Psyllid ID: psy17408


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
MFKYCDCKSNWLPYEGSCNSLARFVGRNNANGVDLNRNFPDQFDSSSERREQPLNVKKLEPETLAMISFIKNNPFVLSGNLHGGAIVASYPFDDSK
ccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccEEEEEccccEEEEEccccccc
cccEccccccHEEEcccccccccEEcccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccEEEEEEccccEEEEEccccccc
mfkycdcksnwlpyegscnslarfvgrnnangvdlnrnfpdqfdssserreqplnvkklepETLAMISFiknnpfvlsgnlhggaivasypfddsk
mfkycdcksnwlpYEGSCNSLARFVGRNnangvdlnrnfpdqfdssserreqplnvKKLEPETLAMISFIKNNPFVLSGNLHGGAivasypfddsk
MFKYCDCKSNWLPYEGSCNSLARFVGRNNANGVDLNRNFPDQFDSSSERREQPLNVKKLEPETLAMISFIKNNPFVLSGNLHGGAIVASYPFDDSK
**KYCDCKSNWLPYEGSCNSLARFVGRNNANGV*****************************TLAMISFIKNNPFVLSGNLHGGAIVASY******
**************EG*CNS*ARFVGRNNANGVDLNRNFPDQFDSSSERREQPLNVKKLEPETLAMISFIKNNPFVLSGNLHGGAIVASYPFD***
MFKYCDCKSNWLPYEGSCNSLARFVGRNNANGVDLNRNFPDQF*********PLNVKKLEPETLAMISFIKNNPFVLSGNLHGGAIVASYPFDDSK
MFKYCDCKSNWLPYEGSCNSLARFVGRNNANGVDLNRNFPDQFDSSSERREQPLNVKKLEPETLAMISFIKNNPFVLSGNLHGGAIVASYPFDD**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFKYCDCKSNWLPYEGSCNSLARFVGRNNANGVDLNRNFPDQFDSSSERREQPLNVKKLEPETLAMISFIKNNPFVLSGNLHGGAIVASYPFDDSK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query96 2.2.26 [Sep-21-2011]
P42787 1406 Carboxypeptidase D OS=Dro yes N/A 0.843 0.057 0.5 1e-18
Q90240 1389 Carboxypeptidase D OS=Ana N/A N/A 0.656 0.045 0.541 4e-16
O89001 1377 Carboxypeptidase D OS=Mus yes N/A 0.656 0.045 0.527 8e-16
P83852 380 Carboxypeptidase D (Fragm N/A N/A 0.656 0.165 0.541 1e-15
O75976 1380 Carboxypeptidase D OS=Hom no N/A 0.656 0.045 0.513 1e-15
Q9JHW1 1378 Carboxypeptidase D OS=Rat yes N/A 0.666 0.046 0.557 2e-15
Q9EQV8 457 Carboxypeptidase N cataly no N/A 0.802 0.168 0.494 3e-15
P15169 458 Carboxypeptidase N cataly no N/A 0.802 0.168 0.494 2e-14
Q2KJ83 462 Carboxypeptidase N cataly no N/A 0.75 0.155 0.524 2e-14
Q9JJN5 457 Carboxypeptidase N cataly no N/A 0.802 0.168 0.505 5e-14
>sp|P42787|CBPD_DROME Carboxypeptidase D OS=Drosophila melanogaster GN=svr PE=1 SV=2 Back     alignment and function desciption
 Score = 92.0 bits (227), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 42/84 (50%), Positives = 59/84 (70%), Gaps = 3/84 (3%)

Query: 12  LPYEGSCNSLARFVGRNNANGVDLNRNFPDQFDSSSERREQPLNVKKLEPETLAMISFIK 71
           L  EG+C SL  +VGR NA  +DLNR+FPD+ + S   +   L  +  +PET A++++I 
Sbjct: 150 LSQEGNCESLPNYVGRGNAANIDLNRDFPDRLEQSHVHQ---LRAQSRQPETAALVNWIV 206

Query: 72  NNPFVLSGNLHGGAIVASYPFDDS 95
           + PFVLS N HGGA+VASYP+D+S
Sbjct: 207 SKPFVLSANFHGGAVVASYPYDNS 230




Required for the proper melanization and sclerotization of the cuticle.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 4EC: .EC: 1EC: 7EC: .EC: 2EC: 2
>sp|Q90240|CBPD_ANAPL Carboxypeptidase D OS=Anas platyrhynchos GN=CPD PE=1 SV=1 Back     alignment and function description
>sp|O89001|CBPD_MOUSE Carboxypeptidase D OS=Mus musculus GN=Cpd PE=1 SV=2 Back     alignment and function description
>sp|P83852|CBPD_LOPSP Carboxypeptidase D (Fragment) OS=Lophonetta specularioides GN=CPD PE=1 SV=1 Back     alignment and function description
>sp|O75976|CBPD_HUMAN Carboxypeptidase D OS=Homo sapiens GN=CPD PE=1 SV=2 Back     alignment and function description
>sp|Q9JHW1|CBPD_RAT Carboxypeptidase D OS=Rattus norvegicus GN=Cpd PE=2 SV=2 Back     alignment and function description
>sp|Q9EQV8|CBPN_RAT Carboxypeptidase N catalytic chain OS=Rattus norvegicus GN=Cpn1 PE=2 SV=1 Back     alignment and function description
>sp|P15169|CBPN_HUMAN Carboxypeptidase N catalytic chain OS=Homo sapiens GN=CPN1 PE=1 SV=1 Back     alignment and function description
>sp|Q2KJ83|CBPN_BOVIN Carboxypeptidase N catalytic chain OS=Bos taurus GN=CPN1 PE=2 SV=1 Back     alignment and function description
>sp|Q9JJN5|CBPN_MOUSE Carboxypeptidase N catalytic chain OS=Mus musculus GN=Cpn1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
242015953 1268 carboxypeptidase D precursor, putative [ 0.802 0.060 0.641 9e-23
312385094 1268 hypothetical protein AND_01175 [Anophele 0.812 0.061 0.580 2e-20
347967818 1457 AGAP002414-PA [Anopheles gambiae str. PE 0.812 0.053 0.555 6e-19
345490273 1668 PREDICTED: carboxypeptidase D-like [Naso 0.75 0.043 0.569 2e-18
332374584 433 unknown [Dendroctonus ponderosae] 0.802 0.177 0.580 2e-18
403183363 1457 AAEL017499-PA [Aedes aegypti] 0.812 0.053 0.567 4e-18
321464268 1292 hypothetical protein DAPPUDRAFT_250728 [ 0.843 0.062 0.578 4e-18
194768873 1607 GF21938 [Drosophila ananassae] gi|190617 0.843 0.050 0.535 5e-18
380020297 1671 PREDICTED: carboxypeptidase D-like [Apis 0.822 0.047 0.575 6e-18
328785691 1612 PREDICTED: carboxypeptidase D-like [Apis 0.822 0.049 0.575 6e-18
>gi|242015953|ref|XP_002428607.1| carboxypeptidase D precursor, putative [Pediculus humanus corporis] gi|212513251|gb|EEB15869.1| carboxypeptidase D precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  110 bits (276), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 66/81 (81%), Gaps = 4/81 (4%)

Query: 15  EGSCNSLARFVGRNNANGVDLNRNFPDQFDSSSERREQPLNVKKLEPETLAMISFIKNNP 74
           EG+C+SL  FVGR NANG+DLNR+FPDQFD   +R     +++K +PETLAM+ +I  NP
Sbjct: 151 EGNCDSLPGFVGRTNANGIDLNRDFPDQFDYIFKRP----SIRKYQPETLAMMKWIVQNP 206

Query: 75  FVLSGNLHGGAIVASYPFDDS 95
           FVLSGNLHGGA+VASYPFD++
Sbjct: 207 FVLSGNLHGGAVVASYPFDNA 227




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|312385094|gb|EFR29672.1| hypothetical protein AND_01175 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|347967818|ref|XP_312538.5| AGAP002414-PA [Anopheles gambiae str. PEST] gi|333468289|gb|EAA07478.5| AGAP002414-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|345490273|ref|XP_003426341.1| PREDICTED: carboxypeptidase D-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332374584|gb|AEE62433.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|403183363|gb|EJY58039.1| AAEL017499-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|321464268|gb|EFX75277.1| hypothetical protein DAPPUDRAFT_250728 [Daphnia pulex] Back     alignment and taxonomy information
>gi|194768873|ref|XP_001966535.1| GF21938 [Drosophila ananassae] gi|190617299|gb|EDV32823.1| GF21938 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|380020297|ref|XP_003694026.1| PREDICTED: carboxypeptidase D-like [Apis florea] Back     alignment and taxonomy information
>gi|328785691|ref|XP_003250638.1| PREDICTED: carboxypeptidase D-like [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
FB|FBgn0004648 1406 svr "silver" [Drosophila melan 0.843 0.057 0.5 3.5e-17
UNIPROTKB|P83852 380 CPD "Carboxypeptidase D" [Loph 0.656 0.165 0.555 3.3e-15
ZFIN|ZDB-GENE-081112-2 1350 cpda "carboxypeptidase D, a" [ 0.75 0.053 0.543 7.3e-15
UNIPROTKB|E1C7M0 453 CPN1 "Uncharacterized protein" 0.812 0.172 0.522 1.2e-14
RGD|70931 457 Cpn1 "carboxypeptidase N, poly 0.802 0.168 0.528 1.5e-14
UNIPROTKB|Q9EQV8 457 Cpn1 "Carboxypeptidase N catal 0.802 0.168 0.528 1.5e-14
MGI|MGI:2135874 457 Cpn1 "carboxypeptidase N, poly 0.802 0.168 0.517 2e-14
UNIPROTKB|F6XTZ1 376 CPN1 "Uncharacterized protein" 0.802 0.204 0.528 2.5e-14
UNIPROTKB|E1BLR9 1108 LOC532189 "Uncharacterized pro 0.697 0.060 0.526 2.5e-14
ZFIN|ZDB-GENE-041210-191 446 cpm "carboxypeptidase M" [Dani 0.770 0.165 0.5 3.1e-14
FB|FBgn0004648 svr "silver" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 225 (84.3 bits), Expect = 3.5e-17, P = 3.5e-17
 Identities = 42/84 (50%), Positives = 59/84 (70%)

Query:    12 LPYEGSCNSLARFVGRNNANGVDLNRNFPDQFDSSSERREQPLNVKKLEPETLAMISFIK 71
             L  EG+C SL  +VGR NA  +DLNR+FPD+ + S   +   L  +  +PET A++++I 
Sbjct:   150 LSQEGNCESLPNYVGRGNAANIDLNRDFPDRLEQSHVHQ---LRAQSRQPETAALVNWIV 206

Query:    72 NNPFVLSGNLHGGAIVASYPFDDS 95
             + PFVLS N HGGA+VASYP+D+S
Sbjct:   207 SKPFVLSANFHGGAVVASYPYDNS 230


GO:0004181 "metallocarboxypeptidase activity" evidence=IDA;NAS
GO:0040003 "chitin-based cuticle development" evidence=NAS
GO:0006508 "proteolysis" evidence=IEA
GO:0030246 "carbohydrate binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005576 "extracellular region" evidence=IDA
GO:0004180 "carboxypeptidase activity" evidence=IMP;IDA
GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP
GO:0006911 "phagocytosis, engulfment" evidence=IMP
GO:0007616 "long-term memory" evidence=IMP
GO:0048471 "perinuclear region of cytoplasm" evidence=IDA
UNIPROTKB|P83852 CPD "Carboxypeptidase D" [Lophonetta specularioides (taxid:75873)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-081112-2 cpda "carboxypeptidase D, a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C7M0 CPN1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|70931 Cpn1 "carboxypeptidase N, polypeptide 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9EQV8 Cpn1 "Carboxypeptidase N catalytic chain" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2135874 Cpn1 "carboxypeptidase N, polypeptide 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F6XTZ1 CPN1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BLR9 LOC532189 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041210-191 cpm "carboxypeptidase M" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9JHW1CBPD_RAT3, ., 4, ., 1, 7, ., 2, 20.55710.66660.0464yesN/A
O89001CBPD_MOUSE3, ., 4, ., 1, 7, ., 2, 20.52770.65620.0457yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
cd03868 293 cd03868, M14_CPD_I, Peptidase M14 carboxypeptidase 4e-34
cd03858 293 cd03858, M14_CP_N-E_like, Peptidase M14 carboxypep 7e-33
cd03864 313 cd03864, M14_CPN, Peptidase M14 carboxypeptidase s 2e-22
cd03866 292 cd03866, M14_CPM, Peptidase M14 carboxypeptidase s 7e-22
cd03863 296 cd03863, M14_CPD_II, Peptidase M14 carboxypeptidas 1e-20
pfam00246277 pfam00246, Peptidase_M14, Zinc carboxypeptidase 4e-20
cd03865 323 cd03865, M14_CPE, Peptidase M14 carboxypeptidase s 1e-17
smart00631277 smart00631, Zn_pept, Zn_pept domain 2e-17
cd03867 315 cd03867, M14_CPZ, Peptidase M14 carboxypeptidase s 2e-17
cd00596211 cd00596, Peptidase_M14_like, M14 family of metallo 1e-14
cd03869 326 cd03869, M14_CPX_like, Peptidase M14 carboxypeptid 3e-13
cd06245284 cd06245, M14_CPD_III, Peptidase M14 carboxypeptida 5e-09
cd06229256 cd06229, M14_Endopeptidase_I, Peptidase M14 carbox 3e-08
cd06904178 cd06904, M14_MpaA_like, Peptidase M14-like domain 4e-07
PRK10602237 PRK10602, PRK10602, murein peptide amidase A; Prov 1e-06
cd03862 273 cd03862, M14-like_7, Peptidase M14-like domain; un 1e-05
cd06227269 cd06227, M14-like_2, Peptidase M14-like domain; un 2e-05
cd06905360 cd06905, M14-like_8, Peptidase M14-like domain; un 3e-04
cd03860293 cd03860, M14_CP_A-B_like, Peptidase M14 carboxypep 3e-04
>gnl|CDD|199850 cd03868, M14_CPD_I, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase D, domain I subgroup Back     alignment and domain information
 Score =  118 bits (297), Expect = 4e-34
 Identities = 48/82 (58%), Positives = 60/82 (73%), Gaps = 7/82 (8%)

Query: 15  EGSCNSLARFVGRNNANGVDLNRNFPDQFDSSSERREQPLNVKKLEPETLAMISFIKNNP 74
           EG C S   + GR NAN VDLNRNFPDQF+    R       ++ +PETLAMI++I++NP
Sbjct: 114 EGDC-SCGGYGGRGNANNVDLNRNFPDQFEGKHVR------AQERQPETLAMINWIRSNP 166

Query: 75  FVLSGNLHGGAIVASYPFDDSK 96
           FVLS NLHGG++VASYP+DDS 
Sbjct: 167 FVLSANLHGGSVVASYPYDDSS 188


The first carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3.4.17.22), domain I. CPD differs from all other metallocarboxypeptidases in that it contains multiple CP-like domains. CPD belongs to the N/E-like subfamily of the M14 family of metallocarboxypeptidases (MCPs).The M14 family are zinc-binding CPs which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. CPD is a single-chain protein containing a signal peptide, three tandem repeats of CP-like domains separated by short bridge regions, followed by a transmembrane domain, and a C-terminal cytosolic tail. The first two CP-like domains of CPD contain all of the essential active site and substrate-binding residues, the third CP-like domain lacks critical residues necessary for enzymatic activity and is inactive towards standard CP substrates. Domain I is optimally active at pH 6.3-7.5 and prefers substrates with C-terminal Arg, whereas domain II is active at pH 5.0-6.5 and prefers substrates with C-terminal Lys. This Domain I family contains two contiguous surface cysteines that may become palmitoylated and target the enzyme to membranes, thus regulating intracellular trafficking. CPD functions in the processing of proteins that transit the secretory pathway, and is present in all vertebrates as well as Drosophila. It is broadly distributed in all tissue types. Within cells, CPD is present in the trans Golgi network and immature secretory vesicles, but is excluded from mature vesicles. It is thought to play a role in the processing of proteins that are initially processed by furin or related endopeptidases present in the trans Golgi network, such as growth factors and receptors. CPD is implicated in the pathogenesis of lupus erythematosus (LE), it is regulated by TGF-beta in various cell types of murine and human origin and is significantly down-regulated in CD14 positive cells isolated from patients with LE. As down-regulation of CPD leads to down-modulation of TGF-beta, CPD may have a role in a positive feedback loop. In D. melanogaster, the CPD variant 1B short (DmCPD1Bs) is necessary and sufficient for viability of the fruit fly. Length = 293

>gnl|CDD|199842 cd03858, M14_CP_N-E_like, Peptidase M14 carboxypeptidase subfamily N/E-like Back     alignment and domain information
>gnl|CDD|199846 cd03864, M14_CPN, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase N subgroup Back     alignment and domain information
>gnl|CDD|199848 cd03866, M14_CPM, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase M subgroup Back     alignment and domain information
>gnl|CDD|199845 cd03863, M14_CPD_II, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase D, domain II subgroup Back     alignment and domain information
>gnl|CDD|215816 pfam00246, Peptidase_M14, Zinc carboxypeptidase Back     alignment and domain information
>gnl|CDD|199847 cd03865, M14_CPE, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase E subgroup Back     alignment and domain information
>gnl|CDD|214748 smart00631, Zn_pept, Zn_pept domain Back     alignment and domain information
>gnl|CDD|199849 cd03867, M14_CPZ, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase Z subgroup Back     alignment and domain information
>gnl|CDD|199839 cd00596, Peptidase_M14_like, M14 family of metallocarboxypeptidases and related proteins Back     alignment and domain information
>gnl|CDD|199851 cd03869, M14_CPX_like, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase X subgroup Back     alignment and domain information
>gnl|CDD|199867 cd06245, M14_CPD_III, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase D, domain III subgroup Back     alignment and domain information
>gnl|CDD|199855 cd06229, M14_Endopeptidase_I, Peptidase M14 carboxypeptidase family-like domain of Endopeptidase I Back     alignment and domain information
>gnl|CDD|133114 cd06904, M14_MpaA_like, Peptidase M14-like domain of Escherichia coli Murein Peptide Amidase A and related proteins Back     alignment and domain information
>gnl|CDD|182582 PRK10602, PRK10602, murein peptide amidase A; Provisional Back     alignment and domain information
>gnl|CDD|133073 cd03862, M14-like_7, Peptidase M14-like domain; uncharacterized subfamily Back     alignment and domain information
>gnl|CDD|199854 cd06227, M14-like_2, Peptidase M14-like domain; uncharacterized subfamily Back     alignment and domain information
>gnl|CDD|199875 cd06905, M14-like_8, Peptidase M14-like domain; uncharacterized subfamily Back     alignment and domain information
>gnl|CDD|199844 cd03860, M14_CP_A-B_like, Peptidase M14 carboxypeptidase subfamily A/B-like Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 96
cd03869 405 M14_CPX_like Peptidase M14-like domain of carboxyp 99.95
cd06246300 M14_CPB2 Peptidase M14 Carboxypeptidase (CP) B2 (C 99.95
cd03870301 M14_CPA Peptidase M14 Carboxypeptidase (CP) A (CPA 99.94
cd03872300 M14_CPA6 Carboxypeptidase (CP) A6 (CPA6, also know 99.94
KOG2650|consensus418 99.94
cd06247298 M14_CPO Peptidase M14 carboxypeptidase (CP) O (CPO 99.94
cd03864 392 M14_CPN Peptidase M14 Carboxypeptidase N (CPN, als 99.93
cd06227272 Peptidase_M14-like_2 A functionally uncharacterize 99.93
cd03871300 M14_CPB Peptidase M14 Carboxypeptidase B (CPB) bel 99.93
cd06228 332 Peptidase_M14-like_3 A functionally uncharacterize 99.93
cd03867 395 M14_CPZ Peptidase M14-like domain of carboxypeptid 99.93
cd06248304 M14_CPA_CPB_like Peptidase M14 Carboxypeptidase A/ 99.93
cd06226293 M14_CPT_like Peptidase M14-like domain of an uncha 99.93
cd03868 372 M14_CPD_I The first carboxypeptidase (CP)-like dom 99.92
cd03859295 M14_CPT Peptidase M14-like domain of carboxypeptid 99.92
cd03863 375 M14_CPD_II The second carboxypeptidase (CP)-like d 99.92
cd06245 363 M14_CPD_III The third carboxypeptidase (CP)-like d 99.91
cd03865 402 M14_CPE_H Peptidase M14 Carboxypeptidase (CP) E (C 99.91
smart00631277 Zn_pept Zn_pept. 99.91
cd03858 374 M14_CP_N-E_like Carboxypeptidase (CP) N/E-like sub 99.91
cd06229255 M14_Endopeptidase_I Peptidase M14-like domain of G 99.91
cd03860294 M14_CP_A-B_like The Peptidase M14 Carboxypeptidase 99.9
cd03866 376 M14_CPM Peptidase M14 Carboxypeptidase (CP) M (CPM 99.9
cd06905360 Peptidase_M14-like_8 A functionally uncharacterize 99.9
PF00246279 Peptidase_M14: Zinc carboxypeptidase This is famil 99.86
cd03862273 Peptidase_M14-like_7 A functionally uncharacterize 99.86
KOG2649|consensus 500 99.84
cd06904178 M14_MpaA_like Peptidase M14-like domain of Escheri 99.74
cd00596196 Peptidase_M14_like The M14 family of metallocarbox 99.67
PRK10602237 murein peptide amidase A; Provisional 99.67
cd06237244 M14_Nna1_like_3 A bacterial subgroup of the Peptid 99.64
cd06908261 M14_AGBL4_like Peptidase M14-like domain of ATP/GT 99.58
cd06234263 M14_Nna1_like_1 A bacterial subgroup of the Peptid 99.58
cd03856269 M14_Nna1_like Peptidase M14-like domain of Nna-1 ( 99.45
cd06238271 Peptidase_M14-like_1_1 Peptidase M14-like domain o 99.4
cd06235258 M14_Nna1_like_2 Subgroup of the Peptidase M14-like 99.35
cd06239231 Peptidase_M14-like_1_2 Peptidase M14-like domain o 99.32
cd06244268 Peptidase_M14-like_1_7 Peptidase M14-like domain o 99.29
cd06243236 Peptidase_M14-like_1_6 Peptidase M14-like domain o 99.2
cd06241266 Peptidase_M14-like_1_4 Peptidase M14-like domain o 99.15
cd06236 304 M14_AGBL5_like Peptidase M14-like domain of ATP/GT 99.15
cd03857226 Peptidase_M14-like_1 Peptidase M14-like domain of 99.15
cd06231236 Peptidase_M14-like_4 A functionally uncharacterize 99.02
cd06907261 M14_AGBL2-3_like Peptidase M14-like domain of ATP/ 98.98
cd06242 268 Peptidase_M14-like_1_5 Peptidase M14-like domain o 98.98
cd06906 278 M14_Nna1 Peptidase M14-like domain of Nna-1 (Nervo 98.48
cd06233 283 Peptidase_M14-like_6 Peptidase M14-like domain of 97.49
cd06240273 Peptidase_M14-like_1_3 Peptidase M14-like domain o 97.43
PF10994 341 DUF2817: Protein of unknown function (DUF2817); In 97.43
cd06254 288 M14_ASTE_ASPA_like_4 A functionally uncharacterize 96.9
cd06251 287 M14_ASTE_ASPA_like_1 A functionally uncharacterize 96.71
cd06250 359 M14_PaAOTO_like An uncharacterized subgroup of the 96.56
cd06230 252 M14_ASTE_ASPA_like The Peptidase M14 Succinylgluta 96.51
cd06255 293 M14_ASTE_ASPA_like_5 A functionally uncharacterize 95.97
cd06252 316 M14_ASTE_ASPA_like_2 A functionally uncharacterize 95.44
cd06232240 Peptidase_M14-like_5 Peptidase M14-like domain of 95.27
TIGR02994 325 ectoine_eutE ectoine utilization protein EutE. Mem 95.16
PF04952 292 AstE_AspA: Succinylglutamate desuccinylase / Aspar 94.93
cd06253 298 M14_ASTE_ASPA_like_3 A functionally uncharacterize 94.8
cd06909 282 M14_ASPA Aspartoacylase (ASPA) belongs to the Succ 93.15
PRK02259 288 aspartoacylase; Provisional 92.86
COG2866374 Predicted carboxypeptidase [Amino acid transport a 92.77
cd06910 272 M14_ASTE_ASPA_like_7 A functionally uncharacterize 92.68
cd06256 327 M14_ASTE_ASPA_like_6 A functionally uncharacterize 92.6
KOG3641|consensus650 92.35
cd03855 322 M14_ASTE Peptidase M14 Succinylglutamate desucciny 90.74
COG3608 331 Predicted deacylase [General function prediction o 87.5
PRK05324 329 succinylglutamate desuccinylase; Provisional 82.67
>cd03869 M14_CPX_like Peptidase M14-like domain of carboxypeptidase (CP)-like protein X (CPX), CPX forms a distinct subgroup of the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
Probab=99.95  E-value=5.8e-28  Score=191.36  Aligned_cols=93  Identities=31%  Similarity=0.538  Sum_probs=83.3

Q ss_pred             ccCCCCceeeecCCccCCCccCCCCCCCCcCCCCCCCC----CCCCCC-------------C-CCCCCCCCCCCcHHHHH
Q psy17408          4 YCDCKSNWLPYEGSCNSLARFVGRNNANGVDLNRNFPD----QFDSSS-------------E-RREQPLNVKKLEPETLA   65 (96)
Q Consensus         4 ~~~~~~~~~a~~~~~~~~~w~~~R~N~~GVDLNRNFp~----~w~~~~-------------~-~~~y~G~~p~SEpEt~A   65 (96)
                      -.|||+++.+.+++++..+|+++|+||+|||||||||+    .|+..+             . ++.|.|+.|+|||||+|
T Consensus       108 ~~NPDG~e~s~~~~~~~~~Wrk~R~na~GVDLNRNFp~~~~~~W~~~~~~~~~~~~~~~~~Pc~~~Y~G~~~~sEPET~A  187 (405)
T cd03869         108 SMNPDGYEKAYEAGSELGGWALGRWTEEGIDINHNFPDLNTILWEAEDKKKVPRKVPNHHIPIPEWYLSENATVAPETRA  187 (405)
T ss_pred             eeCCchhhhhhhcCccccccccCccCCCCccccCCCcccccccccccccccccccccccCCCCccccCCCCCCCcHHHHH
Confidence            36899999999988888899999999999999999996    676321             1 36899999999999999


Q ss_pred             HHHHHHhCCceEEEEeccCCceEEeeCCCCC
Q psy17408         66 MISFIKNNPFVLSGNLHGGAIVASYPFDDSK   96 (96)
Q Consensus        66 v~~~~~~~~~~l~is~Hsg~~~i~yPy~~s~   96 (96)
                      |++|+++++|+|++++|+|..+++||||+++
T Consensus       188 v~~~i~~~~FvLSanlHgG~lv~~YPyd~~~  218 (405)
T cd03869         188 VIAWMEKIPFVLGANLQGGELVVSYPYDMTR  218 (405)
T ss_pred             HHHHHHhCCceEEEEecCccEEEEcCccccc
Confidence            9999999999999999999999999999863



The M14 family are zinc-binding CPs which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. Proteins belonging to this subgroup include CP-like protein X1 (CPX1), CP-like protein X2 (CPX2), and aortic CP-like protein (ACLP) and its isoform adipocyte enhancer binding protein-1 (AEBP1). AEBP1 is a truncated form of ACLP, which may arise from alternative splicing of the gene. These proteins are inactive towards standard CP substrates because they lack one or more critical active site and substrate-binding residues that are necessary for activity. They may function as binding proteins rather than as active CPs or display catalytic activity toward other substrates. Pro

>cd06246 M14_CPB2 Peptidase M14 Carboxypeptidase (CP) B2 (CPB2, also known as plasma carboxypeptidase B, carboxypeptidase U, and CPU), belongs to the carboxpeptidase A/B subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03870 M14_CPA Peptidase M14 Carboxypeptidase (CP) A (CPA) belongs to the A/B subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03872 M14_CPA6 Carboxypeptidase (CP) A6 (CPA6, also known as CPAH; EC 3 Back     alignment and domain information
>KOG2650|consensus Back     alignment and domain information
>cd06247 M14_CPO Peptidase M14 carboxypeptidase (CP) O (CPO, also known as metallocarboxypeptidase C; EC 3 Back     alignment and domain information
>cd03864 M14_CPN Peptidase M14 Carboxypeptidase N (CPN, also known as kininase I, creatine kinase conversion factor, plasma carboxypeptidase B, arginine carboxypeptidase, and protaminase; EC 3 Back     alignment and domain information
>cd06227 Peptidase_M14-like_2 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03871 M14_CPB Peptidase M14 Carboxypeptidase B (CPB) belongs to the carboxypeptidase A/B subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06228 Peptidase_M14-like_3 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03867 M14_CPZ Peptidase M14-like domain of carboxypeptidase (CP) Z (CPZ), CPZ belongs to the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06248 M14_CPA_CPB_like Peptidase M14 Carboxypeptidase A/B-like subfamily: This is one of two main M14 carboxypeptidase subfamilies, defined by sequence and structural homology, the other being N/E Back     alignment and domain information
>cd06226 M14_CPT_like Peptidase M14-like domain of an uncharacterized group of Peptidase M14 Carboxypeptidase (CP) T (CPT)-like proteins Back     alignment and domain information
>cd03868 M14_CPD_I The first carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 Back     alignment and domain information
>cd03859 M14_CPT Peptidase M14-like domain of carboxypeptidase (CP) T (CPT), CPT belongs to the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03863 M14_CPD_II The second carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 Back     alignment and domain information
>cd06245 M14_CPD_III The third carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 Back     alignment and domain information
>cd03865 M14_CPE_H Peptidase M14 Carboxypeptidase (CP) E (CPE, also known as carboxypeptidase H, and enkephalin convertase; EC 3 Back     alignment and domain information
>smart00631 Zn_pept Zn_pept Back     alignment and domain information
>cd03858 M14_CP_N-E_like Carboxypeptidase (CP) N/E-like subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06229 M14_Endopeptidase_I Peptidase M14-like domain of Gamma-D-glutamyl-L-diamino acid endopeptidase 1 (also known as Gamma-D-glutamyl-meso-diaminopimelate peptidase I, and Endopeptidase I (ENP1); EC 3 Back     alignment and domain information
>cd03860 M14_CP_A-B_like The Peptidase M14 Carboxypeptidase (CP) A/B subfamily is one of two main M14 CP subfamilies defined by sequence and structural homology, the other being the N/E subfamily Back     alignment and domain information
>cd03866 M14_CPM Peptidase M14 Carboxypeptidase (CP) M (CPM) belongs to the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06905 Peptidase_M14-like_8 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>PF00246 Peptidase_M14: Zinc carboxypeptidase This is family M14 in the peptidase classification Back     alignment and domain information
>cd03862 Peptidase_M14-like_7 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>KOG2649|consensus Back     alignment and domain information
>cd06904 M14_MpaA_like Peptidase M14-like domain of Escherichia coli Murein Peptide Amidase A (MpaA) and related proteins Back     alignment and domain information
>cd00596 Peptidase_M14_like The M14 family of metallocarboxypeptidases (MCPs) are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity Back     alignment and domain information
>PRK10602 murein peptide amidase A; Provisional Back     alignment and domain information
>cd06237 M14_Nna1_like_3 A bacterial subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP),-like proteins Back     alignment and domain information
>cd06908 M14_AGBL4_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-4, and related proteins Back     alignment and domain information
>cd06234 M14_Nna1_like_1 A bacterial subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP)-like proteins Back     alignment and domain information
>cd03856 M14_Nna1_like Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins Back     alignment and domain information
>cd06238 Peptidase_M14-like_1_1 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06235 M14_Nna1_like_2 Subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins Back     alignment and domain information
>cd06239 Peptidase_M14-like_1_2 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06244 Peptidase_M14-like_1_7 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06243 Peptidase_M14-like_1_6 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06241 Peptidase_M14-like_1_4 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06236 M14_AGBL5_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-5, and related proteins Back     alignment and domain information
>cd03857 Peptidase_M14-like_1 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06231 Peptidase_M14-like_4 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06907 M14_AGBL2-3_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-2, and related proteins Back     alignment and domain information
>cd06242 Peptidase_M14-like_1_5 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06906 M14_Nna1 Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins Back     alignment and domain information
>cd06233 Peptidase_M14-like_6 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06240 Peptidase_M14-like_1_3 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>PF10994 DUF2817: Protein of unknown function (DUF2817); InterPro: IPR021259 This family of proteins has no known function Back     alignment and domain information
>cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06230 M14_ASTE_ASPA_like The Peptidase M14 Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily belongs to the M14 family of metallocarboxypeptidases (MCPs), and includes ASTE, which catalyzes the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway, and aspartoacylase (ASPA, also known as aminoacylase 2, and ACY-2; EC:3 Back     alignment and domain information
>cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06232 Peptidase_M14-like_5 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>TIGR02994 ectoine_eutE ectoine utilization protein EutE Back     alignment and domain information
>PF04952 AstE_AspA: Succinylglutamate desuccinylase / Aspartoacylase family; InterPro: IPR007036 This family describes both succinylglutamate desuccinylase that catalyses the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway and also includes aspartoacylase 3 Back     alignment and domain information
>cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06909 M14_ASPA Aspartoacylase (ASPA) belongs to the Succinylglutamate desuccinylase/aspartoacylase subfamily of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PRK02259 aspartoacylase; Provisional Back     alignment and domain information
>COG2866 Predicted carboxypeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>cd06910 M14_ASTE_ASPA_like_7 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06256 M14_ASTE_ASPA_like_6 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>KOG3641|consensus Back     alignment and domain information
>cd03855 M14_ASTE Peptidase M14 Succinylglutamate desuccinylase (ASTE, also known as N-succinyl-L-glutamate amidohydrolase, N2-succinylglutamate desuccinylase, and SGDS; EC 3 Back     alignment and domain information
>COG3608 Predicted deacylase [General function prediction only] Back     alignment and domain information
>PRK05324 succinylglutamate desuccinylase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
3mn8_A 435 Structure Of Drosophila Melanogaster Carboxypeptida 3e-19
1qmu_A 380 Duck Carboxypeptidase D Domain Ii Length = 380 8e-17
2nsm_A 439 Crystal Structure Of The Human Carboxypeptidase N ( 1e-15
1uwy_A 426 Crystal Structure Of Human Carboxypeptidase M Lengt 2e-14
>pdb|3MN8|A Chain A, Structure Of Drosophila Melanogaster Carboxypeptidase D Isoform 1b Short Length = 435 Back     alignment and structure

Iteration: 1

Score = 90.1 bits (222), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 42/84 (50%), Positives = 59/84 (70%), Gaps = 3/84 (3%) Query: 12 LPYEGSCNSLARFVGRNNANGVDLNRNFPDQFDSSSERREQPLNVKKLEPETLAMISFIK 71 L EG+C SL +VGR NA +DLNR+FPD+ + S + L + +PET A++++I Sbjct: 150 LSQEGNCESLPNYVGRGNAANIDLNRDFPDRLEQSHVHQ---LRAQSRQPETAALVNWIV 206 Query: 72 NNPFVLSGNLHGGAIVASYPFDDS 95 + PFVLS N HGGA+VASYP+D+S Sbjct: 207 SKPFVLSANFHGGAVVASYPYDNS 230
>pdb|1QMU|A Chain A, Duck Carboxypeptidase D Domain Ii Length = 380 Back     alignment and structure
>pdb|2NSM|A Chain A, Crystal Structure Of The Human Carboxypeptidase N (kininase I) Catalytic Domain Length = 439 Back     alignment and structure
>pdb|1UWY|A Chain A, Crystal Structure Of Human Carboxypeptidase M Length = 426 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
3mn8_A 435 LP15968P; catalytic domain of alpha/beta-hydrolase 2e-20
2nsm_A 439 Carboxypeptidase N catalytic chain; caroxypeptidas 3e-20
1h8l_A 380 Carboxypeptidase GP180 residues 503-882; hydrolase 3e-17
1uwy_A 426 Carboxypeptidase M; metallopeptidase, GPI-anchor, 5e-16
3prt_A 323 Carboxypeptidase T; hydrolase; 1.66A {Thermoactino 8e-12
4a37_A 388 Metallo-carboxypeptidase; metallo-protease, hydrol 9e-08
3k2k_A 403 Putative carboxypeptidase; structural genomics, jo 6e-06
1aye_A401 PCPA2, procarboxypeptidase A2; serine protease, zy 3e-04
1jqg_A 433 Carboxypeptidase A; Pro-protein, hydrolase; 2.50A 5e-04
1dtd_A303 Carboxypeptidase A2; carboxypeptidase A2, leech ca 8e-04
>3mn8_A LP15968P; catalytic domain of alpha/beta-hydrolase fold, C-terminal, A transthyretin-like domain, hydrolase; HET: NAG GEM; 2.70A {Drosophila melanogaster} Length = 435 Back     alignment and structure
 Score = 82.7 bits (204), Expect = 2e-20
 Identities = 40/83 (48%), Positives = 58/83 (69%), Gaps = 3/83 (3%)

Query: 14  YEGSCNSLARFVGRNNANGVDLNRNFPDQFDSSSERREQPLNVKKLEPETLAMISFIKNN 73
            EG+C SL  +VGR NA  +DLNR+FPD+ + S   + +  +    +PET A++++I + 
Sbjct: 152 QEGNCESLPNYVGRGNAANIDLNRDFPDRLEQSHVHQLRAQSR---QPETAALVNWIVSK 208

Query: 74  PFVLSGNLHGGAIVASYPFDDSK 96
           PFVLS N HGGA+VASYP+D+S 
Sbjct: 209 PFVLSANFHGGAVVASYPYDNSL 231


>2nsm_A Carboxypeptidase N catalytic chain; caroxypeptidase, zinc peptidase, transthyretin-like domain, processing, peptide modification, hydrolase; HET: NAG; 2.10A {Homo sapiens} Length = 439 Back     alignment and structure
>1h8l_A Carboxypeptidase GP180 residues 503-882; hydrolase, zinc-dependent protease; HET: NAG BMA NDG GEM; 2.6A {Lophonetta specularioides} SCOP: b.3.2.1 c.56.5.1 PDB: 1qmu_A* Length = 380 Back     alignment and structure
>1uwy_A Carboxypeptidase M; metallopeptidase, GPI-anchor, metalloprotease, zinc, lipoprotein, hydrolase, structural proteomics in europe, spine; HET: NAG; 3.0A {Homo sapiens} SCOP: b.3.2.1 c.56.5.1 Length = 426 Back     alignment and structure
>3prt_A Carboxypeptidase T; hydrolase; 1.66A {Thermoactinomyces vulgaris} PDB: 1obr_A 3qnv_A Length = 323 Back     alignment and structure
>4a37_A Metallo-carboxypeptidase; metallo-protease, hydrolase; 1.60A {Pseudomonas aeruginosa} PDB: 4a38_A 4a39_A* Length = 388 Back     alignment and structure
>3k2k_A Putative carboxypeptidase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; 2.49A {Burkholderia mallei atcc 23344} Length = 403 Back     alignment and structure
>1aye_A PCPA2, procarboxypeptidase A2; serine protease, zymogen, hydrolase; 1.80A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 PDB: 1o6x_A Length = 401 Back     alignment and structure
>1jqg_A Carboxypeptidase A; Pro-protein, hydrolase; 2.50A {Helicoverpa armigera} SCOP: c.56.5.1 d.58.3.1 Length = 433 Back     alignment and structure
>1dtd_A Carboxypeptidase A2; carboxypeptidase A2, leech carboxypeptidase inhibitor, hydrolase/hydrolase inhibitor complex; HET: GLU; 1.65A {Homo sapiens} SCOP: c.56.5.1 Length = 303 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
3v38_A 326 Carboxypeptidase T; hydrolase; HET: GOL; 1.50A {Th 99.94
3dgv_A401 TAFI, carboxypeptidase B2; blood coagulation, fibr 99.93
3mn8_A 435 LP15968P; catalytic domain of alpha/beta-hydrolase 99.91
3prt_A 323 Carboxypeptidase T; hydrolase; 1.66A {Thermoactino 99.88
1kwm_A402 Procarboxypeptidase B; hydrolase; HET: CIT; 1.60A 99.88
1dtd_A303 Carboxypeptidase A2; carboxypeptidase A2, leech ca 99.88
1z5r_A306 Procarboxypeptidase B; exopeptidase, hydrolase; 1. 99.88
1aye_A401 PCPA2, procarboxypeptidase A2; serine protease, zy 99.88
2c1c_A 312 Carboxypeptidase B; insect, metalloprotease, insen 99.87
1m4l_A307 Carboxypeptidase A; metalloproteinase, metalloexop 99.87
3d4u_A309 Tafia, carboxypeptidase B2; protease-inhibitor com 99.87
2bo9_A308 Carboxypeptidase A4; metallocarboxypeptidase, X-RA 99.85
2boa_A404 Carboxypeptidase A4; metalloprocarboxypeptidase, X 99.85
1pca_A403 Procarboxypeptidase A PCPA; hydrolase(C-terminal p 99.85
1jqg_A 433 Carboxypeptidase A; Pro-protein, hydrolase; 2.50A 99.85
1h8l_A 380 Carboxypeptidase GP180 residues 503-882; hydrolase 99.83
2nsm_A 439 Carboxypeptidase N catalytic chain; caroxypeptidas 99.83
1uwy_A 426 Carboxypeptidase M; metallopeptidase, GPI-anchor, 99.81
4axv_A243 MPAA; hydrolase; HET: MSE; 2.17A {Vibrio harveyi} 99.68
3b2y_A275 Metallopeptidase containing CO-catalytic metalloa 99.49
2qvp_A275 Uncharacterized protein; putative metallopeptidase 99.46
3l2n_A 395 Peptidase M14, carboxypeptidase A; putative carbox 99.46
3k2k_A 403 Putative carboxypeptidase; structural genomics, jo 99.45
4a37_A 388 Metallo-carboxypeptidase; metallo-protease, hydrol 99.41
3fmc_A 368 Putative succinylglutamate desuccinylase / aspart; 98.75
2qj8_A 332 MLR6093 protein; structural genomics, joint center 98.3
3cdx_A 354 Succinylglutamatedesuccinylase/aspartoacylase; str 98.14
3na6_A 331 Succinylglutamate desuccinylase/aspartoacylase; st 97.09
1yw6_A 335 Succinylglutamate desuccinylase; alpha-beta protei 96.44
2gu2_A 312 ASPA protein; aspartoacylase family, aminoacylase- 95.16
2bco_A 350 Succinylglutamate desuccinylase; NESG, VPR14, stru 94.84
1yw4_A 341 Succinylglutamate desuccinylase; alpha-beta protei 94.32
3nh4_A 327 Aspartoacylase-2; mercapturates, hydrolase; 2.00A 89.96
>3v38_A Carboxypeptidase T; hydrolase; HET: GOL; 1.50A {Thermoactinomyces vulgaris} PDB: 1obr_A 3qnv_A 3prt_A Back     alignment and structure
Probab=99.94  E-value=3.5e-27  Score=180.48  Aligned_cols=90  Identities=19%  Similarity=0.185  Sum_probs=75.6

Q ss_pred             cCCCCceeeecCCccCCCccCCCC-----CCCCcCCCCCCCCCCCCC-C----C-CCCCCCCCCCCcHHHHHHHHHHHhC
Q psy17408          5 CDCKSNWLPYEGSCNSLARFVGRN-----NANGVDLNRNFPDQFDSS-S----E-RREQPLNVKKLEPETLAMISFIKNN   73 (96)
Q Consensus         5 ~~~~~~~~a~~~~~~~~~w~~~R~-----N~~GVDLNRNFp~~w~~~-~----~-~~~y~G~~p~SEpEt~Av~~~~~~~   73 (96)
                      .|+|+++...+.+. ..+|+++|.     +|.|||||||||++|+.. +    . ++.|+|+.|+|||||+||++|++++
T Consensus       111 ~NPDG~~~~~~~~~-~r~WRknR~~~~~~~~~GvDLNRNf~~~w~~~~g~s~~pc~~~Y~G~~p~sEpEt~av~~~i~~~  189 (326)
T 3v38_A          111 INPDGGEYDISSGS-YKSWRKNRQPNSGSSYVGTDLNRNYGYKWGCCGGSSGSPSSETYRGRSAFSAPETAAMRDFINSR  189 (326)
T ss_dssp             SCHHHHHHHHTTSS-CCCCCSCSCCCTTCSCCCCCGGGCSSTTTTCSSSSBSCTTSTTBCCSSTTCSHHHHHHHHHHHHT
T ss_pred             ecCChhhccccCCc-cccccccCCCCCCCCcCccccccCCCcccccCCCCCCCCCccccCCCCCCccHHHHHHHHHHHhh
Confidence            46777777665432 257999986     488999999999999742 1    2 3799999999999999999999986


Q ss_pred             ------CceEEEEeccCCceEEeeCCCC
Q psy17408         74 ------PFVLSGNLHGGAIVASYPFDDS   95 (96)
Q Consensus        74 ------~~~l~is~Hsg~~~i~yPy~~s   95 (96)
                            +|+++|++||++++|+|||+++
T Consensus       190 ~~~~~~~~~~~i~~Hs~~~~il~Pyg~~  217 (326)
T 3v38_A          190 VVGGKQQIKTLITFHTYSELILYPYGYT  217 (326)
T ss_dssp             EETTEECEEEEEEEEESSSEEEESCSSC
T ss_pred             ccccccCeEEEEEecCCCCEEEecCCCC
Confidence                  7999999999999999999986



>3dgv_A TAFI, carboxypeptidase B2; blood coagulation, fibrinolysis, protein S glycoprotein, hydrolase, metal-binding, metalloprotease, PR secreted, zymogen; HET: NAG NDG FUL BMA; 2.50A {Bos taurus} PDB: 3osl_A 3d68_A* 3d66_A* 3d67_A* Back     alignment and structure
>3mn8_A LP15968P; catalytic domain of alpha/beta-hydrolase fold, C-terminal, A transthyretin-like domain, hydrolase; HET: NAG GEM; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3prt_A Carboxypeptidase T; hydrolase; 1.66A {Thermoactinomyces vulgaris} PDB: 1obr_A 3qnv_A Back     alignment and structure
>1kwm_A Procarboxypeptidase B; hydrolase; HET: CIT; 1.60A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 PDB: 3glj_A 1nsa_A 1pba_A Back     alignment and structure
>1dtd_A Carboxypeptidase A2; carboxypeptidase A2, leech carboxypeptidase inhibitor, hydrolase/hydrolase inhibitor complex; HET: GLU; 1.65A {Homo sapiens} SCOP: c.56.5.1 Back     alignment and structure
>1z5r_A Procarboxypeptidase B; exopeptidase, hydrolase; 1.40A {Sus scrofa} SCOP: c.56.5.1 PDB: 1zg7_A* 1zg8_A* 1zg9_A* 2jew_A* 2piy_A* 2piz_A* 2pj0_A* 2pj1_A* 2pj2_A* 2pj3_A* 2pj4_A* 2pj5_A* 2pj6_A* 2pj7_A* 2pj8_A* 2pj9_A* 2pja_A* 2pjb_A* 2pjc_A* 1zli_A ... Back     alignment and structure
>1aye_A PCPA2, procarboxypeptidase A2; serine protease, zymogen, hydrolase; 1.80A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 PDB: 1o6x_A Back     alignment and structure
>2c1c_A Carboxypeptidase B; insect, metalloprotease, insensitive, plant inhibitors, hydrolase; 2.3A {Helicoverpa zea} SCOP: c.56.5.1 Back     alignment and structure
>1m4l_A Carboxypeptidase A; metalloproteinase, metalloexoproteinase, hydrolase; 1.25A {Bos taurus} SCOP: c.56.5.1 PDB: 1cpx_A 1arl_A 1f57_A 2rfh_A* 3i1u_A* 1arm_A 1ell_P 1elm_P 1ee3_P 1zlh_A 2abz_A 3hlp_A 3huv_A 1yme_A* 3fvl_A* 3fx6_A* 2ctc_A* 1hdq_A 2ctb_A* 3kgq_A* ... Back     alignment and structure
>3d4u_A Tafia, carboxypeptidase B2; protease-inhibitor complex, glycoprotein, hydrolase, metal-binding, metalloprotease, protease, secret zymogen; 1.70A {Bos taurus} PDB: 3lms_A Back     alignment and structure
>2bo9_A Carboxypeptidase A4; metallocarboxypeptidase, X-RAY endogenous protein inhibitor, metalloprotease carboxypeptidase, hydrolase; HET: NAG; 1.6A {Homo sapiens} SCOP: c.56.5.1 PDB: 4a94_A 2pcu_A* Back     alignment and structure
>2boa_A Carboxypeptidase A4; metalloprocarboxypeptidase, X-RAY zymogen, metalloprotease, exopropeptidase, hydrolase; HET: NAG; 2.20A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 Back     alignment and structure
>1pca_A Procarboxypeptidase A PCPA; hydrolase(C-terminal peptidase); HET: CIT; 2.00A {Sus scrofa} SCOP: d.58.3.1 PDB: 1pyt_A Back     alignment and structure
>1jqg_A Carboxypeptidase A; Pro-protein, hydrolase; 2.50A {Helicoverpa armigera} SCOP: c.56.5.1 d.58.3.1 Back     alignment and structure
>1h8l_A Carboxypeptidase GP180 residues 503-882; hydrolase, zinc-dependent protease; HET: NAG BMA NDG GEM; 2.6A {Lophonetta specularioides} SCOP: b.3.2.1 c.56.5.1 PDB: 1qmu_A* Back     alignment and structure
>2nsm_A Carboxypeptidase N catalytic chain; caroxypeptidase, zinc peptidase, transthyretin-like domain, processing, peptide modification, hydrolase; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>1uwy_A Carboxypeptidase M; metallopeptidase, GPI-anchor, metalloprotease, zinc, lipoprotein, hydrolase, structural proteomics in europe, spine; HET: NAG; 3.0A {Homo sapiens} SCOP: b.3.2.1 c.56.5.1 Back     alignment and structure
>4axv_A MPAA; hydrolase; HET: MSE; 2.17A {Vibrio harveyi} Back     alignment and structure
>3b2y_A Metallopeptidase containing CO-catalytic metalloa site; metallopeptidase containing CO-catalytic metalloactive site; 1.74A {Shewanella denitrificans OS217} PDB: 3ieh_A* Back     alignment and structure
>2qvp_A Uncharacterized protein; putative metallopeptidase, structural genomics, joint center structural genomics, JCSG; HET: MSE; 2.00A {Shewanella amazonensis} Back     alignment and structure
>3l2n_A Peptidase M14, carboxypeptidase A; putative carboxypeptidase A, structural genomics, joint CENT structural genomics, JCSG; 2.39A {Shewanella denitrificans} Back     alignment and structure
>3k2k_A Putative carboxypeptidase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; 2.49A {Burkholderia mallei atcc 23344} Back     alignment and structure
>4a37_A Metallo-carboxypeptidase; metallo-protease, hydrolase; 1.60A {Pseudomonas aeruginosa} PDB: 4a38_A 4a39_A* Back     alignment and structure
>3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* Back     alignment and structure
>2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} Back     alignment and structure
>3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} Back     alignment and structure
>1yw6_A Succinylglutamate desuccinylase; alpha-beta protein., structural genomics, PSI, protein structure initiative; 3.10A {Escherichia coli} SCOP: c.56.5.7 Back     alignment and structure
>2gu2_A ASPA protein; aspartoacylase family, aminoacylase-2, ACY-2, ACY2_RAT, STRU genomics, PSI, protein structure initiative; HET: MSE; 1.80A {Rattus norvegicus} SCOP: c.56.5.7 PDB: 2q4z_A 2i3c_A 2q51_A 2o4h_A* 2o53_A Back     alignment and structure
>2bco_A Succinylglutamate desuccinylase; NESG, VPR14, structural genomics, PSI, protein structure initiative; 2.33A {Vibrio parahaemolyticus} SCOP: c.56.5.7 PDB: 2g9d_A Back     alignment and structure
>1yw4_A Succinylglutamate desuccinylase; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.00A {Chromobacterium violaceum} SCOP: c.56.5.7 Back     alignment and structure
>3nh4_A Aspartoacylase-2; mercapturates, hydrolase; 2.00A {Mus musculus} SCOP: c.56.5.0 PDB: 3nh5_A 3nfz_A 3nh8_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 96
d1uwya2 296 c.56.5.1 (A:1-296) Carboxypeptidase M, catalytic d 1e-09
d1jqga1 317 c.56.5.1 (A:1-310) Carboxypeptidase A {Cotton boll 4e-09
d2c1ca1 312 c.56.5.1 (A:7-309) Carboxypeptidase B {Corn earwor 1e-08
d1m4la_307 c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) 5e-08
d1ayea1307 c.56.5.1 (A:1-309) Carboxypeptidase A {Human (Homo 1e-07
d2bo9a1305 c.56.5.1 (A:4-307) Carboxypeptidase A {Human (Homo 1e-07
d1h8la2 301 c.56.5.1 (A:4-304) Carboxypeptidase D, catalytic d 1e-07
d1obra_ 323 c.56.5.2 (A:) Carboxypeptidase T {Thermoactinomyce 6e-06
d1z5ra1304 c.56.5.1 (A:6-308) Carboxypeptidase B {Pig (Sus sc 1e-05
>d1uwya2 c.56.5.1 (A:1-296) Carboxypeptidase M, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 296 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Phosphorylase/hydrolase-like
superfamily: Zn-dependent exopeptidases
family: Pancreatic carboxypeptidases
domain: Carboxypeptidase M, catalytic domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 51.0 bits (121), Expect = 1e-09
 Identities = 35/70 (50%), Positives = 46/70 (65%), Gaps = 9/70 (12%)

Query: 26  GRNNANGVDLNRNFPDQFDSSSERREQPLNVKKLEPETLAMISFIKNNPFVLSGNLHGGA 85
           GR N N  DLNRNFPD F+ ++  R+          ET+A++ ++K   FVLS NLHGGA
Sbjct: 126 GRENYNQYDLNRNFPDAFEYNNVSRQP---------ETVAVMKWLKTETFVLSANLHGGA 176

Query: 86  IVASYPFDDS 95
           +VASYPFD+ 
Sbjct: 177 LVASYPFDNG 186


>d1jqga1 c.56.5.1 (A:1-310) Carboxypeptidase A {Cotton bollworm (Helicoverpa armigera) [TaxId: 29058]} Length = 317 Back     information, alignment and structure
>d2c1ca1 c.56.5.1 (A:7-309) Carboxypeptidase B {Corn earworm (Helicoverpa zea) [TaxId: 7113]} Length = 312 Back     information, alignment and structure
>d1m4la_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]} Length = 307 Back     information, alignment and structure
>d1ayea1 c.56.5.1 (A:1-309) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} Length = 307 Back     information, alignment and structure
>d2bo9a1 c.56.5.1 (A:4-307) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1h8la2 c.56.5.1 (A:4-304) Carboxypeptidase D, catalytic domain {Crested duck (Lophonetta specularioides) [TaxId: 8836]} Length = 301 Back     information, alignment and structure
>d1obra_ c.56.5.2 (A:) Carboxypeptidase T {Thermoactinomyces vulgaris [TaxId: 2026]} Length = 323 Back     information, alignment and structure
>d1z5ra1 c.56.5.1 (A:6-308) Carboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823]} Length = 304 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
d1jqga1 317 Carboxypeptidase A {Cotton bollworm (Helicoverpa a 99.9
d1obra_ 323 Carboxypeptidase T {Thermoactinomyces vulgaris [Ta 99.9
d1m4la_307 Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913] 99.89
d1ayea1307 Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9 99.89
d1uwya2 296 Carboxypeptidase M, catalytic domain {Human (Homo 99.89
d2c1ca1 312 Carboxypeptidase B {Corn earworm (Helicoverpa zea) 99.88
d1z5ra1304 Carboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823] 99.86
d1h8la2 301 Carboxypeptidase D, catalytic domain {Crested duck 99.86
d2bo9a1305 Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9 99.82
d1yw4a1 331 Succinylglutamate desuccinylase AstE {Chromobacter 87.0
d1yw6a1 322 Succinylglutamate desuccinylase AstE {Escherichia 83.14
>d1jqga1 c.56.5.1 (A:1-310) Carboxypeptidase A {Cotton bollworm (Helicoverpa armigera) [TaxId: 29058]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Phosphorylase/hydrolase-like
superfamily: Zn-dependent exopeptidases
family: Pancreatic carboxypeptidases
domain: Carboxypeptidase A
species: Cotton bollworm (Helicoverpa armigera) [TaxId: 29058]
Probab=99.90  E-value=7.7e-25  Score=164.86  Aligned_cols=89  Identities=21%  Similarity=0.235  Sum_probs=74.6

Q ss_pred             ccCCCCceeeecCCccCCCccCCC-------CCCCCcCCCCCCCCCCCCCC---C-CCCCCCCCCCCcHHHHHHHHHHHh
Q psy17408          4 YCDCKSNWLPYEGSCNSLARFVGR-------NNANGVDLNRNFPDQFDSSS---E-RREQPLNVKKLEPETLAMISFIKN   72 (96)
Q Consensus         4 ~~~~~~~~~a~~~~~~~~~w~~~R-------~N~~GVDLNRNFp~~w~~~~---~-~~~y~G~~p~SEpEt~Av~~~~~~   72 (96)
                      ..|+|+++...++++.   |+++|       .||+|||||||||..|+...   . .+.|+|+.|+|||||+||++++.+
T Consensus       109 ~~NPDG~~~~~~~~~~---~~knr~~~~~~~~~~~GVDLNRN~~~~w~~~~~~~p~~~~y~G~~p~SEpEt~al~~~~~~  185 (317)
T d1jqga1         109 VANPDGYVHTFGGDRY---WRKNRATGYMAGNLCMGVDLNRNFGMNWGTASSSSVCSDTFHGRSAFSEPESSVIRDIIAE  185 (317)
T ss_dssp             CSCHHHHHHHHSSCTT---CCSCCCCSSSGGGSSCCCCGGGCSSTTTTSSSBCCTTSTTBCCSSTTCSHHHHHHHHHHHH
T ss_pred             eEcchhceeeeccccc---cccCCCCCCCCCCcccCCccccCCCCCCCcccCCCCCccccCCCCccccHHHHHHHHHHHH
Confidence            3578888888777643   56554       46789999999999997542   2 378999999999999999999998


Q ss_pred             CC--ceEEEEeccCCceEEeeCCCC
Q psy17408         73 NP--FVLSGNLHGGAIVASYPFDDS   95 (96)
Q Consensus        73 ~~--~~l~is~Hsg~~~i~yPy~~s   95 (96)
                      ++  |++++++||++++++|||+++
T Consensus       186 ~~~~i~~~vd~Hs~g~~i~yP~~~~  210 (317)
T d1jqga1         186 HRNRMALYLDIHSFGSMILYGYGNG  210 (317)
T ss_dssp             TTTTEEEEEEEEESSSEEEESCTTS
T ss_pred             hccceEEEEeeccCCceEEecCCCC
Confidence            74  888999999999999999875



>d1obra_ c.56.5.2 (A:) Carboxypeptidase T {Thermoactinomyces vulgaris [TaxId: 2026]} Back     information, alignment and structure
>d1m4la_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ayea1 c.56.5.1 (A:1-309) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwya2 c.56.5.1 (A:1-296) Carboxypeptidase M, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c1ca1 c.56.5.1 (A:7-309) Carboxypeptidase B {Corn earworm (Helicoverpa zea) [TaxId: 7113]} Back     information, alignment and structure
>d1z5ra1 c.56.5.1 (A:6-308) Carboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1h8la2 c.56.5.1 (A:4-304) Carboxypeptidase D, catalytic domain {Crested duck (Lophonetta specularioides) [TaxId: 8836]} Back     information, alignment and structure
>d2bo9a1 c.56.5.1 (A:4-307) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yw4a1 c.56.5.7 (A:2-332) Succinylglutamate desuccinylase AstE {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d1yw6a1 c.56.5.7 (A:1-322) Succinylglutamate desuccinylase AstE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure