 95.93 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 95.92 | |
| 3of5_A | 228 | Dethiobiotin synthetase; structural genomics, cent | 95.91 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 95.91 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 95.9 | |
| 1knx_A | 312 | Probable HPR(Ser) kinase/phosphatase; HPR kinase, | 95.87 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 95.85 | |
| 3ez2_A | 398 | Plasmid partition protein A; type IA, DNA binding, | 95.84 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 95.83 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 95.81 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 95.79 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 95.78 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 95.76 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 95.71 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 95.71 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 95.69 | |
| 3igf_A | 374 | ALL4481 protein; two-domained protein consisting o | 95.69 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 95.68 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 95.63 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 95.62 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 95.62 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 95.62 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 95.6 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 95.6 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 95.59 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 95.58 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 95.57 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 95.54 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 95.54 | |
| 3pg5_A | 361 | Uncharacterized protein; structural genomics, PSI- | 95.53 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 95.52 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 95.52 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 95.5 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 95.49 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 95.44 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 95.42 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 95.41 | |
| 3ez9_A | 403 | Para; DNA binding, winged-HTH, partition, biosynth | 95.41 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 95.4 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 95.39 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 95.38 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 95.36 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 95.36 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 95.35 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 95.34 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 95.34 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 95.3 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 95.3 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 95.29 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 95.29 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 95.29 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 95.27 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 95.26 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 95.25 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 95.24 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 95.21 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 95.21 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 95.18 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 95.18 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 95.17 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 95.17 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 95.17 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 95.14 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 95.14 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 95.14 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 95.12 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 95.11 | |
| 2q3h_A | 201 | RAS homolog gene family, member U; GTPase, structu | 95.11 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 95.09 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 95.09 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 95.09 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 95.08 | |
| 3fgn_A | 251 | Dethiobiotin synthetase; biotin biosynthesis, BIOD | 95.08 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 95.08 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 95.07 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 95.06 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 95.05 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 95.04 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 95.02 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 95.01 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 95.01 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 95.0 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 94.99 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 94.98 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 94.98 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 94.97 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 94.97 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 94.96 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 94.96 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 94.96 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 94.96 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 94.95 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 94.94 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 94.92 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 94.92 | |
| 1zcb_A | 362 | G alpha I/13; GTP-binding, lipoprotein, membrane, | 94.92 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 94.91 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 94.9 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 94.9 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 94.89 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 94.88 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 94.88 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 94.87 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 94.87 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 94.86 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 94.85 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 94.81 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 94.81 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 94.79 |
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=9e-53 Score=403.36 Aligned_cols=263 Identities=50% Similarity=0.934 Sum_probs=230.4
Q ss_pred cccchhhhhhhcCC----CCeEEEEEcCCCCCHHHHHHHHHHHHHHcCCCEEEecCccccccccccCCCCHHHHHHHHHH
Q psy17388 7 EGKESWLRDFKEGQ----SNICLLFPGLSGAGKTSISFQIESYLIAQGIPAYALDGDNLRNGINANLAFSEEDRNENVRR 82 (272)
Q Consensus 7 ~~~~~~~r~~~~~~----~~~lI~l~G~~GsGKSTlAr~La~~L~~~g~~~~~ld~D~i~~~l~~~~~~~~~~~~~~~~~ 82 (272)
++.++ |+.+.++ +|++|+|+|+|||||||+|++|+++|...|++++.+|+|.++..+..+.+|+..++.+++++
T Consensus 35 v~~~~--r~~~~~~~~~~~g~lIvLtGlsGSGKSTlAr~La~~L~~~G~~~v~lDgD~iR~~L~~~~~fs~~dree~~r~ 112 (630)
T 1x6v_B 35 VSRNK--RGQVVGTRGGFRGCTVWLTGLSGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRR 112 (630)
T ss_dssp CCHHH--HHHHSSSSSSCCCEEEEEECSTTSSHHHHHHHHHHHHHHTTCCEEEESHHHHTTTTTTTCCSSHHHHHHHHHH
T ss_pred CCHHH--HHHHhCCCccCCCCEEEEEeCCCCCHHHHHHHHHHHHHhcCCeEEEechHHhhhccCccccCChhhhHHHHHH
Confidence 44444 4555554 89999999999999999999999999888889999999999888776677887888889988
Q ss_pred HHHHHHHHHhCCCeEEEcCCCCcHHHHHHHHHHHHhCCCceEEEEEeCCHHHHHHhhhhhhhhhhhhccccccccccccC
Q psy17388 83 AAECAKMFAECGFIALCSFVSPTAAARDRAREIHRNANLEFFEVFVNTPVEICEQRDVKGHYKKAREGKIKSFTGVSQPY 162 (272)
Q Consensus 83 i~~~~~~~~~~g~~VI~d~~~~~~~~r~~~~~~~~~~g~~~~~V~L~~~~e~~~~Rl~~r~~~~~r~~~~~~~~~~~~~y 162 (272)
+.++++.++++|.+||+++.+++...++.+++++...+.++++|||+||++++.+|+.++.+++.|.+++..+..++..|
T Consensus 113 i~eva~~~l~~G~iVI~d~~s~~~~~r~~~r~ll~~~g~p~~vV~Ldap~Evl~~Rl~r~ly~~aR~~~~~~~~~~~~~Y 192 (630)
T 1x6v_B 113 IAEVAKLFADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEY 192 (630)
T ss_dssp HHHHHHHHHHTTCEEEEECCCCCHHHHHHHHHHHHTTTCCEEEEEEECCHHHHHHHCTTSHHHHHTTC----CBTTTBCC
T ss_pred HHHHHHHHHhCCCEEEEeCchhhHHHHHHHHHHHHhCCCCeEEEEEECCHHHHHHHhccccchhhhhhhHHHHHHhhhhh
Confidence 88888888899999999988887778889999888888889999999999999999988877777777666777788899
Q ss_pred CCCCCCcEEEeCCCCCHHHHHHHHHHHHHhCCCCCCch------hhh-----------hccCCceecCchhHHHHHHHhh
Q psy17388 163 EAPKNPDLILETVNVPVEKCANSVLDMIAAKGLIPARQ------FFF-----------IEALPRLDIGVIDLQWVQVIAE 225 (272)
Q Consensus 163 e~~~~~~~~Idt~~~~~ee~~~~I~~~L~~~~~~~~~~------l~~-----------~~~~~~~~~~~~~~~~~~~~~~ 225 (272)
+.|..++++|||++.++++++++|++.|...+++|-|+ |++ +..||+|.|+++++|||++|++
T Consensus 193 e~p~~~dlvIDts~~s~eevv~~Il~~L~~~~~ip~G~~~~l~~l~v~~~~~~~~~~~a~~l~~i~l~~~~~~dlell~~ 272 (630)
T 1x6v_B 193 EKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVPVDASYEVKELYVPENKLHLAKTDAETLPALKINKVDMQWVQVLAE 272 (630)
T ss_dssp CCCSSCSEEEETTSSCHHHHHHHHHHHHHHTTSSCCCCCCSCCCCBCCGGGHHHHHHHHHTSCEEECCHHHHHHHHHHHH
T ss_pred cccCCCcEEEECCCCCHHHHHHHHHHHHHhcCcccccCcccceecccChHHHHHHHHhhccCCEEEECHHHHHHHHHHhc
Confidence 98878899999998999999999999999999999863 343 7789999999999999999999
Q ss_pred ccccCccCCCCHHHHHhhhhhcccCCC--CccceeEEEecChhhhhhc
Q psy17388 226 GWSSPLKGFMREDEFLKTIHFNTLDSN--VNQSVAIVLAVTGEDKQRL 271 (272)
Q Consensus 226 g~~~pl~gfm~~~~~~~v~~~~~l~~~--~~~~~pi~l~~~~~~~~~~ 271 (272)
||||||+|||+++||+||+++|||+|| ++|||||||+|++++++.|
T Consensus 273 G~fsPL~GfM~~~dy~~v~~~~~l~~g~~~~~~iPi~L~v~~~~~~~l 320 (630)
T 1x6v_B 273 GWATPLNGFMREREYLQCLHFDCLLDGGVINLSVPIVLTATHEDKERL 320 (630)
T ss_dssp TTTTTCCSSCCHHHHHHHHHHSEECTTSCEECCSCCCEEECHHHHHHH
T ss_pred CCccCchhhCCHHHHHHHHHhCEeCCCCeeeeeeEEEEeCCHHHHhhC
Confidence 999999999999999999999999996 7999999999999988765
|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1r6x_A ATP:sulfate adenylyltransferase; APS kinase-like domain; 1.40A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1v47_A ATP sulfurylase; product binding complex, zinc, riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; HET: ADX; 2.49A {Thermus thermophilus} SCOP: b.122.1.3 c.26.1.5 | Back alignment and structure |
|---|
| >1jhd_A Sulfate adenylyltransferase; sulfurylase, APS, chemoautotroph, bromide; 1.70A {Sulfur-oxidizing endosymbiont ofriftia pachyptila} SCOP: b.122.1.3 c.26.1.5 | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >3czq_A Putative polyphosphate kinase 2; structural genomics, APC6299, PSI-2, structure initiative; HET: MSE GOL; 2.23A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >1p6x_A Thymidine kinase; P-loop, LID, transferase; HET: THM; 2.00A {Equid herpesvirus 4} SCOP: c.37.1.1 PDB: 1p72_A* 1p73_A* 1p75_A* | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural protein structure initiative, midwest center for structural genomics; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1e2k_A Thymidine kinase; transferase, antiviral drug, enzyme-prodrug gene therapy, sugar ring pucker; HET: TMC; 1.7A {Herpes simplex virus} SCOP: c.37.1.1 PDB: 1e2i_A* 1e2h_A* 1e2m_A* 1e2n_A* 1e2p_A* 1ki2_A* 1ki3_A* 1ki4_A* 1ki6_B* 1ki7_A* 1ki8_A* 3rdp_A* 2ki5_A* 1kim_A* 1qhi_A* 1p7c_A* 1vtk_A* 2vtk_A* 3vtk_A* 3f0t_A* ... | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural protein structure initiative, midwest center for structural genomics; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >1osn_A Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, transferase; HET: BVP ADP; 3.20A {Human herpesvirus 3} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >3rhf_A Putative polyphosphate kinase 2 family protein; PSI-biology, MCSG, structural genomics, midwest center for S genomics; HET: PGE FLC PG4; 2.45A {Arthrobacter aurescens} | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >1dek_A Deoxynucleoside monophosphate kinase; transferase, phosphotransferase; HET: DGP; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 PDB: 1del_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* | Back alignment and structure |
|---|
| >3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* | Back alignment and structure |
|---|
| >2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* | Back alignment and structure |
|---|
| >3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* | Back alignment and structure |
|---|
| >1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A | Back alignment and structure |
|---|
| >3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3qxc_A Dethiobiotin synthetase; DTBS, structural genomics, ATP BIND biology, protein structure initiative, midwest center for S genomics, MCSG; HET: ATP; 1.34A {Helicobacter pylori} PDB: 3mle_A* 3qxh_A* 3qxj_A* 3qxs_A* 3qxx_A* 3qy0_A* 2qmo_A | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3of5_A Dethiobiotin synthetase; structural genomics, center for structural genomics of infec diseases, csgid, ligase; 1.52A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >3fgn_A Dethiobiotin synthetase; biotin biosynthesis, BIOD, ATP-BIND ligase, magnesium, nucleotide-binding; 1.85A {Mycobacterium tuberculosis} PDB: 3fmf_A* 3fmi_A* 3fpa_A* | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 272 | ||||
| d1m7ga_ | 208 | c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (A | 3e-52 | |
| d1x6va3 | 195 | c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kin | 3e-34 | |
| d1m8pa3 | 183 | c.37.1.15 (A:391-573) ATP sulfurylase C-terminal d | 6e-28 | |
| d1qhxa_ | 178 | c.37.1.3 (A:) Chloramphenicol phosphotransferase { | 3e-19 | |
| d1zp6a1 | 176 | c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { | 1e-16 | |
| d1g8fa3 | 122 | c.37.1.15 (A:390-511) ATP sulfurylase C-terminal d | 5e-14 | |
| d1knqa_ | 171 | c.37.1.17 (A:) Gluconate kinase {Escherichia coli | 6e-13 | |
| d1np6a_ | 170 | c.37.1.10 (A:) Molybdopterin-guanine dinucleotide | 2e-12 | |
| d1v47a1 | 132 | b.122.1.3 (A:4-135) ATP sulfurylase N-terminal dom | 4e-12 | |
| d1x6va1 | 161 | b.122.1.3 (A:229-389) ATP sulfurylase N-terminal d | 6e-12 | |
| d1bifa1 | 213 | c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fruct | 7e-12 | |
| d1g8fa1 | 167 | b.122.1.3 (A:2-168) ATP sulfurylase N-terminal dom | 9e-12 | |
| d1m8pa1 | 170 | b.122.1.3 (A:1-170) ATP sulfurylase N-terminal dom | 9e-12 | |
| d1jhda1 | 173 | b.122.1.3 (A:1-173) ATP sulfurylase N-terminal dom | 4e-10 | |
| d2bdta1 | 176 | c.37.1.25 (A:1-176) Hypothetical protein BH3686 {B | 2e-09 | |
| d1kaga_ | 169 | c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia | 8e-09 | |
| d1ly1a_ | 152 | c.37.1.1 (A:) Polynucleotide kinase, kinase domain | 1e-05 | |
| d1nksa_ | 194 | c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobu | 4e-05 |
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Length = 208 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Adenosine-5'phosphosulfate kinase (APS kinase) domain: Adenosine-5'phosphosulfate kinase (APS kinase) species: Fungus (Penicillium chrysogenum) [TaxId: 5076]
Score = 167 bits (423), Expect = 3e-52
Identities = 87/188 (46%), Positives = 123/188 (65%), Gaps = 7/188 (3%)
Query: 19 GQSNICLLFPGLSGAGKTSISFQIESYLIAQG-IPAYALDGDNLRNGINANLAFSEEDRN 77
Q + + GLS +GK++++ ++E L+ + AY LDGDN+R G+N +L FSE DRN
Sbjct: 21 NQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRN 80
Query: 78 ENVRRAAECAKMFAECGFIALCSFVSPTAAARDRAREIH------RNANLEFFEVFVNTP 131
EN+RR AE AK+FA+ IA+ SF+SP RD AR++H L F EV+V+ P
Sbjct: 81 ENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVATPGEETGLPFVEVYVDVP 140
Query: 132 VEICEQRDVKGHYKKAREGKIKSFTGVSQPYEAPKNPDLILETVNVPVEKCANSVLDMIA 191
VE+ EQRD KG YKKAREG IK FTG+S PYEAP NP++ ++ +PV+ ++D +
Sbjct: 141 VEVAEQRDPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNYELPVQDAVKQIIDYLD 200
Query: 192 AKGLIPAR 199
KG +PA+
Sbjct: 201 TKGYLPAK 208
|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Length = 195 | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Length = 183 | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 | Back information, alignment and structure |
|---|
| >d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 122 | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Length = 171 | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Length = 170 | Back information, alignment and structure |
|---|
| >d1v47a1 b.122.1.3 (A:4-135) ATP sulfurylase N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 132 | Back information, alignment and structure |
|---|
| >d1x6va1 b.122.1.3 (A:229-389) ATP sulfurylase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 161 | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 213 | Back information, alignment and structure |
|---|
| >d1g8fa1 b.122.1.3 (A:2-168) ATP sulfurylase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 167 | Back information, alignment and structure |
|---|
| >d1m8pa1 b.122.1.3 (A:1-170) ATP sulfurylase N-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Length = 170 | Back information, alignment and structure |
|---|
| >d1jhda1 b.122.1.3 (A:1-173) ATP sulfurylase N-terminal domain {Sulfur-oxidizing endosymbiont of Riftia pachyptila [TaxId: 35843]} Length = 173 | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Length = 176 | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Length = 169 | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Length = 152 | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 194 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 272 | |||
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 100.0 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 99.93 | |
| d1g8fa1 | 167 | ATP sulfurylase N-terminal domain {Baker's yeast ( | 99.92 | |
| d1m8pa1 | 170 | ATP sulfurylase N-terminal domain {Fungus (Penicil | 99.91 | |
| d1x6va1 | 161 | ATP sulfurylase N-terminal domain {Human (Homo sap | 99.91 | |
| d1jhda1 | 173 | ATP sulfurylase N-terminal domain {Sulfur-oxidizin | 99.91 | |
| d1v47a1 | 132 | ATP sulfurylase N-terminal domain {Thermus thermop | 99.9 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 99.89 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 99.82 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 99.81 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 99.8 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 99.76 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 99.76 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 99.69 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 99.64 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 99.63 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 99.62 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 99.61 | |
| d1g8fa3 | 122 | ATP sulfurylase C-terminal domain {Baker's yeast ( | 99.61 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 99.59 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 99.59 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 99.52 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 99.52 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 99.46 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 99.46 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 99.45 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 99.41 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 99.41 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 99.37 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 99.35 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 99.34 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 99.33 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 99.33 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 99.31 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 99.28 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 99.26 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 99.26 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 99.25 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 99.24 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 99.23 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 99.2 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 99.07 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 99.01 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 98.96 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 98.95 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 98.92 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 98.91 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 98.91 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 98.87 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 98.87 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 98.86 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 98.84 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 98.8 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 98.78 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 98.6 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 98.57 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 98.54 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 98.5 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 98.47 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 98.35 | |
| d1e2ka_ | 329 | Thymidine kinase {Herpes simplex virus type 1, dif | 98.3 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 98.28 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 98.26 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 98.26 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 98.18 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 98.17 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 98.16 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 98.06 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 98.06 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 98.04 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 98.02 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 97.98 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 97.95 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 97.94 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 97.88 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 97.85 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 97.83 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 97.81 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 97.74 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 97.73 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 97.65 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 97.62 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 97.6 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 97.59 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 97.59 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 97.53 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 97.51 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 97.47 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 97.47 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 97.46 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 97.44 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 97.42 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 97.4 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 97.4 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 97.39 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 97.35 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 97.34 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 97.32 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 97.32 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 97.3 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 97.28 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 97.28 | |
| d1kjwa2 | 199 | Guanylate kinase-like domain of Psd-95 {Rat (Rattu | 97.24 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 97.22 | |
| d2axpa1 | 164 | Hypothetical protein YorR {Bacillus subtilis [TaxI | 97.22 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 97.21 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 97.19 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 97.17 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 97.12 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 97.12 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 97.05 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 97.02 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 96.93 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 96.88 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 96.88 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 96.87 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 96.87 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 96.86 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 96.86 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 96.86 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 96.85 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 96.84 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 96.83 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 96.83 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 96.81 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 96.8 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 96.73 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 96.72 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 96.72 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 96.71 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 96.71 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 96.7 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 96.69 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 96.64 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 96.61 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 96.6 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 96.6 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 96.6 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 96.54 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 96.53 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 96.51 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 96.5 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 96.43 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 96.43 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 96.4 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 96.35 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 96.35 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 96.35 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 96.33 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 96.32 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 96.31 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 96.23 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 96.18 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 96.14 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 96.04 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 96.04 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 96.03 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 95.92 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 95.89 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 95.69 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 95.69 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 95.68 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 95.66 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 95.64 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 95.6 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 95.56 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 95.55 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 95.42 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 95.4 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 95.36 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 95.32 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 95.3 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 95.28 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 95.24 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 95.24 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 95.23 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 95.21 | |
| d1xbta1 | 133 | Thymidine kinase, TK1, N-terminal domain {Human (H | 95.19 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 95.18 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 95.17 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 95.16 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 95.13 | |
| d1xx6a1 | 141 | Thymidine kinase, TK1, N-terminal domain {Clostrid | 95.1 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 95.06 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 95.01 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 95.0 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 94.99 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 94.99 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 94.97 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 94.96 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 94.88 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 94.87 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 94.84 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 94.82 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 94.82 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 94.79 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 94.79 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 94.77 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 94.77 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 94.76 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 94.7 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 94.68 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 94.65 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 94.64 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 94.64 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 94.57 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 94.55 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 94.51 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 94.51 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 94.46 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 94.46 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 94.45 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 94.39 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 94.34 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 94.33 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 94.31 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 94.3 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 94.24 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 94.24 | |
| d2b8ta1 | 139 | Thymidine kinase, TK1, N-terminal domain {Ureaplas | 94.23 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 94.21 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 94.18 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 94.13 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 94.04 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 94.03 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 94.02 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 94.01 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 93.96 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 93.86 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 93.84 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 93.82 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 93.78 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 93.69 | |
| d1c9ka_ | 180 | Adenosylcobinamide kinase/adenosylcobinamide phosp | 93.58 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 93.53 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 93.46 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 93.43 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 93.34 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 93.32 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 93.25 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 93.22 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 93.16 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 93.02 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 92.84 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 92.67 | |
| d1br2a2 | 710 | Myosin S1, motor domain {Chicken (Gallus gallus), | 92.61 | |
| d1lkxa_ | 684 | Myosin S1, motor domain {Dictyostelium discoideum, | 92.54 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 92.5 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 92.39 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 92.35 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 92.15 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 92.07 | |
| d1d0xa2 | 712 | Myosin S1, motor domain {Dictyostelium discoideum | 92.07 | |
| d2olra1 | 313 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 92.04 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 91.98 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 91.91 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 91.81 | |
| d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 91.79 | |
| d1ii2a1 | 323 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 91.67 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 91.33 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 91.3 | |
| d1w7ja2 | 730 | Myosin S1, motor domain {Chicken (Gallus gallus), | 91.23 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 91.07 | |
| d1j3ba1 | 318 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 90.98 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 90.96 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 90.85 | |
| d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 90.82 | |
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 90.79 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 90.23 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 90.1 | |
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 90.03 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 89.89 | |
| d1jala1 | 278 | YchF GTP-binding protein N-terminal domain {Haemop | 89.65 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 88.75 | |
| d1ni3a1 | 296 | YchF GTP-binding protein N-terminal domain {Fissio | 88.67 | |
| d2qn6a3 | 205 | Initiation factor eIF2 gamma subunit, N-terminal ( | 88.43 | |
| d1j6ua3 | 207 | UDP-N-acetylmuramate-alanine ligase MurC {Thermoto | 87.22 | |
| d1kk1a3 | 195 | Initiation factor eIF2 gamma subunit, N-terminal ( | 87.15 | |
| d1wxqa1 | 319 | GTP-binding protein PH0525 {Pyrococcus horikoshii | 86.77 | |
| d1e8ca3 | 234 | UDP-N-acetylmuramyl tripeptide synthetase MurE {Es | 86.59 | |
| d2akab1 | 299 | Dynamin G domain {Rat (Rattus norvegicus) [TaxId: | 85.53 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 85.21 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 84.94 | |
| d1jwyb_ | 306 | Dynamin G domain {Dictyostelium discoideum [TaxId: | 84.87 | |
| d1r5ba3 | 245 | Eukaryotic peptide chain release factor ERF2, G do | 84.82 | |
| d1gg4a4 | 214 | UDP-murNac-tripeptide D-alanyl-D-alanine-adding en | 84.6 | |
| d1zunb3 | 222 | Sulfate adenylate transferase subunit cysN/C, EF-T | 83.9 | |
| d1f5na2 | 277 | Interferon-induced guanylate-binding protein 1 (GB | 83.85 | |
| d1p3da1 | 96 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 83.18 | |
| d1jnya3 | 224 | Elongation factor eEF-1alpha, N-terminal (G) domai | 82.75 | |
| d2jfga3 | 204 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 82.43 | |
| d1f60a3 | 239 | Elongation factor eEF-1alpha, N-terminal (G) domai | 82.28 | |
| d1n0ua2 | 341 | Elongation factor 2 (eEF-2), N-terminal (G) domain | 81.33 |
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Adenosine-5'phosphosulfate kinase (APS kinase) domain: Adenosine-5'phosphosulfate kinase (APS kinase) species: Fungus (Penicillium chrysogenum) [TaxId: 5076]
Probab=100.00 E-value=1.1e-32 Score=230.44 Aligned_cols=186 Identities=47% Similarity=0.826 Sum_probs=172.5
Q ss_pred hhhhhcCCCCeEEEEEcCCCCCHHHHHHHHHHHHHH-cCCCEEEecCccccccccccCCCCHHHHHHHHHHHHHHHHHHH
Q psy17388 13 LRDFKEGQSNICLLFPGLSGAGKTSISFQIESYLIA-QGIPAYALDGDNLRNGINANLAFSEEDRNENVRRAAECAKMFA 91 (272)
Q Consensus 13 ~r~~~~~~~~~lI~l~G~~GsGKSTlAr~La~~L~~-~g~~~~~ld~D~i~~~l~~~~~~~~~~~~~~~~~i~~~~~~~~ 91 (272)
.|..+.+++|.+|||+|+|||||||+|++|+++|.. .++++.++|+|.+|..+..+.+|+..++...+.++..++..+.
T Consensus 15 ~r~~~~~~kg~vIwltGlsGsGKTTia~~L~~~l~~~~~~~~~~ldgD~iR~~l~~~l~ys~~~r~~~~~r~~~~a~~~~ 94 (208)
T d1m7ga_ 15 ERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFA 94 (208)
T ss_dssp HHHHHHTSSCEEEEEECSTTSSHHHHHHHHHHHHHHHHCCCEEEECHHHHTTTTTTTCCSSHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHhCCCCeEEEEECCCCCCHHHHHHHHHHHHHHhcCceEEEEcchHHHHhhcCCCCCChhHHHHHHHHHHHHHHHHh
Confidence 467888899999999999999999999999988854 5778999999999999988899999999999999999999999
Q ss_pred hCCCeEEEcCCCCcHHHHHHHHHHHH------hCCCceEEEEEeCCHHHHHHhhhhhhhhhhhhccccccccccccCCCC
Q psy17388 92 ECGFIALCSFVSPTAAARDRAREIHR------NANLEFFEVFVNTPVEICEQRDVKGHYKKAREGKIKSFTGVSQPYEAP 165 (272)
Q Consensus 92 ~~g~~VI~d~~~~~~~~r~~~~~~~~------~~g~~~~~V~L~~~~e~~~~Rl~~r~~~~~r~~~~~~~~~~~~~ye~~ 165 (272)
.+|..||++.+++....|+.++++.. ..+.+++.|||+||.++|.+|..++.|.+...+.+.++.+++..|++|
T Consensus 95 ~~g~~viv~~i~~~~~~R~~~r~i~~~~~~~~~~~~~~~eVyv~~~le~~~~Rd~k~~y~~~~~~~~~~~~gvd~~ye~P 174 (208)
T d1m7ga_ 95 DSNSIAITSFISPYRKDRDTARQLHEVATPGEETGLPFVEVYVDVPVEVAEQRDPKGLYKKAREGVIKEFTGISAPYEAP 174 (208)
T ss_dssp HTTCEEEEECCCCCHHHHHHHHHHHHCCCTTCSCCCCEEEEEEECCHHHHHTSCTTCHHHHHHHTSSSSCBTTTBCCCCC
T ss_pred ccCCceeeecccccHHHHHHHHHHhhhhccchhcCCceEEEEEcCCHHHHHHhhcccchhhhhcCcccceecccccCCCC
Confidence 99999999999999999999988763 356789999999999999999999999998888888999999999999
Q ss_pred CCCcEEEeCCCCCHHHHHHHHHHHHHhCCCCCC
Q psy17388 166 KNPDLILETVNVPVEKCANSVLDMIAAKGLIPA 198 (272)
Q Consensus 166 ~~~~~~Idt~~~~~ee~~~~I~~~L~~~~~~~~ 198 (272)
..++++|||+..++++++++|++.|.++|+||+
T Consensus 175 ~~~dl~Idt~~~s~~e~~~~Ii~~L~~~~~i~~ 207 (208)
T d1m7ga_ 175 ANPEVHVKNYELPVQDAVKQIIDYLDTKGYLPA 207 (208)
T ss_dssp SSCSEEEECSSSCHHHHHHHHHHHHHHTTCSCC
T ss_pred CCCcEEEeCCCCCHHHHHHHHHHHHHHcCCCCC
Confidence 999999999999999999999999999999986
|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8fa1 b.122.1.3 (A:2-168) ATP sulfurylase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m8pa1 b.122.1.3 (A:1-170) ATP sulfurylase N-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1x6va1 b.122.1.3 (A:229-389) ATP sulfurylase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jhda1 b.122.1.3 (A:1-173) ATP sulfurylase N-terminal domain {Sulfur-oxidizing endosymbiont of Riftia pachyptila [TaxId: 35843]} | Back information, alignment and structure |
|---|
| >d1v47a1 b.122.1.3 (A:4-135) ATP sulfurylase N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2axpa1 c.37.1.1 (A:2-165) Hypothetical protein YorR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1j6ua3 c.72.2.1 (A:89-295) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1e8ca3 c.72.2.1 (A:104-337) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1gg4a4 c.72.2.1 (A:99-312) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2jfga3 c.72.2.1 (A:94-297) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|