Psyllid ID: psy17567
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 362 | ||||||
| 328719723 | 1336 | PREDICTED: adenylate cyclase type 8-like | 0.657 | 0.178 | 0.594 | 1e-88 | |
| 91082343 | 1551 | PREDICTED: similar to adenylate cyclase | 0.676 | 0.157 | 0.514 | 1e-75 | |
| 270007177 | 499 | hypothetical protein TcasGA2_TC013718 [T | 0.685 | 0.496 | 0.514 | 1e-74 | |
| 170059532 | 1509 | adenylate cyclase [Culex quinquefasciatu | 0.657 | 0.157 | 0.516 | 1e-73 | |
| 5514629 | 1718 | adenylyl cyclase 78C-L [Drosophila melan | 0.676 | 0.142 | 0.494 | 4e-73 | |
| 442633835 | 1717 | adenylyl cyclase 78C, isoform F [Drosoph | 0.676 | 0.142 | 0.494 | 4e-73 | |
| 442633830 | 1694 | adenylyl cyclase 78C, isoform D [Drosoph | 0.676 | 0.144 | 0.494 | 4e-73 | |
| 281366555 | 1718 | adenylyl cyclase 78C, isoform B [Drosoph | 0.676 | 0.142 | 0.494 | 4e-73 | |
| 442633832 | 1727 | adenylyl cyclase 78C, isoform E [Drosoph | 0.676 | 0.141 | 0.494 | 5e-73 | |
| 195348445 | 1718 | GM22165 [Drosophila sechellia] gi|194122 | 0.676 | 0.142 | 0.494 | 7e-73 |
| >gi|328719723|ref|XP_001942943.2| PREDICTED: adenylate cyclase type 8-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 333 bits (853), Expect = 1e-88, Method: Compositional matrix adjust.
Identities = 160/269 (59%), Positives = 193/269 (71%), Gaps = 31/269 (11%)
Query: 94 PVFKKGVLYKGIYCPSLTNSFREPSLEMSYQRYSHRQRQKSLIIVNLVDMVLKAVLTVAW 153
PVFKKG +YKGIYCP+LTNSFREPSLE+SYQRYSHRQRQKSLIIVN VDM LKAVL W
Sbjct: 74 PVFKKGRVYKGIYCPTLTNSFREPSLELSYQRYSHRQRQKSLIIVNFVDMTLKAVLAGVW 133
Query: 154 I--SYNEVELSQIDSTKLTWTVYTMMSNLAMCLLGWWRCFANNYLQWAAVGTWILLNTQG 211
+ +Y+E SQ + WT TM +NL +CLLGWW+
Sbjct: 134 LLPTYHEPYHSQ----RAIWTCLTMFANLTVCLLGWWK---------------------- 167
Query: 212 WWRCFANNYLQWAAVGTWILLNTQGFISQGIGLNNKEYLIWYILFIVFVTYAMLPLPLKW 271
CFANNYLQWAAV TW +N QGF+ + G ++EYL+WY+LFIVFVTYAMLPLPL+W
Sbjct: 168 ---CFANNYLQWAAVFTWCFINVQGFVWESYGQGSREYLVWYVLFIVFVTYAMLPLPLRW 224
Query: 272 CFIGGCTTSVLHVIITAQIKLHRGPLSPCSVHEMGALCLVYIGINSAGMYTKYLTDRGQR 331
C + GC+T++LH++IT+ K + C V ++ A+ L+Y +N AGMYTKYLTDR QR
Sbjct: 225 CILAGCSTALLHILITSYTKSSKEKNRLCVVRQLTAMSLLYAAVNFAGMYTKYLTDRSQR 284
Query: 332 RAFLETHRSTETRMKTQKENDQQEKLLLS 360
+AFLETHRSTE R KTQKEN+QQEKLLLS
Sbjct: 285 KAFLETHRSTEARFKTQKENEQQEKLLLS 313
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|91082343|ref|XP_966895.1| PREDICTED: similar to adenylate cyclase [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270007177|gb|EFA03625.1| hypothetical protein TcasGA2_TC013718 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|170059532|ref|XP_001865404.1| adenylate cyclase [Culex quinquefasciatus] gi|167878270|gb|EDS41653.1| adenylate cyclase [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|5514629|gb|AAD44018.1|AF047382_1 adenylyl cyclase 78C-L [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|442633835|ref|NP_001262139.1| adenylyl cyclase 78C, isoform F [Drosophila melanogaster] gi|440216107|gb|AGB94832.1| adenylyl cyclase 78C, isoform F [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|442633830|ref|NP_001262137.1| adenylyl cyclase 78C, isoform D [Drosophila melanogaster] gi|440216105|gb|AGB94830.1| adenylyl cyclase 78C, isoform D [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|281366555|ref|NP_524194.3| adenylyl cyclase 78C, isoform B [Drosophila melanogaster] gi|272455262|gb|AAF51680.3| adenylyl cyclase 78C, isoform B [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|442633832|ref|NP_001262138.1| adenylyl cyclase 78C, isoform E [Drosophila melanogaster] gi|440216106|gb|AGB94831.1| adenylyl cyclase 78C, isoform E [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195348445|ref|XP_002040759.1| GM22165 [Drosophila sechellia] gi|194122269|gb|EDW44312.1| GM22165 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 362 | ||||||
| FB|FBgn0024150 | 1718 | Ac78C "Adenylyl cyclase 78C" [ | 0.408 | 0.086 | 0.556 | 8.6e-44 | |
| UNIPROTKB|E7EVL1 | 1120 | ADCY8 "Adenylate cyclase type | 0.383 | 0.124 | 0.409 | 9.8e-38 | |
| UNIPROTKB|P40145 | 1251 | ADCY8 "Adenylate cyclase type | 0.383 | 0.111 | 0.409 | 1.4e-37 | |
| UNIPROTKB|E2RCX6 | 1251 | ADCY8 "Uncharacterized protein | 0.383 | 0.111 | 0.402 | 1.7e-37 | |
| RGD|2036 | 1248 | Adcy8 "adenylate cyclase 8 (br | 0.383 | 0.111 | 0.409 | 4.6e-37 | |
| UNIPROTKB|E1BQ12 | 1253 | ADCY8 "Uncharacterized protein | 0.383 | 0.110 | 0.395 | 4.7e-37 | |
| MGI|MGI:1341110 | 1249 | Adcy8 "adenylate cyclase 8" [M | 0.383 | 0.111 | 0.409 | 7.5e-37 | |
| ZFIN|ZDB-GENE-070912-197 | 1225 | adcy8 "adenylate cyclase 8 (br | 0.383 | 0.113 | 0.402 | 1.4e-36 | |
| UNIPROTKB|E1BTI9 | 1079 | ADCY8 "Uncharacterized protein | 0.375 | 0.126 | 0.418 | 1.6e-36 | |
| ZFIN|ZDB-GENE-041014-154 | 1187 | si:dkey-206f10.1 "si:dkey-206f | 0.455 | 0.139 | 0.355 | 1.2e-21 |
| FB|FBgn0024150 Ac78C "Adenylyl cyclase 78C" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 476 (172.6 bits), Expect = 8.6e-44, P = 8.6e-44
Identities = 84/151 (55%), Positives = 113/151 (74%)
Query: 211 GWWRCFANNYLQWAAVGTWILLNTQGFISQGIGLNNKEYLIWYILFIVFVTYAMLPLPLK 270
G+WRCFANNYL WAAV TW+L N QGF+ QG+G ++EYL+WYILF++FV YAMLPLPLK
Sbjct: 385 GYWRCFANNYLHWAAVCTWVLFNIQGFVGQGVGFADREYLVWYILFVIFVPYAMLPLPLK 444
Query: 271 WCFIGGCTTSVLHVIITAQIKLHRGP--LSP-CSVHEMGALCLVYIGINSAGMYTKYLTD 327
WC +GG T+ H+ + IKL G ++P C + ++ A ++Y IN AGMYTKYLTD
Sbjct: 445 WCVVGGTITASCHLAVITIIKLQHGEATINPECVLFQIFANFILYTAINVAGMYTKYLTD 504
Query: 328 RGQRRAFLETHRSTETRMKTQKENDQQEKLL 358
RGQR AF+ETH++ E + +++KE + +KLL
Sbjct: 505 RGQRLAFIETHKAMEHKKESEKELQRTQKLL 535
|
|
| UNIPROTKB|E7EVL1 ADCY8 "Adenylate cyclase type 8" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P40145 ADCY8 "Adenylate cyclase type 8" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RCX6 ADCY8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|2036 Adcy8 "adenylate cyclase 8 (brain)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BQ12 ADCY8 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1341110 Adcy8 "adenylate cyclase 8" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070912-197 adcy8 "adenylate cyclase 8 (brain)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BTI9 ADCY8 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041014-154 si:dkey-206f10.1 "si:dkey-206f10.1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 362 | |||
| pfam06658 | 142 | pfam06658, DUF1168, Protein of unknown function (D | 3e-09 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 4e-09 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 5e-09 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 1e-08 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 2e-08 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 3e-08 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 5e-08 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 6e-08 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 8e-08 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 1e-07 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 1e-07 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 2e-07 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 4e-07 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 4e-07 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 5e-07 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 6e-07 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 7e-07 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 1e-06 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 1e-06 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 1e-06 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 1e-06 | |
| pfam03343 | 603 | pfam03343, SART-1, SART-1 family | 1e-06 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 1e-06 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 2e-06 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 2e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-06 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 2e-06 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 2e-06 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 2e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-06 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 4e-06 | |
| PTZ00053 | 470 | PTZ00053, PTZ00053, methionine aminopeptidase 2; P | 4e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 5e-06 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 5e-06 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 5e-06 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 6e-06 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 7e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 7e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 7e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 7e-06 | |
| pfam10278 | 178 | pfam10278, Med19, Mediator of RNA pol II transcrip | 7e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 8e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 8e-06 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 8e-06 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 1e-05 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 1e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 1e-05 | |
| pfam04935 | 206 | pfam04935, SURF6, Surfeit locus protein 6 | 1e-05 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 2e-05 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 2e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-05 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 2e-05 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 2e-05 | |
| pfam09428 | 130 | pfam09428, DUF2011, Fungal protein of unknown func | 2e-05 | |
| pfam08555 | 90 | pfam08555, DUF1754, Eukaryotic family of unknown f | 2e-05 | |
| pfam08496 | 154 | pfam08496, Peptidase_S49_N, Peptidase family S49 N | 2e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-05 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 3e-05 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 3e-05 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 4e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 4e-05 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 4e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 4e-05 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 5e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 5e-05 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 5e-05 | |
| pfam09468 | 287 | pfam09468, RNase_H2-Ydr279, Ydr279p protein family | 5e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 6e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 6e-05 | |
| pfam10278 | 178 | pfam10278, Med19, Mediator of RNA pol II transcrip | 6e-05 | |
| cd09270 | 211 | cd09270, RNase_H2-B, Ribonuclease H2-B is a subuni | 6e-05 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 7e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 7e-05 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 7e-05 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 8e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 9e-05 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 9e-05 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 1e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 1e-04 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 1e-04 | |
| pfam09831 | 177 | pfam09831, DUF2058, Uncharacterized protein conser | 1e-04 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 1e-04 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 1e-04 | |
| pfam04641 | 254 | pfam04641, Rtf2, Replication termination factor 2 | 1e-04 | |
| pfam14265 | 125 | pfam14265, DUF4355, Domain of unknown function (DU | 1e-04 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 1e-04 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 2e-04 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 2e-04 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 2e-04 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 2e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-04 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 2e-04 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 2e-04 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 2e-04 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 2e-04 | |
| pfam06375 | 561 | pfam06375, BLVR, Bovine leukaemia virus receptor ( | 2e-04 | |
| TIGR03927 | 150 | TIGR03927, T7SS_EssA_Firm, type VII secretion prot | 2e-04 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 2e-04 | |
| pfam06424 | 131 | pfam06424, PRP1_N, PRP1 splicing factor, N-termina | 2e-04 | |
| pfam01086 | 225 | pfam01086, Clathrin_lg_ch, Clathrin light chain | 2e-04 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 3e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-04 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 3e-04 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 3e-04 | |
| pfam09468 | 287 | pfam09468, RNase_H2-Ydr279, Ydr279p protein family | 3e-04 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 3e-04 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 3e-04 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 3e-04 | |
| PLN02967 | 581 | PLN02967, PLN02967, kinase | 3e-04 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 3e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-04 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 4e-04 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 4e-04 | |
| PRK05306 | 746 | PRK05306, infB, translation initiation factor IF-2 | 4e-04 | |
| COG5116 | 926 | COG5116, RPN2, 26S proteasome regulatory complex c | 4e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 5e-04 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 5e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 5e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 5e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 5e-04 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 5e-04 | |
| PRK12778 | 752 | PRK12778, PRK12778, putative bifunctional 2-polypr | 5e-04 | |
| smart00435 | 391 | smart00435, TOPEUc, DNA Topoisomerase I (eukaryota | 5e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 5e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 6e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 6e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 6e-04 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 6e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 6e-04 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 7e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 7e-04 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 7e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 7e-04 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 7e-04 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 7e-04 | |
| PRK04950 | 213 | PRK04950, PRK04950, ProP expression regulator; Pro | 7e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 8e-04 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 8e-04 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 8e-04 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 8e-04 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 8e-04 | |
| COG4487 | 438 | COG4487, COG4487, Uncharacterized protein conserve | 8e-04 | |
| pfam13148 | 379 | pfam13148, DUF3987, Protein of unknown function (D | 8e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 9e-04 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 9e-04 | |
| PRK05306 | 746 | PRK05306, infB, translation initiation factor IF-2 | 9e-04 | |
| pfam05786 | 719 | pfam05786, Cnd2, Condensin complex subunit 2 | 9e-04 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 0.001 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 0.001 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.001 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.001 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.001 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 0.001 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 0.001 | |
| pfam04935 | 206 | pfam04935, SURF6, Surfeit locus protein 6 | 0.001 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 0.001 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 0.001 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 0.001 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.001 | |
| pfam09831 | 177 | pfam09831, DUF2058, Uncharacterized protein conser | 0.001 | |
| pfam14265 | 125 | pfam14265, DUF4355, Domain of unknown function (DU | 0.001 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 0.001 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 0.001 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 0.001 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 0.001 | |
| pfam13476 | 204 | pfam13476, AAA_23, AAA domain | 0.001 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 0.001 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 0.001 | |
| PHA03089 | 191 | PHA03089, PHA03089, late transcription factor VLTF | 0.001 | |
| pfam04696 | 131 | pfam04696, Pinin_SDK_memA, pinin/SDK/memA/ protein | 0.001 | |
| pfam09736 | 141 | pfam09736, Bud13, Pre-mRNA-splicing factor of RES | 0.001 | |
| PTZ00074 | 135 | PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro | 0.001 | |
| PRK11778 | 330 | PRK11778, PRK11778, putative inner membrane peptid | 0.001 | |
| pfam03839 | 217 | pfam03839, Sec62, Translocation protein Sec62 | 0.001 | |
| pfam08576 | 98 | pfam08576, DUF1764, Eukaryotic protein of unknown | 0.001 | |
| pfam05104 | 151 | pfam05104, Rib_recp_KP_reg, Ribosome receptor lysi | 0.001 | |
| pfam13904 | 261 | pfam13904, DUF4207, Domain of unknown function (DU | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 0.002 | |
| pfam09428 | 130 | pfam09428, DUF2011, Fungal protein of unknown func | 0.002 | |
| pfam08496 | 154 | pfam08496, Peptidase_S49_N, Peptidase family S49 N | 0.002 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.002 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.002 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 0.002 | |
| pfam06375 | 561 | pfam06375, BLVR, Bovine leukaemia virus receptor ( | 0.002 | |
| pfam06375 | 561 | pfam06375, BLVR, Bovine leukaemia virus receptor ( | 0.002 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 0.002 | |
| smart00435 | 391 | smart00435, TOPEUc, DNA Topoisomerase I (eukaryota | 0.002 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 0.002 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 0.002 | |
| PTZ00074 | 135 | PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro | 0.002 | |
| PRK11778 | 330 | PRK11778, PRK11778, putative inner membrane peptid | 0.002 | |
| pfam03839 | 217 | pfam03839, Sec62, Translocation protein Sec62 | 0.002 | |
| pfam10661 | 145 | pfam10661, EssA, WXG100 protein secretion system ( | 0.002 | |
| pfam12589 | 85 | pfam12589, WBS_methylT, Methyltransferase involved | 0.002 | |
| PTZ00399 | 651 | PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro | 0.002 | |
| pfam07771 | 120 | pfam07771, TSGP1, Tick salivary peptide group 1 | 0.002 | |
| pfam07133 | 164 | pfam07133, Merozoite_SPAM, Merozoite surface prote | 0.002 | |
| PRK10819 | 246 | PRK10819, PRK10819, transport protein TonB; Provis | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG5644 | 869 | COG5644, COG5644, Uncharacterized conserved protei | 0.002 | |
| pfam05672 | 171 | pfam05672, MAP7, MAP7 (E-MAP-115) family | 0.002 | |
| PTZ00272 | 701 | PTZ00272, PTZ00272, heat shock protein 83 kDa (Hsp | 0.002 | |
| pfam09731 | 493 | pfam09731, Mitofilin, Mitochondrial inner membrane | 0.002 | |
| TIGR01069 | 771 | TIGR01069, mutS2, MutS2 family protein | 0.002 | |
| pfam06102 | 168 | pfam06102, DUF947, Domain of unknown function (DUF | 0.002 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.002 | |
| COG1579 | 239 | COG1579, COG1579, Zn-ribbon protein, possibly nucl | 0.002 | |
| PRK14962 | 472 | PRK14962, PRK14962, DNA polymerase III subunits ga | 0.002 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 0.003 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.003 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 0.003 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.003 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.003 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.003 | |
| pfam04641 | 254 | pfam04641, Rtf2, Replication termination factor 2 | 0.003 | |
| TIGR03927 | 150 | TIGR03927, T7SS_EssA_Firm, type VII secretion prot | 0.003 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 0.003 | |
| PTZ00074 | 135 | PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro | 0.003 | |
| PTZ00399 | 651 | PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro | 0.003 | |
| pfam09731 | 493 | pfam09731, Mitofilin, Mitochondrial inner membrane | 0.003 | |
| TIGR01069 | 771 | TIGR01069, mutS2, MutS2 family protein | 0.003 | |
| COG1293 | 564 | COG1293, COG1293, Predicted RNA-binding protein ho | 0.003 | |
| pfam12720 | 169 | pfam12720, DUF3807, Protein of unknown function (D | 0.003 | |
| pfam14303 | 147 | pfam14303, NAM-associated, No apical meristem-asso | 0.003 | |
| pfam14058 | 136 | pfam14058, PcfK, PcfK-like protein | 0.003 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.004 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 0.004 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.004 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 0.004 | |
| pfam04935 | 206 | pfam04935, SURF6, Surfeit locus protein 6 | 0.004 | |
| pfam09468 | 287 | pfam09468, RNase_H2-Ydr279, Ydr279p protein family | 0.004 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.004 | |
| pfam03839 | 217 | pfam03839, Sec62, Translocation protein Sec62 | 0.004 | |
| COG1293 | 564 | COG1293, COG1293, Predicted RNA-binding protein ho | 0.004 | |
| COG1193 | 753 | COG1193, COG1193, Mismatch repair ATPase (MutS fam | 0.004 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 0.004 |
| >gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) | Back alignment and domain information |
|---|
Score = 54.7 bits (132), Expect = 3e-09
Identities = 34/93 (36%), Positives = 55/93 (59%), Gaps = 4/93 (4%)
Query: 10 EKKKRIEKRNKEE-EKEENEQEEKEKEDVEEEKNKKKKKK--KKKKKKKKKKKKKKKEEQ 66
E+ + ++++ K+E E EE +Q+ +EK+ +EEK KK+ K KKK+KKKKKKK KK ++
Sbjct: 50 ERLELMDEKWKKETEDEEFQQKREEKKRKDEEKTAKKRAKRQKKKQKKKKKKKAKKGNKK 109
Query: 67 SVKEIEESLKERKEKTLTEDSQCDTMIPVFKKG 99
KE +S +E ++ E + PV
Sbjct: 110 EEKEGSKSSEESSDEEE-EGEEDKQEEPVEIME 141
|
This family consists of several hypothetical eukaryotic proteins of unknown function. Length = 142 |
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|217502 pfam03343, SART-1, SART-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|218336 pfam04935, SURF6, Surfeit locus protein 6 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) | Back alignment and domain information |
|---|
| >gnl|CDD|219901 pfam08555, DUF1754, Eukaryotic family of unknown function (DUF1754) | Back alignment and domain information |
|---|
| >gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 | Back alignment and domain information |
|---|
| >gnl|CDD|187751 cd09270, RNase_H2-B, Ribonuclease H2-B is a subunit of the eukaryotic RNase H complex which cleaves RNA-DNA hybrids | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|220431 pfam09831, DUF2058, Uncharacterized protein conserved in bacteria (DUF2058) | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|218188 pfam04641, Rtf2, Replication termination factor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR) | Back alignment and domain information |
|---|
| >gnl|CDD|200340 TIGR03927, T7SS_EssA_Firm, type VII secretion protein EssA | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|203444 pfam06424, PRP1_N, PRP1 splicing factor, N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|216292 pfam01086, Clathrin_lg_ch, Clathrin light chain | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|215521 PLN02967, PLN02967, kinase | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|227446 COG5116, RPN2, 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237200 PRK12778, PRK12778, putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226889 COG4487, COG4487, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|221937 pfam13148, DUF3987, Protein of unknown function (DUF3987) | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218747 pfam05786, Cnd2, Condensin complex subunit 2 | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|218336 pfam04935, SURF6, Surfeit locus protein 6 | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|220431 pfam09831, DUF2058, Uncharacterized protein conserved in bacteria (DUF2058) | Back alignment and domain information |
|---|
| >gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|222160 pfam13476, AAA_23, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222977 PHA03089, PHA03089, late transcription factor VLTF-4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218215 pfam04696, Pinin_SDK_memA, pinin/SDK/memA/ protein conserved region | Back alignment and domain information |
|---|
| >gnl|CDD|220371 pfam09736, Bud13, Pre-mRNA-splicing factor of RES complex | Back alignment and domain information |
|---|
| >gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217756 pfam03839, Sec62, Translocation protein Sec62 | Back alignment and domain information |
|---|
| >gnl|CDD|219913 pfam08576, DUF1764, Eukaryotic protein of unknown function (DUF1764) | Back alignment and domain information |
|---|
| >gnl|CDD|218435 pfam05104, Rib_recp_KP_reg, Ribosome receptor lysine/proline rich region | Back alignment and domain information |
|---|
| >gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) | Back alignment and domain information |
|---|
| >gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR) | Back alignment and domain information |
|---|
| >gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR) | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217756 pfam03839, Sec62, Translocation protein Sec62 | Back alignment and domain information |
|---|
| >gnl|CDD|220839 pfam10661, EssA, WXG100 protein secretion system (Wss), protein EssA | Back alignment and domain information |
|---|
| >gnl|CDD|221654 pfam12589, WBS_methylT, Methyltransferase involved in Williams-Beuren syndrome | Back alignment and domain information |
|---|
| >gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219564 pfam07771, TSGP1, Tick salivary peptide group 1 | Back alignment and domain information |
|---|
| >gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) | Back alignment and domain information |
|---|
| >gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|227931 COG5644, COG5644, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|218684 pfam05672, MAP7, MAP7 (E-MAP-115) family | Back alignment and domain information |
|---|
| >gnl|CDD|240341 PTZ00272, PTZ00272, heat shock protein 83 kDa (Hsp83); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|218899 pfam06102, DUF947, Domain of unknown function (DUF947) | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237869 PRK14962, PRK14962, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|218188 pfam04641, Rtf2, Replication termination factor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|200340 TIGR03927, T7SS_EssA_Firm, type VII secretion protein EssA | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|224212 COG1293, COG1293, Predicted RNA-binding protein homologous to eukaryotic snRNP [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|221733 pfam12720, DUF3807, Protein of unknown function (DUF3807) | Back alignment and domain information |
|---|
| >gnl|CDD|222665 pfam14303, NAM-associated, No apical meristem-associated C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|206228 pfam14058, PcfK, PcfK-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|218336 pfam04935, SURF6, Surfeit locus protein 6 | Back alignment and domain information |
|---|
| >gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217756 pfam03839, Sec62, Translocation protein Sec62 | Back alignment and domain information |
|---|
| >gnl|CDD|224212 COG1293, COG1293, Predicted RNA-binding protein homologous to eukaryotic snRNP [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|224114 COG1193, COG1193, Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 362 | |||
| KOG3618|consensus | 1318 | 99.9 | ||
| KOG3619|consensus | 867 | 99.39 | ||
| KOG2422|consensus | 665 | 93.94 | ||
| KOG0112|consensus | 975 | 93.89 | ||
| KOG4364|consensus | 811 | 93.0 | ||
| KOG3619|consensus | 867 | 92.89 | ||
| KOG0345|consensus | 567 | 91.53 | ||
| PF06375 | 154 | BLVR: Bovine leukaemia virus receptor (BLVR); Inte | 91.18 | |
| KOG2412|consensus | 591 | 91.16 | ||
| KOG4364|consensus | 811 | 90.68 | ||
| PF11600 | 216 | CAF-1_p150: Chromatin assembly factor 1 complex p1 | 89.77 | |
| KOG4055|consensus | 213 | 87.69 | ||
| PF07946 | 321 | DUF1682: Protein of unknown function (DUF1682); In | 87.42 | |
| PF06658 | 142 | DUF1168: Protein of unknown function (DUF1168); In | 86.89 | |
| KOG0338|consensus | 691 | 86.23 | ||
| PTZ00121 | 2084 | MAEBL; Provisional | 84.4 |
| >KOG3618|consensus | Back alignment and domain information |
|---|
Probab=99.90 E-value=6.4e-23 Score=212.36 Aligned_cols=264 Identities=14% Similarity=0.172 Sum_probs=189.9
Q ss_pred cCHHhHHHHHHHhhhhccCc----cccccccccc-cccccccccccccCccCcCCCcchHHhHHHHHHHHhhhHHHHHHH
Q psy17567 66 QSVKEIEESLKERKEKTLTE----DSQCDTMIPV-FKKGVLYKGIYCPSLTNSFREPSLEMSYQRYSHRQRQKSLIIVNL 140 (362)
Q Consensus 66 ~~~~~~~~~l~e~~~~~lt~----~~~~~~~~~~-f~~g~~~~g~~~p~L~~kF~s~~LE~LYq~Y~~r~~q~sL~v~~~ 140 (362)
++.+++...+.|..+.+.++ .+||++++|. |++ +.+| | ++++|+|..||+.|+.-.+.|-|...--- +
T Consensus 13 ~~t~~v~~~~~Psi~s~~Ss~gRR~~~~~~~lP~~FER-Asar-W----wdPkFdS~~LEeqy~~~~Fpq~r~RfR~~-L 85 (1318)
T KOG3618|consen 13 GDTNSVRVKINPSISSSCSSSGRRVGGGGRLLPQLFER-ASAR-W----WDPKFDSVNLEEQYLERCFPQTRRRFRYA-L 85 (1318)
T ss_pred CCCcccceeeCcchhhhcCCCCcccCCCcccchHHHHH-hhhh-h----cCccCCcchHHHHHHHhhCHHHHHHHHHH-H
Confidence 78899999999999998876 4999999996 998 4445 3 78999999999999999888766554322 2
Q ss_pred HHHHHHHHHHHHHHHhcccccccccchhHHHHHHHHHHHHHHHHHh-hhhhhcchhhHHHHHHHHHHHHhhhhhhhhhhh
Q psy17567 141 VDMVLKAVLTVAWISYNEVELSQIDSTKLTWTVYTMMSNLAMCLLG-WWRCFANNYLQWAAVGTWILLNTQGWWRCFANN 219 (362)
Q Consensus 141 l~ill~~~l~~l~l~~~~~~~~~~~~~~~~~~~~~l~~~l~L~vl~-~~~~~~~~~l~~~~~~~wi~l~t~~~~~c~~~~ 219 (362)
..|.+++.++.+|+..+...+ ....+....|.+.+..++++++ +++.+.+.| .|.+++.-+++ |
T Consensus 86 ~YI~~~~l~W~lYfav~~rs~---fi~~~~~slc~lslv~~mf~~ft~~~lY~rhy-~~TS~~~tlLv-------c---- 150 (1318)
T KOG3618|consen 86 FYIGFACLLWSLYFAVHMRSR---FIVMVAPSLCFLSLVCVMFFLFTFTKLYARHY-AWTSLALTLLV-------C---- 150 (1318)
T ss_pred HHHHHHHHHHHHHheeccCce---eeeehHHHHHHHHHHHHHHHHHHHHHHHHHHh-hHHHHHHHHHH-------H----
Confidence 578889999999987665332 2222223333333333444443 677665555 67766522221 2
Q ss_pred hhhhhhhHHHHhhhhhhhhcccc-ccCCccchhHHHHHHHHHHhcccccchHHHHHhhhhhHHHHHHHHHHHHh---ccC
Q psy17567 220 YLQWAAVGTWILLNTQGFISQGI-GLNNKEYLIWYILFIVFVTYAMLPLPLKWCFIGGCTTSVLHVIITAQIKL---HRG 295 (362)
Q Consensus 220 yl~~~~~~~~v~~~~q~~~~~~~-~~~~~~~~~w~~lfiIf~iYtmLPl~l~~ail~g~~~Sl~hliv~~~~~~---~~~ 295 (362)
..++.. +.+++. .+-++-.....++-++++|||.+|+|++.++.+|+..|+.+-++...+.- +..
T Consensus 151 ------~~tLa~-----ltat~r~af~spvgsfa~c~evvlLiYTv~plPLyL~~~~gi~YSilFE~~~~~~ig~~~~~~ 219 (1318)
T KOG3618|consen 151 ------ALTLAN-----LTATARPAFLSPVGSFAMCIEVVLLIYTVMPLPLYLSLCLGIAYSILFETFGYHFIGEACFPS 219 (1318)
T ss_pred ------HHHHHH-----hhhccchhhhCchhHHHHHHHHHHHHHHhcchHHHHHHHHHHHHHHHHHHhhhhccccccccC
Confidence 111111 111222 22122334555778899999999999999999999999998876432110 001
Q ss_pred CCCchhhhhHHHHHHHHHHhhhhhhhhhhhhhHHhHHHHHHHHHHHHHHHHhhhHHHHHHHHhhhcC
Q psy17567 296 PLSPCSVHEMGALCLVYIGINSAGMYTKYLTDRGQRRAFLETHRSTETRMKTQKENDQQEKLLLSGM 362 (362)
Q Consensus 296 ~~~~~~~~ql~an~ll~lc~NliG~~~~~l~e~~qR~aFLetrq~i~~rl~Le~E~~qQErLLLSVL 362 (362)
+....+-+.++..++++.|+|++|++..+|+.+++|++||+..|++..|..||.|+|-+|++++||+
T Consensus 220 e~aG~~~~~l~~r~~lH~~vHliGVHlfim~qVR~R~TFlKVGQs~l~rkdLE~EkqlKe~MIhSVM 286 (1318)
T KOG3618|consen 220 EGAGALHWELLSRGLLHGCVHLIGVHLFIMSQVRSRSTFLKVGQSILHRKDLEVEKQLKERMIHSVM 286 (1318)
T ss_pred cccCchhHHHHHHHHHhhhhhhhhhHHHHHHHHHhhhhHHHhhHHHHhhhhhHHHHHHHHHHHHhhc
Confidence 1222456789999999999999999999999999999999999999999999999999999999996
|
|
| >KOG3619|consensus | Back alignment and domain information |
|---|
| >KOG2422|consensus | Back alignment and domain information |
|---|
| >KOG0112|consensus | Back alignment and domain information |
|---|
| >KOG4364|consensus | Back alignment and domain information |
|---|
| >KOG3619|consensus | Back alignment and domain information |
|---|
| >KOG0345|consensus | Back alignment and domain information |
|---|
| >PF06375 BLVR: Bovine leukaemia virus receptor (BLVR); InterPro: IPR010474 Bovine leukemia virus (BLV) is one of the most common infectious cattle viruses, with between 30 and 40% of cows in the United States being infected | Back alignment and domain information |
|---|
| >KOG2412|consensus | Back alignment and domain information |
|---|
| >KOG4364|consensus | Back alignment and domain information |
|---|
| >PF11600 CAF-1_p150: Chromatin assembly factor 1 complex p150 subunit, N-terminal; InterPro: IPR021644 P150 is a polypeptide subunit of CAF-1, which functions in depositing newly synthesised and acetylated histones H3/H4 into chromatin during DNA replication and repair [] | Back alignment and domain information |
|---|
| >KOG4055|consensus | Back alignment and domain information |
|---|
| >PF07946 DUF1682: Protein of unknown function (DUF1682); InterPro: IPR012879 The members of this family are all hypothetical eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF06658 DUF1168: Protein of unknown function (DUF1168); InterPro: IPR009548 This family consists of several hypothetical eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0338|consensus | Back alignment and domain information |
|---|
| >PTZ00121 MAEBL; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 362 | |||
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 8e-12 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 4e-08 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 8e-06 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 9e-06 | |
| 3lvh_D | 205 | LCB, clathrin light chain B; SELF assembly, coated | 2e-07 | |
| 3lvh_D | 205 | LCB, clathrin light chain B; SELF assembly, coated | 4e-07 | |
| 3lvh_D | 205 | LCB, clathrin light chain B; SELF assembly, coated | 4e-04 | |
| 1b6a_A | 478 | Methionine aminopeptidase; angiogenesis inhibitor; | 4e-07 | |
| 1b6a_A | 478 | Methionine aminopeptidase; angiogenesis inhibitor; | 6e-06 | |
| 1b6a_A | 478 | Methionine aminopeptidase; angiogenesis inhibitor; | 9e-06 | |
| 1b6a_A | 478 | Methionine aminopeptidase; angiogenesis inhibitor; | 1e-05 | |
| 1b6a_A | 478 | Methionine aminopeptidase; angiogenesis inhibitor; | 1e-05 | |
| 1b6a_A | 478 | Methionine aminopeptidase; angiogenesis inhibitor; | 3e-05 | |
| 1b6a_A | 478 | Methionine aminopeptidase; angiogenesis inhibitor; | 4e-05 | |
| 1b6a_A | 478 | Methionine aminopeptidase; angiogenesis inhibitor; | 4e-05 | |
| 1b6a_A | 478 | Methionine aminopeptidase; angiogenesis inhibitor; | 6e-04 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 7e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-06 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-06 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 9e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-04 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-04 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 4e-04 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 5e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-04 | |
| 4ani_A | 213 | Protein GRPE; chaperone cycle, complementary assay | 2e-05 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 2e-05 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 2e-04 | |
| 1qy5_A | 269 | Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N | 5e-05 | |
| 1qy5_A | 269 | Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N | 2e-04 | |
| 1qy5_A | 269 | Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N | 3e-04 | |
| 1qy5_A | 269 | Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N | 3e-04 | |
| 1qy5_A | 269 | Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N | 4e-04 | |
| 2cg9_A | 677 | ATP-dependent molecular chaperone HSP82; chaperone | 8e-05 | |
| 2zkr_c | 421 | 60S ribosomal protein L4; protein-RNA complex, 60S | 2e-04 | |
| 2zkr_c | 421 | 60S ribosomal protein L4; protein-RNA complex, 60S | 2e-04 | |
| 2zkr_c | 421 | 60S ribosomal protein L4; protein-RNA complex, 60S | 3e-04 | |
| 2zkr_c | 421 | 60S ribosomal protein L4; protein-RNA complex, 60S | 3e-04 | |
| 2zkr_c | 421 | 60S ribosomal protein L4; protein-RNA complex, 60S | 7e-04 | |
| 1qzv_F | 154 | Plant photosystem I: subunit PSAF; photosynthesis, | 3e-04 | |
| 2j1d_G | 483 | DAAM1, disheveled-associated activator of morphoge | 3e-04 | |
| 3kio_B | 332 | Ribonuclease H2 subunit B; aicardi-goutieres syndr | 3e-04 | |
| 3kio_B | 332 | Ribonuclease H2 subunit B; aicardi-goutieres syndr | 5e-04 | |
| 3kio_B | 332 | Ribonuclease H2 subunit B; aicardi-goutieres syndr | 5e-04 | |
| 3kio_B | 332 | Ribonuclease H2 subunit B; aicardi-goutieres syndr | 7e-04 | |
| 2xzm_Y | 293 | RPS6E; ribosome, translation; 3.93A {Tetrahymena t | 7e-04 | |
| 3err_A | 536 | Fusion protein of microtubule binding domain from | 8e-04 |
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
Score = 62.5 bits (151), Expect = 8e-12
Identities = 16/75 (21%), Positives = 39/75 (52%), Gaps = 8/75 (10%)
Query: 1 MRKRRGGAGEKKKRIEKRNKEEEKEENEQEEKEKEDVEEEKNKKKKKKKKKKKKKKKKKK 60
+RK R E++KR+++ + + E E EK K+D+EE +++ ++ +K K
Sbjct: 87 IRKWRE---EQRKRLQELDAASKVMEQEWREKAKKDLEE-----WNQRQSEQVEKNKINN 138
Query: 61 KKKEEQSVKEIEESL 75
+ ++ ++ + +
Sbjct: 139 RIADKAFYQQPDADI 153
|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvh_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 9.00A {Bos taurus} Length = 205 | Back alignment and structure |
|---|
| >3lvh_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 9.00A {Bos taurus} Length = 205 | Back alignment and structure |
|---|
| >3lvh_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 9.00A {Bos taurus} Length = 205 | Back alignment and structure |
|---|
| >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 | Back alignment and structure |
|---|
| >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 | Back alignment and structure |
|---|
| >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 | Back alignment and structure |
|---|
| >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 | Back alignment and structure |
|---|
| >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 | Back alignment and structure |
|---|
| >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 | Back alignment and structure |
|---|
| >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 | Back alignment and structure |
|---|
| >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 | Back alignment and structure |
|---|
| >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >4ani_A Protein GRPE; chaperone cycle, complementary assay; 4.09A {Geobacillus kaustophilus} Length = 213 | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 | Back alignment and structure |
|---|
| >1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 | Back alignment and structure |
|---|
| >1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 | Back alignment and structure |
|---|
| >1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 | Back alignment and structure |
|---|
| >1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 | Back alignment and structure |
|---|
| >1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 | Back alignment and structure |
|---|
| >2cg9_A ATP-dependent molecular chaperone HSP82; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Length = 677 | Back alignment and structure |
|---|
| >2zkr_c 60S ribosomal protein L4; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 421 | Back alignment and structure |
|---|
| >2zkr_c 60S ribosomal protein L4; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 421 | Back alignment and structure |
|---|
| >2zkr_c 60S ribosomal protein L4; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 421 | Back alignment and structure |
|---|
| >2zkr_c 60S ribosomal protein L4; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 421 | Back alignment and structure |
|---|
| >2zkr_c 60S ribosomal protein L4; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 421 | Back alignment and structure |
|---|
| >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 | Back alignment and structure |
|---|
| >2j1d_G DAAM1, disheveled-associated activator of morphogenesis; actin assembly, protein binding; 2.55A {Homo sapiens} PDB: 2z6e_A Length = 483 | Back alignment and structure |
|---|
| >3kio_B Ribonuclease H2 subunit B; aicardi-goutieres syndrome, RNAse H2, protein complex, autoimmune disease, endonuclease, hydrolase, metal-binding; 2.90A {Mus musculus} PDB: 3p5j_B 3puf_B 3p56_B Length = 332 | Back alignment and structure |
|---|
| >3kio_B Ribonuclease H2 subunit B; aicardi-goutieres syndrome, RNAse H2, protein complex, autoimmune disease, endonuclease, hydrolase, metal-binding; 2.90A {Mus musculus} PDB: 3p5j_B 3puf_B 3p56_B Length = 332 | Back alignment and structure |
|---|
| >3kio_B Ribonuclease H2 subunit B; aicardi-goutieres syndrome, RNAse H2, protein complex, autoimmune disease, endonuclease, hydrolase, metal-binding; 2.90A {Mus musculus} PDB: 3p5j_B 3puf_B 3p56_B Length = 332 | Back alignment and structure |
|---|
| >3kio_B Ribonuclease H2 subunit B; aicardi-goutieres syndrome, RNAse H2, protein complex, autoimmune disease, endonuclease, hydrolase, metal-binding; 2.90A {Mus musculus} PDB: 3p5j_B 3puf_B 3p56_B Length = 332 | Back alignment and structure |
|---|
| >2xzm_Y RPS6E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_Y Length = 293 | Back alignment and structure |
|---|
| >3err_A Fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA...; coiled coil, ligase; HET: AMP; 2.27A {Mus musculus} Length = 536 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 362 | ||||
| d1sa0e_ | 138 | a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus | 1e-05 | |
| d1sa0e_ | 138 | a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus | 5e-04 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 9e-05 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 6e-04 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 0.002 |
| >d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Non-globular all-alpha subunits of globular proteins superfamily: Stathmin family: Stathmin domain: Stathmin 4 species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 42.2 bits (99), Expect = 1e-05
Identities = 20/81 (24%), Positives = 39/81 (48%), Gaps = 1/81 (1%)
Query: 1 MRKRRGGAGEKKKRIEKRNKEEEKEENEQEEKEKEDVEEEKNKKKKKKKKKKKKKKKKKK 60
++K+ A E++K E + E+ E E + + EE N K K+K +K + K
Sbjct: 47 IQKKLEAAEERRKYQEAELLKHLAEKREHEREVIQKAIEENNNFIKMAKEKLAQKMESNK 106
Query: 61 KKKEEQSVKEIEESLKERKEK 81
+ +E + + E L+E+ +
Sbjct: 107 ENREAH-LAAMLERLQEKDKH 126
|
| >d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00