Psyllid ID: psy17408
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 96 | ||||||
| 242015953 | 1268 | carboxypeptidase D precursor, putative [ | 0.802 | 0.060 | 0.641 | 9e-23 | |
| 312385094 | 1268 | hypothetical protein AND_01175 [Anophele | 0.812 | 0.061 | 0.580 | 2e-20 | |
| 347967818 | 1457 | AGAP002414-PA [Anopheles gambiae str. PE | 0.812 | 0.053 | 0.555 | 6e-19 | |
| 345490273 | 1668 | PREDICTED: carboxypeptidase D-like [Naso | 0.75 | 0.043 | 0.569 | 2e-18 | |
| 332374584 | 433 | unknown [Dendroctonus ponderosae] | 0.802 | 0.177 | 0.580 | 2e-18 | |
| 403183363 | 1457 | AAEL017499-PA [Aedes aegypti] | 0.812 | 0.053 | 0.567 | 4e-18 | |
| 321464268 | 1292 | hypothetical protein DAPPUDRAFT_250728 [ | 0.843 | 0.062 | 0.578 | 4e-18 | |
| 194768873 | 1607 | GF21938 [Drosophila ananassae] gi|190617 | 0.843 | 0.050 | 0.535 | 5e-18 | |
| 380020297 | 1671 | PREDICTED: carboxypeptidase D-like [Apis | 0.822 | 0.047 | 0.575 | 6e-18 | |
| 328785691 | 1612 | PREDICTED: carboxypeptidase D-like [Apis | 0.822 | 0.049 | 0.575 | 6e-18 |
| >gi|242015953|ref|XP_002428607.1| carboxypeptidase D precursor, putative [Pediculus humanus corporis] gi|212513251|gb|EEB15869.1| carboxypeptidase D precursor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 110 bits (276), Expect = 9e-23, Method: Compositional matrix adjust.
Identities = 52/81 (64%), Positives = 66/81 (81%), Gaps = 4/81 (4%)
Query: 15 EGSCNSLARFVGRNNANGVDLNRNFPDQFDSSSERREQPLNVKKLEPETLAMISFIKNNP 74
EG+C+SL FVGR NANG+DLNR+FPDQFD +R +++K +PETLAM+ +I NP
Sbjct: 151 EGNCDSLPGFVGRTNANGIDLNRDFPDQFDYIFKRP----SIRKYQPETLAMMKWIVQNP 206
Query: 75 FVLSGNLHGGAIVASYPFDDS 95
FVLSGNLHGGA+VASYPFD++
Sbjct: 207 FVLSGNLHGGAVVASYPFDNA 227
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|312385094|gb|EFR29672.1| hypothetical protein AND_01175 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|347967818|ref|XP_312538.5| AGAP002414-PA [Anopheles gambiae str. PEST] gi|333468289|gb|EAA07478.5| AGAP002414-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|345490273|ref|XP_003426341.1| PREDICTED: carboxypeptidase D-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|332374584|gb|AEE62433.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
| >gi|403183363|gb|EJY58039.1| AAEL017499-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|321464268|gb|EFX75277.1| hypothetical protein DAPPUDRAFT_250728 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|194768873|ref|XP_001966535.1| GF21938 [Drosophila ananassae] gi|190617299|gb|EDV32823.1| GF21938 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|380020297|ref|XP_003694026.1| PREDICTED: carboxypeptidase D-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|328785691|ref|XP_003250638.1| PREDICTED: carboxypeptidase D-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 96 | ||||||
| FB|FBgn0004648 | 1406 | svr "silver" [Drosophila melan | 0.843 | 0.057 | 0.5 | 3.5e-17 | |
| UNIPROTKB|P83852 | 380 | CPD "Carboxypeptidase D" [Loph | 0.656 | 0.165 | 0.555 | 3.3e-15 | |
| ZFIN|ZDB-GENE-081112-2 | 1350 | cpda "carboxypeptidase D, a" [ | 0.75 | 0.053 | 0.543 | 7.3e-15 | |
| UNIPROTKB|E1C7M0 | 453 | CPN1 "Uncharacterized protein" | 0.812 | 0.172 | 0.522 | 1.2e-14 | |
| RGD|70931 | 457 | Cpn1 "carboxypeptidase N, poly | 0.802 | 0.168 | 0.528 | 1.5e-14 | |
| UNIPROTKB|Q9EQV8 | 457 | Cpn1 "Carboxypeptidase N catal | 0.802 | 0.168 | 0.528 | 1.5e-14 | |
| MGI|MGI:2135874 | 457 | Cpn1 "carboxypeptidase N, poly | 0.802 | 0.168 | 0.517 | 2e-14 | |
| UNIPROTKB|F6XTZ1 | 376 | CPN1 "Uncharacterized protein" | 0.802 | 0.204 | 0.528 | 2.5e-14 | |
| UNIPROTKB|E1BLR9 | 1108 | LOC532189 "Uncharacterized pro | 0.697 | 0.060 | 0.526 | 2.5e-14 | |
| ZFIN|ZDB-GENE-041210-191 | 446 | cpm "carboxypeptidase M" [Dani | 0.770 | 0.165 | 0.5 | 3.1e-14 |
| FB|FBgn0004648 svr "silver" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 225 (84.3 bits), Expect = 3.5e-17, P = 3.5e-17
Identities = 42/84 (50%), Positives = 59/84 (70%)
Query: 12 LPYEGSCNSLARFVGRNNANGVDLNRNFPDQFDSSSERREQPLNVKKLEPETLAMISFIK 71
L EG+C SL +VGR NA +DLNR+FPD+ + S + L + +PET A++++I
Sbjct: 150 LSQEGNCESLPNYVGRGNAANIDLNRDFPDRLEQSHVHQ---LRAQSRQPETAALVNWIV 206
Query: 72 NNPFVLSGNLHGGAIVASYPFDDS 95
+ PFVLS N HGGA+VASYP+D+S
Sbjct: 207 SKPFVLSANFHGGAVVASYPYDNS 230
|
|
| UNIPROTKB|P83852 CPD "Carboxypeptidase D" [Lophonetta specularioides (taxid:75873)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-081112-2 cpda "carboxypeptidase D, a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C7M0 CPN1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|70931 Cpn1 "carboxypeptidase N, polypeptide 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9EQV8 Cpn1 "Carboxypeptidase N catalytic chain" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2135874 Cpn1 "carboxypeptidase N, polypeptide 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6XTZ1 CPN1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BLR9 LOC532189 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041210-191 cpm "carboxypeptidase M" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 96 | |||
| cd03868 | 293 | cd03868, M14_CPD_I, Peptidase M14 carboxypeptidase | 4e-34 | |
| cd03858 | 293 | cd03858, M14_CP_N-E_like, Peptidase M14 carboxypep | 7e-33 | |
| cd03864 | 313 | cd03864, M14_CPN, Peptidase M14 carboxypeptidase s | 2e-22 | |
| cd03866 | 292 | cd03866, M14_CPM, Peptidase M14 carboxypeptidase s | 7e-22 | |
| cd03863 | 296 | cd03863, M14_CPD_II, Peptidase M14 carboxypeptidas | 1e-20 | |
| pfam00246 | 277 | pfam00246, Peptidase_M14, Zinc carboxypeptidase | 4e-20 | |
| cd03865 | 323 | cd03865, M14_CPE, Peptidase M14 carboxypeptidase s | 1e-17 | |
| smart00631 | 277 | smart00631, Zn_pept, Zn_pept domain | 2e-17 | |
| cd03867 | 315 | cd03867, M14_CPZ, Peptidase M14 carboxypeptidase s | 2e-17 | |
| cd00596 | 211 | cd00596, Peptidase_M14_like, M14 family of metallo | 1e-14 | |
| cd03869 | 326 | cd03869, M14_CPX_like, Peptidase M14 carboxypeptid | 3e-13 | |
| cd06245 | 284 | cd06245, M14_CPD_III, Peptidase M14 carboxypeptida | 5e-09 | |
| cd06229 | 256 | cd06229, M14_Endopeptidase_I, Peptidase M14 carbox | 3e-08 | |
| cd06904 | 178 | cd06904, M14_MpaA_like, Peptidase M14-like domain | 4e-07 | |
| PRK10602 | 237 | PRK10602, PRK10602, murein peptide amidase A; Prov | 1e-06 | |
| cd03862 | 273 | cd03862, M14-like_7, Peptidase M14-like domain; un | 1e-05 | |
| cd06227 | 269 | cd06227, M14-like_2, Peptidase M14-like domain; un | 2e-05 | |
| cd06905 | 360 | cd06905, M14-like_8, Peptidase M14-like domain; un | 3e-04 | |
| cd03860 | 293 | cd03860, M14_CP_A-B_like, Peptidase M14 carboxypep | 3e-04 |
| >gnl|CDD|199850 cd03868, M14_CPD_I, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase D, domain I subgroup | Back alignment and domain information |
|---|
Score = 118 bits (297), Expect = 4e-34
Identities = 48/82 (58%), Positives = 60/82 (73%), Gaps = 7/82 (8%)
Query: 15 EGSCNSLARFVGRNNANGVDLNRNFPDQFDSSSERREQPLNVKKLEPETLAMISFIKNNP 74
EG C S + GR NAN VDLNRNFPDQF+ R ++ +PETLAMI++I++NP
Sbjct: 114 EGDC-SCGGYGGRGNANNVDLNRNFPDQFEGKHVR------AQERQPETLAMINWIRSNP 166
Query: 75 FVLSGNLHGGAIVASYPFDDSK 96
FVLS NLHGG++VASYP+DDS
Sbjct: 167 FVLSANLHGGSVVASYPYDDSS 188
|
The first carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3.4.17.22), domain I. CPD differs from all other metallocarboxypeptidases in that it contains multiple CP-like domains. CPD belongs to the N/E-like subfamily of the M14 family of metallocarboxypeptidases (MCPs).The M14 family are zinc-binding CPs which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. CPD is a single-chain protein containing a signal peptide, three tandem repeats of CP-like domains separated by short bridge regions, followed by a transmembrane domain, and a C-terminal cytosolic tail. The first two CP-like domains of CPD contain all of the essential active site and substrate-binding residues, the third CP-like domain lacks critical residues necessary for enzymatic activity and is inactive towards standard CP substrates. Domain I is optimally active at pH 6.3-7.5 and prefers substrates with C-terminal Arg, whereas domain II is active at pH 5.0-6.5 and prefers substrates with C-terminal Lys. This Domain I family contains two contiguous surface cysteines that may become palmitoylated and target the enzyme to membranes, thus regulating intracellular trafficking. CPD functions in the processing of proteins that transit the secretory pathway, and is present in all vertebrates as well as Drosophila. It is broadly distributed in all tissue types. Within cells, CPD is present in the trans Golgi network and immature secretory vesicles, but is excluded from mature vesicles. It is thought to play a role in the processing of proteins that are initially processed by furin or related endopeptidases present in the trans Golgi network, such as growth factors and receptors. CPD is implicated in the pathogenesis of lupus erythematosus (LE), it is regulated by TGF-beta in various cell types of murine and human origin and is significantly down-regulated in CD14 positive cells isolated from patients with LE. As down-regulation of CPD leads to down-modulation of TGF-beta, CPD may have a role in a positive feedback loop. In D. melanogaster, the CPD variant 1B short (DmCPD1Bs) is necessary and sufficient for viability of the fruit fly. Length = 293 |
| >gnl|CDD|199842 cd03858, M14_CP_N-E_like, Peptidase M14 carboxypeptidase subfamily N/E-like | Back alignment and domain information |
|---|
| >gnl|CDD|199846 cd03864, M14_CPN, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase N subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|199848 cd03866, M14_CPM, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase M subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|199845 cd03863, M14_CPD_II, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase D, domain II subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|215816 pfam00246, Peptidase_M14, Zinc carboxypeptidase | Back alignment and domain information |
|---|
| >gnl|CDD|199847 cd03865, M14_CPE, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase E subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|214748 smart00631, Zn_pept, Zn_pept domain | Back alignment and domain information |
|---|
| >gnl|CDD|199849 cd03867, M14_CPZ, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase Z subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|199839 cd00596, Peptidase_M14_like, M14 family of metallocarboxypeptidases and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|199851 cd03869, M14_CPX_like, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase X subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|199867 cd06245, M14_CPD_III, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase D, domain III subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|199855 cd06229, M14_Endopeptidase_I, Peptidase M14 carboxypeptidase family-like domain of Endopeptidase I | Back alignment and domain information |
|---|
| >gnl|CDD|133114 cd06904, M14_MpaA_like, Peptidase M14-like domain of Escherichia coli Murein Peptide Amidase A and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|182582 PRK10602, PRK10602, murein peptide amidase A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133073 cd03862, M14-like_7, Peptidase M14-like domain; uncharacterized subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|199854 cd06227, M14-like_2, Peptidase M14-like domain; uncharacterized subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|199875 cd06905, M14-like_8, Peptidase M14-like domain; uncharacterized subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|199844 cd03860, M14_CP_A-B_like, Peptidase M14 carboxypeptidase subfamily A/B-like | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 96 | |||
| cd03869 | 405 | M14_CPX_like Peptidase M14-like domain of carboxyp | 99.95 | |
| cd06246 | 300 | M14_CPB2 Peptidase M14 Carboxypeptidase (CP) B2 (C | 99.95 | |
| cd03870 | 301 | M14_CPA Peptidase M14 Carboxypeptidase (CP) A (CPA | 99.94 | |
| cd03872 | 300 | M14_CPA6 Carboxypeptidase (CP) A6 (CPA6, also know | 99.94 | |
| KOG2650|consensus | 418 | 99.94 | ||
| cd06247 | 298 | M14_CPO Peptidase M14 carboxypeptidase (CP) O (CPO | 99.94 | |
| cd03864 | 392 | M14_CPN Peptidase M14 Carboxypeptidase N (CPN, als | 99.93 | |
| cd06227 | 272 | Peptidase_M14-like_2 A functionally uncharacterize | 99.93 | |
| cd03871 | 300 | M14_CPB Peptidase M14 Carboxypeptidase B (CPB) bel | 99.93 | |
| cd06228 | 332 | Peptidase_M14-like_3 A functionally uncharacterize | 99.93 | |
| cd03867 | 395 | M14_CPZ Peptidase M14-like domain of carboxypeptid | 99.93 | |
| cd06248 | 304 | M14_CPA_CPB_like Peptidase M14 Carboxypeptidase A/ | 99.93 | |
| cd06226 | 293 | M14_CPT_like Peptidase M14-like domain of an uncha | 99.93 | |
| cd03868 | 372 | M14_CPD_I The first carboxypeptidase (CP)-like dom | 99.92 | |
| cd03859 | 295 | M14_CPT Peptidase M14-like domain of carboxypeptid | 99.92 | |
| cd03863 | 375 | M14_CPD_II The second carboxypeptidase (CP)-like d | 99.92 | |
| cd06245 | 363 | M14_CPD_III The third carboxypeptidase (CP)-like d | 99.91 | |
| cd03865 | 402 | M14_CPE_H Peptidase M14 Carboxypeptidase (CP) E (C | 99.91 | |
| smart00631 | 277 | Zn_pept Zn_pept. | 99.91 | |
| cd03858 | 374 | M14_CP_N-E_like Carboxypeptidase (CP) N/E-like sub | 99.91 | |
| cd06229 | 255 | M14_Endopeptidase_I Peptidase M14-like domain of G | 99.91 | |
| cd03860 | 294 | M14_CP_A-B_like The Peptidase M14 Carboxypeptidase | 99.9 | |
| cd03866 | 376 | M14_CPM Peptidase M14 Carboxypeptidase (CP) M (CPM | 99.9 | |
| cd06905 | 360 | Peptidase_M14-like_8 A functionally uncharacterize | 99.9 | |
| PF00246 | 279 | Peptidase_M14: Zinc carboxypeptidase This is famil | 99.86 | |
| cd03862 | 273 | Peptidase_M14-like_7 A functionally uncharacterize | 99.86 | |
| KOG2649|consensus | 500 | 99.84 | ||
| cd06904 | 178 | M14_MpaA_like Peptidase M14-like domain of Escheri | 99.74 | |
| cd00596 | 196 | Peptidase_M14_like The M14 family of metallocarbox | 99.67 | |
| PRK10602 | 237 | murein peptide amidase A; Provisional | 99.67 | |
| cd06237 | 244 | M14_Nna1_like_3 A bacterial subgroup of the Peptid | 99.64 | |
| cd06908 | 261 | M14_AGBL4_like Peptidase M14-like domain of ATP/GT | 99.58 | |
| cd06234 | 263 | M14_Nna1_like_1 A bacterial subgroup of the Peptid | 99.58 | |
| cd03856 | 269 | M14_Nna1_like Peptidase M14-like domain of Nna-1 ( | 99.45 | |
| cd06238 | 271 | Peptidase_M14-like_1_1 Peptidase M14-like domain o | 99.4 | |
| cd06235 | 258 | M14_Nna1_like_2 Subgroup of the Peptidase M14-like | 99.35 | |
| cd06239 | 231 | Peptidase_M14-like_1_2 Peptidase M14-like domain o | 99.32 | |
| cd06244 | 268 | Peptidase_M14-like_1_7 Peptidase M14-like domain o | 99.29 | |
| cd06243 | 236 | Peptidase_M14-like_1_6 Peptidase M14-like domain o | 99.2 | |
| cd06241 | 266 | Peptidase_M14-like_1_4 Peptidase M14-like domain o | 99.15 | |
| cd06236 | 304 | M14_AGBL5_like Peptidase M14-like domain of ATP/GT | 99.15 | |
| cd03857 | 226 | Peptidase_M14-like_1 Peptidase M14-like domain of | 99.15 | |
| cd06231 | 236 | Peptidase_M14-like_4 A functionally uncharacterize | 99.02 | |
| cd06907 | 261 | M14_AGBL2-3_like Peptidase M14-like domain of ATP/ | 98.98 | |
| cd06242 | 268 | Peptidase_M14-like_1_5 Peptidase M14-like domain o | 98.98 | |
| cd06906 | 278 | M14_Nna1 Peptidase M14-like domain of Nna-1 (Nervo | 98.48 | |
| cd06233 | 283 | Peptidase_M14-like_6 Peptidase M14-like domain of | 97.49 | |
| cd06240 | 273 | Peptidase_M14-like_1_3 Peptidase M14-like domain o | 97.43 | |
| PF10994 | 341 | DUF2817: Protein of unknown function (DUF2817); In | 97.43 | |
| cd06254 | 288 | M14_ASTE_ASPA_like_4 A functionally uncharacterize | 96.9 | |
| cd06251 | 287 | M14_ASTE_ASPA_like_1 A functionally uncharacterize | 96.71 | |
| cd06250 | 359 | M14_PaAOTO_like An uncharacterized subgroup of the | 96.56 | |
| cd06230 | 252 | M14_ASTE_ASPA_like The Peptidase M14 Succinylgluta | 96.51 | |
| cd06255 | 293 | M14_ASTE_ASPA_like_5 A functionally uncharacterize | 95.97 | |
| cd06252 | 316 | M14_ASTE_ASPA_like_2 A functionally uncharacterize | 95.44 | |
| cd06232 | 240 | Peptidase_M14-like_5 Peptidase M14-like domain of | 95.27 | |
| TIGR02994 | 325 | ectoine_eutE ectoine utilization protein EutE. Mem | 95.16 | |
| PF04952 | 292 | AstE_AspA: Succinylglutamate desuccinylase / Aspar | 94.93 | |
| cd06253 | 298 | M14_ASTE_ASPA_like_3 A functionally uncharacterize | 94.8 | |
| cd06909 | 282 | M14_ASPA Aspartoacylase (ASPA) belongs to the Succ | 93.15 | |
| PRK02259 | 288 | aspartoacylase; Provisional | 92.86 | |
| COG2866 | 374 | Predicted carboxypeptidase [Amino acid transport a | 92.77 | |
| cd06910 | 272 | M14_ASTE_ASPA_like_7 A functionally uncharacterize | 92.68 | |
| cd06256 | 327 | M14_ASTE_ASPA_like_6 A functionally uncharacterize | 92.6 | |
| KOG3641|consensus | 650 | 92.35 | ||
| cd03855 | 322 | M14_ASTE Peptidase M14 Succinylglutamate desucciny | 90.74 | |
| COG3608 | 331 | Predicted deacylase [General function prediction o | 87.5 | |
| PRK05324 | 329 | succinylglutamate desuccinylase; Provisional | 82.67 |
| >cd03869 M14_CPX_like Peptidase M14-like domain of carboxypeptidase (CP)-like protein X (CPX), CPX forms a distinct subgroup of the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
Probab=99.95 E-value=5.8e-28 Score=191.36 Aligned_cols=93 Identities=31% Similarity=0.538 Sum_probs=83.3
Q ss_pred ccCCCCceeeecCCccCCCccCCCCCCCCcCCCCCCCC----CCCCCC-------------C-CCCCCCCCCCCcHHHHH
Q psy17408 4 YCDCKSNWLPYEGSCNSLARFVGRNNANGVDLNRNFPD----QFDSSS-------------E-RREQPLNVKKLEPETLA 65 (96)
Q Consensus 4 ~~~~~~~~~a~~~~~~~~~w~~~R~N~~GVDLNRNFp~----~w~~~~-------------~-~~~y~G~~p~SEpEt~A 65 (96)
-.|||+++.+.+++++..+|+++|+||+|||||||||+ .|+..+ . ++.|.|+.|+|||||+|
T Consensus 108 ~~NPDG~e~s~~~~~~~~~Wrk~R~na~GVDLNRNFp~~~~~~W~~~~~~~~~~~~~~~~~Pc~~~Y~G~~~~sEPET~A 187 (405)
T cd03869 108 SMNPDGYEKAYEAGSELGGWALGRWTEEGIDINHNFPDLNTILWEAEDKKKVPRKVPNHHIPIPEWYLSENATVAPETRA 187 (405)
T ss_pred eeCCchhhhhhhcCccccccccCccCCCCccccCCCcccccccccccccccccccccccCCCCccccCCCCCCCcHHHHH
Confidence 36899999999988888899999999999999999996 676321 1 36899999999999999
Q ss_pred HHHHHHhCCceEEEEeccCCceEEeeCCCCC
Q psy17408 66 MISFIKNNPFVLSGNLHGGAIVASYPFDDSK 96 (96)
Q Consensus 66 v~~~~~~~~~~l~is~Hsg~~~i~yPy~~s~ 96 (96)
|++|+++++|+|++++|+|..+++||||+++
T Consensus 188 v~~~i~~~~FvLSanlHgG~lv~~YPyd~~~ 218 (405)
T cd03869 188 VIAWMEKIPFVLGANLQGGELVVSYPYDMTR 218 (405)
T ss_pred HHHHHHhCCceEEEEecCccEEEEcCccccc
Confidence 9999999999999999999999999999863
|
The M14 family are zinc-binding CPs which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. Proteins belonging to this subgroup include CP-like protein X1 (CPX1), CP-like protein X2 (CPX2), and aortic CP-like protein (ACLP) and its isoform adipocyte enhancer binding protein-1 (AEBP1). AEBP1 is a truncated form of ACLP, which may arise from alternative splicing of the gene. These proteins are inactive towards standard CP substrates because they lack one or more critical active site and substrate-binding residues that are necessary for activity. They may function as binding proteins rather than as active CPs or display catalytic activity toward other substrates. Pro |
| >cd06246 M14_CPB2 Peptidase M14 Carboxypeptidase (CP) B2 (CPB2, also known as plasma carboxypeptidase B, carboxypeptidase U, and CPU), belongs to the carboxpeptidase A/B subfamily of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd03870 M14_CPA Peptidase M14 Carboxypeptidase (CP) A (CPA) belongs to the A/B subfamily of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd03872 M14_CPA6 Carboxypeptidase (CP) A6 (CPA6, also known as CPAH; EC 3 | Back alignment and domain information |
|---|
| >KOG2650|consensus | Back alignment and domain information |
|---|
| >cd06247 M14_CPO Peptidase M14 carboxypeptidase (CP) O (CPO, also known as metallocarboxypeptidase C; EC 3 | Back alignment and domain information |
|---|
| >cd03864 M14_CPN Peptidase M14 Carboxypeptidase N (CPN, also known as kininase I, creatine kinase conversion factor, plasma carboxypeptidase B, arginine carboxypeptidase, and protaminase; EC 3 | Back alignment and domain information |
|---|
| >cd06227 Peptidase_M14-like_2 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd03871 M14_CPB Peptidase M14 Carboxypeptidase B (CPB) belongs to the carboxypeptidase A/B subfamily of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06228 Peptidase_M14-like_3 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd03867 M14_CPZ Peptidase M14-like domain of carboxypeptidase (CP) Z (CPZ), CPZ belongs to the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06248 M14_CPA_CPB_like Peptidase M14 Carboxypeptidase A/B-like subfamily: This is one of two main M14 carboxypeptidase subfamilies, defined by sequence and structural homology, the other being N/E | Back alignment and domain information |
|---|
| >cd06226 M14_CPT_like Peptidase M14-like domain of an uncharacterized group of Peptidase M14 Carboxypeptidase (CP) T (CPT)-like proteins | Back alignment and domain information |
|---|
| >cd03868 M14_CPD_I The first carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 | Back alignment and domain information |
|---|
| >cd03859 M14_CPT Peptidase M14-like domain of carboxypeptidase (CP) T (CPT), CPT belongs to the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd03863 M14_CPD_II The second carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 | Back alignment and domain information |
|---|
| >cd06245 M14_CPD_III The third carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 | Back alignment and domain information |
|---|
| >cd03865 M14_CPE_H Peptidase M14 Carboxypeptidase (CP) E (CPE, also known as carboxypeptidase H, and enkephalin convertase; EC 3 | Back alignment and domain information |
|---|
| >smart00631 Zn_pept Zn_pept | Back alignment and domain information |
|---|
| >cd03858 M14_CP_N-E_like Carboxypeptidase (CP) N/E-like subfamily of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06229 M14_Endopeptidase_I Peptidase M14-like domain of Gamma-D-glutamyl-L-diamino acid endopeptidase 1 (also known as Gamma-D-glutamyl-meso-diaminopimelate peptidase I, and Endopeptidase I (ENP1); EC 3 | Back alignment and domain information |
|---|
| >cd03860 M14_CP_A-B_like The Peptidase M14 Carboxypeptidase (CP) A/B subfamily is one of two main M14 CP subfamilies defined by sequence and structural homology, the other being the N/E subfamily | Back alignment and domain information |
|---|
| >cd03866 M14_CPM Peptidase M14 Carboxypeptidase (CP) M (CPM) belongs to the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06905 Peptidase_M14-like_8 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >PF00246 Peptidase_M14: Zinc carboxypeptidase This is family M14 in the peptidase classification | Back alignment and domain information |
|---|
| >cd03862 Peptidase_M14-like_7 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >KOG2649|consensus | Back alignment and domain information |
|---|
| >cd06904 M14_MpaA_like Peptidase M14-like domain of Escherichia coli Murein Peptide Amidase A (MpaA) and related proteins | Back alignment and domain information |
|---|
| >cd00596 Peptidase_M14_like The M14 family of metallocarboxypeptidases (MCPs) are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity | Back alignment and domain information |
|---|
| >PRK10602 murein peptide amidase A; Provisional | Back alignment and domain information |
|---|
| >cd06237 M14_Nna1_like_3 A bacterial subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP),-like proteins | Back alignment and domain information |
|---|
| >cd06908 M14_AGBL4_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-4, and related proteins | Back alignment and domain information |
|---|
| >cd06234 M14_Nna1_like_1 A bacterial subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP)-like proteins | Back alignment and domain information |
|---|
| >cd03856 M14_Nna1_like Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins | Back alignment and domain information |
|---|
| >cd06238 Peptidase_M14-like_1_1 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06235 M14_Nna1_like_2 Subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins | Back alignment and domain information |
|---|
| >cd06239 Peptidase_M14-like_1_2 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06244 Peptidase_M14-like_1_7 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06243 Peptidase_M14-like_1_6 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06241 Peptidase_M14-like_1_4 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06236 M14_AGBL5_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-5, and related proteins | Back alignment and domain information |
|---|
| >cd03857 Peptidase_M14-like_1 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06231 Peptidase_M14-like_4 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06907 M14_AGBL2-3_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-2, and related proteins | Back alignment and domain information |
|---|
| >cd06242 Peptidase_M14-like_1_5 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06906 M14_Nna1 Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins | Back alignment and domain information |
|---|
| >cd06233 Peptidase_M14-like_6 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06240 Peptidase_M14-like_1_3 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >PF10994 DUF2817: Protein of unknown function (DUF2817); InterPro: IPR021259 This family of proteins has no known function | Back alignment and domain information |
|---|
| >cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06230 M14_ASTE_ASPA_like The Peptidase M14 Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily belongs to the M14 family of metallocarboxypeptidases (MCPs), and includes ASTE, which catalyzes the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway, and aspartoacylase (ASPA, also known as aminoacylase 2, and ACY-2; EC:3 | Back alignment and domain information |
|---|
| >cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06232 Peptidase_M14-like_5 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >TIGR02994 ectoine_eutE ectoine utilization protein EutE | Back alignment and domain information |
|---|
| >PF04952 AstE_AspA: Succinylglutamate desuccinylase / Aspartoacylase family; InterPro: IPR007036 This family describes both succinylglutamate desuccinylase that catalyses the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway and also includes aspartoacylase 3 | Back alignment and domain information |
|---|
| >cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06909 M14_ASPA Aspartoacylase (ASPA) belongs to the Succinylglutamate desuccinylase/aspartoacylase subfamily of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PRK02259 aspartoacylase; Provisional | Back alignment and domain information |
|---|
| >COG2866 Predicted carboxypeptidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd06910 M14_ASTE_ASPA_like_7 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06256 M14_ASTE_ASPA_like_6 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >KOG3641|consensus | Back alignment and domain information |
|---|
| >cd03855 M14_ASTE Peptidase M14 Succinylglutamate desuccinylase (ASTE, also known as N-succinyl-L-glutamate amidohydrolase, N2-succinylglutamate desuccinylase, and SGDS; EC 3 | Back alignment and domain information |
|---|
| >COG3608 Predicted deacylase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05324 succinylglutamate desuccinylase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 96 | ||||
| 3mn8_A | 435 | Structure Of Drosophila Melanogaster Carboxypeptida | 3e-19 | ||
| 1qmu_A | 380 | Duck Carboxypeptidase D Domain Ii Length = 380 | 8e-17 | ||
| 2nsm_A | 439 | Crystal Structure Of The Human Carboxypeptidase N ( | 1e-15 | ||
| 1uwy_A | 426 | Crystal Structure Of Human Carboxypeptidase M Lengt | 2e-14 |
| >pdb|3MN8|A Chain A, Structure Of Drosophila Melanogaster Carboxypeptidase D Isoform 1b Short Length = 435 | Back alignment and structure |
|
| >pdb|1QMU|A Chain A, Duck Carboxypeptidase D Domain Ii Length = 380 | Back alignment and structure |
| >pdb|2NSM|A Chain A, Crystal Structure Of The Human Carboxypeptidase N (kininase I) Catalytic Domain Length = 439 | Back alignment and structure |
| >pdb|1UWY|A Chain A, Crystal Structure Of Human Carboxypeptidase M Length = 426 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 96 | |||
| 3mn8_A | 435 | LP15968P; catalytic domain of alpha/beta-hydrolase | 2e-20 | |
| 2nsm_A | 439 | Carboxypeptidase N catalytic chain; caroxypeptidas | 3e-20 | |
| 1h8l_A | 380 | Carboxypeptidase GP180 residues 503-882; hydrolase | 3e-17 | |
| 1uwy_A | 426 | Carboxypeptidase M; metallopeptidase, GPI-anchor, | 5e-16 | |
| 3prt_A | 323 | Carboxypeptidase T; hydrolase; 1.66A {Thermoactino | 8e-12 | |
| 4a37_A | 388 | Metallo-carboxypeptidase; metallo-protease, hydrol | 9e-08 | |
| 3k2k_A | 403 | Putative carboxypeptidase; structural genomics, jo | 6e-06 | |
| 1aye_A | 401 | PCPA2, procarboxypeptidase A2; serine protease, zy | 3e-04 | |
| 1jqg_A | 433 | Carboxypeptidase A; Pro-protein, hydrolase; 2.50A | 5e-04 | |
| 1dtd_A | 303 | Carboxypeptidase A2; carboxypeptidase A2, leech ca | 8e-04 |
| >3mn8_A LP15968P; catalytic domain of alpha/beta-hydrolase fold, C-terminal, A transthyretin-like domain, hydrolase; HET: NAG GEM; 2.70A {Drosophila melanogaster} Length = 435 | Back alignment and structure |
|---|
Score = 82.7 bits (204), Expect = 2e-20
Identities = 40/83 (48%), Positives = 58/83 (69%), Gaps = 3/83 (3%)
Query: 14 YEGSCNSLARFVGRNNANGVDLNRNFPDQFDSSSERREQPLNVKKLEPETLAMISFIKNN 73
EG+C SL +VGR NA +DLNR+FPD+ + S + + + +PET A++++I +
Sbjct: 152 QEGNCESLPNYVGRGNAANIDLNRDFPDRLEQSHVHQLRAQSR---QPETAALVNWIVSK 208
Query: 74 PFVLSGNLHGGAIVASYPFDDSK 96
PFVLS N HGGA+VASYP+D+S
Sbjct: 209 PFVLSANFHGGAVVASYPYDNSL 231
|
| >2nsm_A Carboxypeptidase N catalytic chain; caroxypeptidase, zinc peptidase, transthyretin-like domain, processing, peptide modification, hydrolase; HET: NAG; 2.10A {Homo sapiens} Length = 439 | Back alignment and structure |
|---|
| >1h8l_A Carboxypeptidase GP180 residues 503-882; hydrolase, zinc-dependent protease; HET: NAG BMA NDG GEM; 2.6A {Lophonetta specularioides} SCOP: b.3.2.1 c.56.5.1 PDB: 1qmu_A* Length = 380 | Back alignment and structure |
|---|
| >1uwy_A Carboxypeptidase M; metallopeptidase, GPI-anchor, metalloprotease, zinc, lipoprotein, hydrolase, structural proteomics in europe, spine; HET: NAG; 3.0A {Homo sapiens} SCOP: b.3.2.1 c.56.5.1 Length = 426 | Back alignment and structure |
|---|
| >3prt_A Carboxypeptidase T; hydrolase; 1.66A {Thermoactinomyces vulgaris} PDB: 1obr_A 3qnv_A Length = 323 | Back alignment and structure |
|---|
| >4a37_A Metallo-carboxypeptidase; metallo-protease, hydrolase; 1.60A {Pseudomonas aeruginosa} PDB: 4a38_A 4a39_A* Length = 388 | Back alignment and structure |
|---|
| >3k2k_A Putative carboxypeptidase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; 2.49A {Burkholderia mallei atcc 23344} Length = 403 | Back alignment and structure |
|---|
| >1aye_A PCPA2, procarboxypeptidase A2; serine protease, zymogen, hydrolase; 1.80A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 PDB: 1o6x_A Length = 401 | Back alignment and structure |
|---|
| >1jqg_A Carboxypeptidase A; Pro-protein, hydrolase; 2.50A {Helicoverpa armigera} SCOP: c.56.5.1 d.58.3.1 Length = 433 | Back alignment and structure |
|---|
| >1dtd_A Carboxypeptidase A2; carboxypeptidase A2, leech carboxypeptidase inhibitor, hydrolase/hydrolase inhibitor complex; HET: GLU; 1.65A {Homo sapiens} SCOP: c.56.5.1 Length = 303 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 96 | |||
| 3v38_A | 326 | Carboxypeptidase T; hydrolase; HET: GOL; 1.50A {Th | 99.94 | |
| 3dgv_A | 401 | TAFI, carboxypeptidase B2; blood coagulation, fibr | 99.93 | |
| 3mn8_A | 435 | LP15968P; catalytic domain of alpha/beta-hydrolase | 99.91 | |
| 3prt_A | 323 | Carboxypeptidase T; hydrolase; 1.66A {Thermoactino | 99.88 | |
| 1kwm_A | 402 | Procarboxypeptidase B; hydrolase; HET: CIT; 1.60A | 99.88 | |
| 1dtd_A | 303 | Carboxypeptidase A2; carboxypeptidase A2, leech ca | 99.88 | |
| 1z5r_A | 306 | Procarboxypeptidase B; exopeptidase, hydrolase; 1. | 99.88 | |
| 1aye_A | 401 | PCPA2, procarboxypeptidase A2; serine protease, zy | 99.88 | |
| 2c1c_A | 312 | Carboxypeptidase B; insect, metalloprotease, insen | 99.87 | |
| 1m4l_A | 307 | Carboxypeptidase A; metalloproteinase, metalloexop | 99.87 | |
| 3d4u_A | 309 | Tafia, carboxypeptidase B2; protease-inhibitor com | 99.87 | |
| 2bo9_A | 308 | Carboxypeptidase A4; metallocarboxypeptidase, X-RA | 99.85 | |
| 2boa_A | 404 | Carboxypeptidase A4; metalloprocarboxypeptidase, X | 99.85 | |
| 1pca_A | 403 | Procarboxypeptidase A PCPA; hydrolase(C-terminal p | 99.85 | |
| 1jqg_A | 433 | Carboxypeptidase A; Pro-protein, hydrolase; 2.50A | 99.85 | |
| 1h8l_A | 380 | Carboxypeptidase GP180 residues 503-882; hydrolase | 99.83 | |
| 2nsm_A | 439 | Carboxypeptidase N catalytic chain; caroxypeptidas | 99.83 | |
| 1uwy_A | 426 | Carboxypeptidase M; metallopeptidase, GPI-anchor, | 99.81 | |
| 4axv_A | 243 | MPAA; hydrolase; HET: MSE; 2.17A {Vibrio harveyi} | 99.68 | |
| 3b2y_A | 275 | Metallopeptidase containing CO-catalytic metalloa | 99.49 | |
| 2qvp_A | 275 | Uncharacterized protein; putative metallopeptidase | 99.46 | |
| 3l2n_A | 395 | Peptidase M14, carboxypeptidase A; putative carbox | 99.46 | |
| 3k2k_A | 403 | Putative carboxypeptidase; structural genomics, jo | 99.45 | |
| 4a37_A | 388 | Metallo-carboxypeptidase; metallo-protease, hydrol | 99.41 | |
| 3fmc_A | 368 | Putative succinylglutamate desuccinylase / aspart; | 98.75 | |
| 2qj8_A | 332 | MLR6093 protein; structural genomics, joint center | 98.3 | |
| 3cdx_A | 354 | Succinylglutamatedesuccinylase/aspartoacylase; str | 98.14 | |
| 3na6_A | 331 | Succinylglutamate desuccinylase/aspartoacylase; st | 97.09 | |
| 1yw6_A | 335 | Succinylglutamate desuccinylase; alpha-beta protei | 96.44 | |
| 2gu2_A | 312 | ASPA protein; aspartoacylase family, aminoacylase- | 95.16 | |
| 2bco_A | 350 | Succinylglutamate desuccinylase; NESG, VPR14, stru | 94.84 | |
| 1yw4_A | 341 | Succinylglutamate desuccinylase; alpha-beta protei | 94.32 | |
| 3nh4_A | 327 | Aspartoacylase-2; mercapturates, hydrolase; 2.00A | 89.96 |
| >3v38_A Carboxypeptidase T; hydrolase; HET: GOL; 1.50A {Thermoactinomyces vulgaris} PDB: 1obr_A 3qnv_A 3prt_A | Back alignment and structure |
|---|
Probab=99.94 E-value=3.5e-27 Score=180.48 Aligned_cols=90 Identities=19% Similarity=0.185 Sum_probs=75.6
Q ss_pred cCCCCceeeecCCccCCCccCCCC-----CCCCcCCCCCCCCCCCCC-C----C-CCCCCCCCCCCcHHHHHHHHHHHhC
Q psy17408 5 CDCKSNWLPYEGSCNSLARFVGRN-----NANGVDLNRNFPDQFDSS-S----E-RREQPLNVKKLEPETLAMISFIKNN 73 (96)
Q Consensus 5 ~~~~~~~~a~~~~~~~~~w~~~R~-----N~~GVDLNRNFp~~w~~~-~----~-~~~y~G~~p~SEpEt~Av~~~~~~~ 73 (96)
.|+|+++...+.+. ..+|+++|. +|.|||||||||++|+.. + . ++.|+|+.|+|||||+||++|++++
T Consensus 111 ~NPDG~~~~~~~~~-~r~WRknR~~~~~~~~~GvDLNRNf~~~w~~~~g~s~~pc~~~Y~G~~p~sEpEt~av~~~i~~~ 189 (326)
T 3v38_A 111 INPDGGEYDISSGS-YKSWRKNRQPNSGSSYVGTDLNRNYGYKWGCCGGSSGSPSSETYRGRSAFSAPETAAMRDFINSR 189 (326)
T ss_dssp SCHHHHHHHHTTSS-CCCCCSCSCCCTTCSCCCCCGGGCSSTTTTCSSSSBSCTTSTTBCCSSTTCSHHHHHHHHHHHHT
T ss_pred ecCChhhccccCCc-cccccccCCCCCCCCcCccccccCCCcccccCCCCCCCCCccccCCCCCCccHHHHHHHHHHHhh
Confidence 46777777665432 257999986 488999999999999742 1 2 3799999999999999999999986
Q ss_pred ------CceEEEEeccCCceEEeeCCCC
Q psy17408 74 ------PFVLSGNLHGGAIVASYPFDDS 95 (96)
Q Consensus 74 ------~~~l~is~Hsg~~~i~yPy~~s 95 (96)
+|+++|++||++++|+|||+++
T Consensus 190 ~~~~~~~~~~~i~~Hs~~~~il~Pyg~~ 217 (326)
T 3v38_A 190 VVGGKQQIKTLITFHTYSELILYPYGYT 217 (326)
T ss_dssp EETTEECEEEEEEEEESSSEEEESCSSC
T ss_pred ccccccCeEEEEEecCCCCEEEecCCCC
Confidence 7999999999999999999986
|
| >3dgv_A TAFI, carboxypeptidase B2; blood coagulation, fibrinolysis, protein S glycoprotein, hydrolase, metal-binding, metalloprotease, PR secreted, zymogen; HET: NAG NDG FUL BMA; 2.50A {Bos taurus} PDB: 3osl_A 3d68_A* 3d66_A* 3d67_A* | Back alignment and structure |
|---|
| >3mn8_A LP15968P; catalytic domain of alpha/beta-hydrolase fold, C-terminal, A transthyretin-like domain, hydrolase; HET: NAG GEM; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3prt_A Carboxypeptidase T; hydrolase; 1.66A {Thermoactinomyces vulgaris} PDB: 1obr_A 3qnv_A | Back alignment and structure |
|---|
| >1kwm_A Procarboxypeptidase B; hydrolase; HET: CIT; 1.60A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 PDB: 3glj_A 1nsa_A 1pba_A | Back alignment and structure |
|---|
| >1dtd_A Carboxypeptidase A2; carboxypeptidase A2, leech carboxypeptidase inhibitor, hydrolase/hydrolase inhibitor complex; HET: GLU; 1.65A {Homo sapiens} SCOP: c.56.5.1 | Back alignment and structure |
|---|
| >1z5r_A Procarboxypeptidase B; exopeptidase, hydrolase; 1.40A {Sus scrofa} SCOP: c.56.5.1 PDB: 1zg7_A* 1zg8_A* 1zg9_A* 2jew_A* 2piy_A* 2piz_A* 2pj0_A* 2pj1_A* 2pj2_A* 2pj3_A* 2pj4_A* 2pj5_A* 2pj6_A* 2pj7_A* 2pj8_A* 2pj9_A* 2pja_A* 2pjb_A* 2pjc_A* 1zli_A ... | Back alignment and structure |
|---|
| >1aye_A PCPA2, procarboxypeptidase A2; serine protease, zymogen, hydrolase; 1.80A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 PDB: 1o6x_A | Back alignment and structure |
|---|
| >2c1c_A Carboxypeptidase B; insect, metalloprotease, insensitive, plant inhibitors, hydrolase; 2.3A {Helicoverpa zea} SCOP: c.56.5.1 | Back alignment and structure |
|---|
| >1m4l_A Carboxypeptidase A; metalloproteinase, metalloexoproteinase, hydrolase; 1.25A {Bos taurus} SCOP: c.56.5.1 PDB: 1cpx_A 1arl_A 1f57_A 2rfh_A* 3i1u_A* 1arm_A 1ell_P 1elm_P 1ee3_P 1zlh_A 2abz_A 3hlp_A 3huv_A 1yme_A* 3fvl_A* 3fx6_A* 2ctc_A* 1hdq_A 2ctb_A* 3kgq_A* ... | Back alignment and structure |
|---|
| >3d4u_A Tafia, carboxypeptidase B2; protease-inhibitor complex, glycoprotein, hydrolase, metal-binding, metalloprotease, protease, secret zymogen; 1.70A {Bos taurus} PDB: 3lms_A | Back alignment and structure |
|---|
| >2bo9_A Carboxypeptidase A4; metallocarboxypeptidase, X-RAY endogenous protein inhibitor, metalloprotease carboxypeptidase, hydrolase; HET: NAG; 1.6A {Homo sapiens} SCOP: c.56.5.1 PDB: 4a94_A 2pcu_A* | Back alignment and structure |
|---|
| >2boa_A Carboxypeptidase A4; metalloprocarboxypeptidase, X-RAY zymogen, metalloprotease, exopropeptidase, hydrolase; HET: NAG; 2.20A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 | Back alignment and structure |
|---|
| >1pca_A Procarboxypeptidase A PCPA; hydrolase(C-terminal peptidase); HET: CIT; 2.00A {Sus scrofa} SCOP: d.58.3.1 PDB: 1pyt_A | Back alignment and structure |
|---|
| >1jqg_A Carboxypeptidase A; Pro-protein, hydrolase; 2.50A {Helicoverpa armigera} SCOP: c.56.5.1 d.58.3.1 | Back alignment and structure |
|---|
| >1h8l_A Carboxypeptidase GP180 residues 503-882; hydrolase, zinc-dependent protease; HET: NAG BMA NDG GEM; 2.6A {Lophonetta specularioides} SCOP: b.3.2.1 c.56.5.1 PDB: 1qmu_A* | Back alignment and structure |
|---|
| >2nsm_A Carboxypeptidase N catalytic chain; caroxypeptidase, zinc peptidase, transthyretin-like domain, processing, peptide modification, hydrolase; HET: NAG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1uwy_A Carboxypeptidase M; metallopeptidase, GPI-anchor, metalloprotease, zinc, lipoprotein, hydrolase, structural proteomics in europe, spine; HET: NAG; 3.0A {Homo sapiens} SCOP: b.3.2.1 c.56.5.1 | Back alignment and structure |
|---|
| >4axv_A MPAA; hydrolase; HET: MSE; 2.17A {Vibrio harveyi} | Back alignment and structure |
|---|
| >3b2y_A Metallopeptidase containing CO-catalytic metalloa site; metallopeptidase containing CO-catalytic metalloactive site; 1.74A {Shewanella denitrificans OS217} PDB: 3ieh_A* | Back alignment and structure |
|---|
| >2qvp_A Uncharacterized protein; putative metallopeptidase, structural genomics, joint center structural genomics, JCSG; HET: MSE; 2.00A {Shewanella amazonensis} | Back alignment and structure |
|---|
| >3l2n_A Peptidase M14, carboxypeptidase A; putative carboxypeptidase A, structural genomics, joint CENT structural genomics, JCSG; 2.39A {Shewanella denitrificans} | Back alignment and structure |
|---|
| >3k2k_A Putative carboxypeptidase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; 2.49A {Burkholderia mallei atcc 23344} | Back alignment and structure |
|---|
| >4a37_A Metallo-carboxypeptidase; metallo-protease, hydrolase; 1.60A {Pseudomonas aeruginosa} PDB: 4a38_A 4a39_A* | Back alignment and structure |
|---|
| >3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* | Back alignment and structure |
|---|
| >2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} | Back alignment and structure |
|---|
| >1yw6_A Succinylglutamate desuccinylase; alpha-beta protein., structural genomics, PSI, protein structure initiative; 3.10A {Escherichia coli} SCOP: c.56.5.7 | Back alignment and structure |
|---|
| >2gu2_A ASPA protein; aspartoacylase family, aminoacylase-2, ACY-2, ACY2_RAT, STRU genomics, PSI, protein structure initiative; HET: MSE; 1.80A {Rattus norvegicus} SCOP: c.56.5.7 PDB: 2q4z_A 2i3c_A 2q51_A 2o4h_A* 2o53_A | Back alignment and structure |
|---|
| >2bco_A Succinylglutamate desuccinylase; NESG, VPR14, structural genomics, PSI, protein structure initiative; 2.33A {Vibrio parahaemolyticus} SCOP: c.56.5.7 PDB: 2g9d_A | Back alignment and structure |
|---|
| >1yw4_A Succinylglutamate desuccinylase; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.00A {Chromobacterium violaceum} SCOP: c.56.5.7 | Back alignment and structure |
|---|
| >3nh4_A Aspartoacylase-2; mercapturates, hydrolase; 2.00A {Mus musculus} SCOP: c.56.5.0 PDB: 3nh5_A 3nfz_A 3nh8_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 96 | ||||
| d1uwya2 | 296 | c.56.5.1 (A:1-296) Carboxypeptidase M, catalytic d | 1e-09 | |
| d1jqga1 | 317 | c.56.5.1 (A:1-310) Carboxypeptidase A {Cotton boll | 4e-09 | |
| d2c1ca1 | 312 | c.56.5.1 (A:7-309) Carboxypeptidase B {Corn earwor | 1e-08 | |
| d1m4la_ | 307 | c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) | 5e-08 | |
| d1ayea1 | 307 | c.56.5.1 (A:1-309) Carboxypeptidase A {Human (Homo | 1e-07 | |
| d2bo9a1 | 305 | c.56.5.1 (A:4-307) Carboxypeptidase A {Human (Homo | 1e-07 | |
| d1h8la2 | 301 | c.56.5.1 (A:4-304) Carboxypeptidase D, catalytic d | 1e-07 | |
| d1obra_ | 323 | c.56.5.2 (A:) Carboxypeptidase T {Thermoactinomyce | 6e-06 | |
| d1z5ra1 | 304 | c.56.5.1 (A:6-308) Carboxypeptidase B {Pig (Sus sc | 1e-05 |
| >d1uwya2 c.56.5.1 (A:1-296) Carboxypeptidase M, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 296 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Phosphorylase/hydrolase-like superfamily: Zn-dependent exopeptidases family: Pancreatic carboxypeptidases domain: Carboxypeptidase M, catalytic domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 51.0 bits (121), Expect = 1e-09
Identities = 35/70 (50%), Positives = 46/70 (65%), Gaps = 9/70 (12%)
Query: 26 GRNNANGVDLNRNFPDQFDSSSERREQPLNVKKLEPETLAMISFIKNNPFVLSGNLHGGA 85
GR N N DLNRNFPD F+ ++ R+ ET+A++ ++K FVLS NLHGGA
Sbjct: 126 GRENYNQYDLNRNFPDAFEYNNVSRQP---------ETVAVMKWLKTETFVLSANLHGGA 176
Query: 86 IVASYPFDDS 95
+VASYPFD+
Sbjct: 177 LVASYPFDNG 186
|
| >d1jqga1 c.56.5.1 (A:1-310) Carboxypeptidase A {Cotton bollworm (Helicoverpa armigera) [TaxId: 29058]} Length = 317 | Back information, alignment and structure |
|---|
| >d2c1ca1 c.56.5.1 (A:7-309) Carboxypeptidase B {Corn earworm (Helicoverpa zea) [TaxId: 7113]} Length = 312 | Back information, alignment and structure |
|---|
| >d1m4la_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]} Length = 307 | Back information, alignment and structure |
|---|
| >d1ayea1 c.56.5.1 (A:1-309) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} Length = 307 | Back information, alignment and structure |
|---|
| >d2bo9a1 c.56.5.1 (A:4-307) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} Length = 305 | Back information, alignment and structure |
|---|
| >d1h8la2 c.56.5.1 (A:4-304) Carboxypeptidase D, catalytic domain {Crested duck (Lophonetta specularioides) [TaxId: 8836]} Length = 301 | Back information, alignment and structure |
|---|
| >d1obra_ c.56.5.2 (A:) Carboxypeptidase T {Thermoactinomyces vulgaris [TaxId: 2026]} Length = 323 | Back information, alignment and structure |
|---|
| >d1z5ra1 c.56.5.1 (A:6-308) Carboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823]} Length = 304 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 96 | |||
| d1jqga1 | 317 | Carboxypeptidase A {Cotton bollworm (Helicoverpa a | 99.9 | |
| d1obra_ | 323 | Carboxypeptidase T {Thermoactinomyces vulgaris [Ta | 99.9 | |
| d1m4la_ | 307 | Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913] | 99.89 | |
| d1ayea1 | 307 | Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9 | 99.89 | |
| d1uwya2 | 296 | Carboxypeptidase M, catalytic domain {Human (Homo | 99.89 | |
| d2c1ca1 | 312 | Carboxypeptidase B {Corn earworm (Helicoverpa zea) | 99.88 | |
| d1z5ra1 | 304 | Carboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823] | 99.86 | |
| d1h8la2 | 301 | Carboxypeptidase D, catalytic domain {Crested duck | 99.86 | |
| d2bo9a1 | 305 | Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9 | 99.82 | |
| d1yw4a1 | 331 | Succinylglutamate desuccinylase AstE {Chromobacter | 87.0 | |
| d1yw6a1 | 322 | Succinylglutamate desuccinylase AstE {Escherichia | 83.14 |
| >d1jqga1 c.56.5.1 (A:1-310) Carboxypeptidase A {Cotton bollworm (Helicoverpa armigera) [TaxId: 29058]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Phosphorylase/hydrolase-like superfamily: Zn-dependent exopeptidases family: Pancreatic carboxypeptidases domain: Carboxypeptidase A species: Cotton bollworm (Helicoverpa armigera) [TaxId: 29058]
Probab=99.90 E-value=7.7e-25 Score=164.86 Aligned_cols=89 Identities=21% Similarity=0.235 Sum_probs=74.6
Q ss_pred ccCCCCceeeecCCccCCCccCCC-------CCCCCcCCCCCCCCCCCCCC---C-CCCCCCCCCCCcHHHHHHHHHHHh
Q psy17408 4 YCDCKSNWLPYEGSCNSLARFVGR-------NNANGVDLNRNFPDQFDSSS---E-RREQPLNVKKLEPETLAMISFIKN 72 (96)
Q Consensus 4 ~~~~~~~~~a~~~~~~~~~w~~~R-------~N~~GVDLNRNFp~~w~~~~---~-~~~y~G~~p~SEpEt~Av~~~~~~ 72 (96)
..|+|+++...++++. |+++| .||+|||||||||..|+... . .+.|+|+.|+|||||+||++++.+
T Consensus 109 ~~NPDG~~~~~~~~~~---~~knr~~~~~~~~~~~GVDLNRN~~~~w~~~~~~~p~~~~y~G~~p~SEpEt~al~~~~~~ 185 (317)
T d1jqga1 109 VANPDGYVHTFGGDRY---WRKNRATGYMAGNLCMGVDLNRNFGMNWGTASSSSVCSDTFHGRSAFSEPESSVIRDIIAE 185 (317)
T ss_dssp CSCHHHHHHHHSSCTT---CCSCCCCSSSGGGSSCCCCGGGCSSTTTTSSSBCCTTSTTBCCSSTTCSHHHHHHHHHHHH
T ss_pred eEcchhceeeeccccc---cccCCCCCCCCCCcccCCccccCCCCCCCcccCCCCCccccCCCCccccHHHHHHHHHHHH
Confidence 3578888888777643 56554 46789999999999997542 2 378999999999999999999998
Q ss_pred CC--ceEEEEeccCCceEEeeCCCC
Q psy17408 73 NP--FVLSGNLHGGAIVASYPFDDS 95 (96)
Q Consensus 73 ~~--~~l~is~Hsg~~~i~yPy~~s 95 (96)
++ |++++++||++++++|||+++
T Consensus 186 ~~~~i~~~vd~Hs~g~~i~yP~~~~ 210 (317)
T d1jqga1 186 HRNRMALYLDIHSFGSMILYGYGNG 210 (317)
T ss_dssp TTTTEEEEEEEEESSSEEEESCTTS
T ss_pred hccceEEEEeeccCCceEEecCCCC
Confidence 74 888999999999999999875
|
| >d1obra_ c.56.5.2 (A:) Carboxypeptidase T {Thermoactinomyces vulgaris [TaxId: 2026]} | Back information, alignment and structure |
|---|
| >d1m4la_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ayea1 c.56.5.1 (A:1-309) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uwya2 c.56.5.1 (A:1-296) Carboxypeptidase M, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c1ca1 c.56.5.1 (A:7-309) Carboxypeptidase B {Corn earworm (Helicoverpa zea) [TaxId: 7113]} | Back information, alignment and structure |
|---|
| >d1z5ra1 c.56.5.1 (A:6-308) Carboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1h8la2 c.56.5.1 (A:4-304) Carboxypeptidase D, catalytic domain {Crested duck (Lophonetta specularioides) [TaxId: 8836]} | Back information, alignment and structure |
|---|
| >d2bo9a1 c.56.5.1 (A:4-307) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yw4a1 c.56.5.7 (A:2-332) Succinylglutamate desuccinylase AstE {Chromobacterium violaceum [TaxId: 536]} | Back information, alignment and structure |
|---|
| >d1yw6a1 c.56.5.7 (A:1-322) Succinylglutamate desuccinylase AstE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|