Psyllid ID: psy17586


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100------
MVNSCTLHFIGGTLPLCRPLMYSIISTIPYLLSFIFWFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKYENLKKKSWFEDTIESLTSSGKPAQNPT
ccccEEEEEEccccccccHHHEEEEEcccccccccccEEEEEEEEEEEEcccccEEEEccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccccccccc
cccccEEEEcccccccccccEEEEEEcccccHHHHHHHHHHcEEEEEEEcccccEEEEccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccccccccccc
mvnsctlhfiggtlplcrplmySIISTIPYLLSFIFWFQVDHTIIMYlidpeglfvdyygqnkkpeevSNSIIVNMMKYENLKKKSWFEDTIESLtssgkpaqnpt
MVNSCTLHFIGGTLPLCRPLMYSIISTIPYLLSFIFWFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKYENLKKKSWFEDTIEsltssgkpaqnpt
MVNSCTLHFIGGTLPLCRPLMYSIISTIPYLLSFIFWFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKYENLKKKSWFEDTIESLTSSGKPAQNPT
****CTLHFIGGTLPLCRPLMYSIISTIPYLLSFIFWFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKYENLKKKSWFE*****************
***SCTLHFIGGTLPLCRPLMYSIISTIPYLLSFIFWFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNM******************************
MVNSCTLHFIGGTLPLCRPLMYSIISTIPYLLSFIFWFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKYENLKKKSWFEDTIE*************
**NSCTLHFIGGTLPLCRPLMYSIISTIPYLLSFIFWFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKYENLKKKSWFED****************
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVNSCTLHFIGGTLPLCRPLMYSIISTIPYLLSFIFWFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKYENLKKKSWFEDTIESLTSSGKPAQNPT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query106 2.2.26 [Sep-21-2011]
Q5SUC9284 Protein SCO1 homolog, mit yes N/A 0.415 0.154 0.565 2e-08
O75880301 Protein SCO1 homolog, mit yes N/A 0.415 0.146 0.574 2e-08
A1A4J8305 Protein SCO1 homolog, mit yes N/A 0.415 0.144 0.574 2e-08
O43819266 Protein SCO2 homolog, mit no N/A 0.405 0.161 0.418 7e-07
Q8VCL2255 Protein SCO2 homolog, mit no N/A 0.405 0.168 0.395 2e-05
A6H784266 Protein SCO2 homolog, mit no N/A 0.405 0.161 0.372 2e-05
Q5RH02279 Protein SCO2 homolog, mit yes N/A 0.405 0.154 0.418 8e-05
Q8VYP0334 Protein SCO1 homolog 1, m yes N/A 0.396 0.125 0.357 0.0007
>sp|Q5SUC9|SCO1_MOUSE Protein SCO1 homolog, mitochondrial OS=Mus musculus GN=Sco1 PE=2 SV=1 Back     alignment and function desciption
 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/46 (56%), Positives = 35/46 (76%), Gaps = 2/46 (4%)

Query: 40  VDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKYENLKKK 85
           VDHTIIMYLI P+G F+DY+GQNKK  E++ SI  +M  +  +KK+
Sbjct: 241 VDHTIIMYLIGPDGEFLDYFGQNKKKAEIAGSIAAHMRSH--MKKR 284




Thought to play a role in cellular copper homeostasis, mitochondrial redox signaling or insertion of copper into the active site of COX.
Mus musculus (taxid: 10090)
>sp|O75880|SCO1_HUMAN Protein SCO1 homolog, mitochondrial OS=Homo sapiens GN=SCO1 PE=1 SV=1 Back     alignment and function description
>sp|A1A4J8|SCO1_BOVIN Protein SCO1 homolog, mitochondrial OS=Bos taurus GN=SCO1 PE=2 SV=1 Back     alignment and function description
>sp|O43819|SCO2_HUMAN Protein SCO2 homolog, mitochondrial OS=Homo sapiens GN=SCO2 PE=1 SV=3 Back     alignment and function description
>sp|Q8VCL2|SCO2_MOUSE Protein SCO2 homolog, mitochondrial OS=Mus musculus GN=Sco2 PE=2 SV=1 Back     alignment and function description
>sp|A6H784|SCO2_BOVIN Protein SCO2 homolog, mitochondrial OS=Bos taurus GN=SCO2 PE=2 SV=1 Back     alignment and function description
>sp|Q5RH02|SCO2_DANRE Protein SCO2 homolog, mitochondrial OS=Danio rerio GN=sco2 PE=3 SV=1 Back     alignment and function description
>sp|Q8VYP0|SCO11_ARATH Protein SCO1 homolog 1, mitochondrial OS=Arabidopsis thaliana GN=HCC1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query106
357618941 209 hypothetical protein KGM_15740 [Danaus p 0.462 0.234 0.653 2e-12
383851445 288 PREDICTED: protein SCO1 homolog, mitocho 0.452 0.166 0.687 4e-12
91090063 271 PREDICTED: similar to GA21389-PA [Tribol 0.462 0.180 0.673 4e-12
270014369 214 hypothetical protein TcasGA2_TC030680, p 0.462 0.228 0.673 5e-12
312382271 390 hypothetical protein AND_05116 [Anophele 0.471 0.128 0.6 8e-12
170033218 264 SCO1, mitochondrial [Culex quinquefascia 0.462 0.185 0.612 2e-11
118785805 276 AGAP008774-PA [Anopheles gambiae str. PE 0.462 0.177 0.612 3e-11
194766067 251 GF23635 [Drosophila ananassae] gi|190617 0.462 0.195 0.591 7e-11
195437420 256 GK24460 [Drosophila willistoni] gi|19416 0.462 0.191 0.612 7e-11
350421661 292 PREDICTED: protein SCO1 homolog, mitocho 0.452 0.164 0.625 8e-11
>gi|357618941|gb|EHJ71725.1| hypothetical protein KGM_15740 [Danaus plexippus] Back     alignment and taxonomy information
 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 42/49 (85%)

Query: 40  VDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKYENLKKKSWF 88
           VDHTII+YL+DP+G FVDYYGQN+  +E+ +SI+VN+ KYE+ KK SWF
Sbjct: 161 VDHTIIIYLVDPDGEFVDYYGQNRNAKEIHDSILVNIKKYEDGKKSSWF 209




Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383851445|ref|XP_003701243.1| PREDICTED: protein SCO1 homolog, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|91090063|ref|XP_969355.1| PREDICTED: similar to GA21389-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270014369|gb|EFA10817.1| hypothetical protein TcasGA2_TC030680, partial [Tribolium castaneum] Back     alignment and taxonomy information
>gi|312382271|gb|EFR27787.1| hypothetical protein AND_05116 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|170033218|ref|XP_001844475.1| SCO1, mitochondrial [Culex quinquefasciatus] gi|167873882|gb|EDS37265.1| SCO1, mitochondrial [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|118785805|ref|XP_314900.3| AGAP008774-PA [Anopheles gambiae str. PEST] gi|116127910|gb|EAA10098.4| AGAP008774-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|194766067|ref|XP_001965146.1| GF23635 [Drosophila ananassae] gi|190617756|gb|EDV33280.1| GF23635 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195437420|ref|XP_002066638.1| GK24460 [Drosophila willistoni] gi|194162723|gb|EDW77624.1| GK24460 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|350421661|ref|XP_003492915.1| PREDICTED: protein SCO1 homolog, mitochondrial-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query106
FB|FBgn0262467251 Scox "Synthesis of cytochrome 0.462 0.195 0.571 1.9e-12
WB|WBGene00015297312 sco-1 [Caenorhabditis elegans 0.443 0.150 0.595 5.1e-11
UNIPROTKB|F1SS60305 SCO1 "Uncharacterized protein" 0.415 0.144 0.595 6.2e-09
MGI|MGI:106362284 Sco1 "SCO cytochrome oxidase d 0.415 0.154 0.565 8.5e-09
UNIPROTKB|J3QL56270 SCO1 "Protein SCO1 homolog, mi 0.415 0.162 0.574 1.2e-08
UNIPROTKB|O75880301 SCO1 "Protein SCO1 homolog, mi 0.415 0.146 0.574 1.7e-08
UNIPROTKB|A1A4J8305 SCO1 "Protein SCO1 homolog, mi 0.415 0.144 0.574 1.7e-08
RGD|1559538284 Sco1 "SCO1 cytochrome c oxidas 0.377 0.140 0.6 1.8e-08
UNIPROTKB|J9NS66304 SCO1 "Uncharacterized protein" 0.377 0.131 0.575 6.1e-08
UNIPROTKB|O43819266 SCO2 "Protein SCO2 homolog, mi 0.405 0.161 0.418 1.2e-06
FB|FBgn0262467 Scox "Synthesis of cytochrome c oxidase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 166 (63.5 bits), Expect = 1.9e-12, P = 1.9e-12
 Identities = 28/49 (57%), Positives = 39/49 (79%)

Query:    40 VDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKYENLKKKSWF 88
             VDHTIIMYL++P+G FVDYYGQN+  ++   SI+VN+ K+ ++ KK WF
Sbjct:   202 VDHTIIMYLVNPDGEFVDYYGQNRDKDQCVASILVNIAKWNSMNKKGWF 250




GO:0005743 "mitochondrial inner membrane" evidence=ISS
GO:0016531 "copper chaperone activity" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISS
GO:0008535 "respiratory chain complex IV assembly" evidence=ISS
GO:0006878 "cellular copper ion homeostasis" evidence=IEA
GO:0006825 "copper ion transport" evidence=IEA
GO:0002168 "instar larval development" evidence=IMP
GO:0007308 "oocyte construction" evidence=IMP
GO:0017004 "cytochrome complex assembly" evidence=IMP
GO:0048477 "oogenesis" evidence=IMP
GO:0004129 "cytochrome-c oxidase activity" evidence=IMP
GO:0060361 "flight" evidence=IMP
GO:0031987 "locomotion involved in locomotory behavior" evidence=IMP
WB|WBGene00015297 sco-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1SS60 SCO1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:106362 Sco1 "SCO cytochrome oxidase deficient homolog 1 (yeast)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|J3QL56 SCO1 "Protein SCO1 homolog, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O75880 SCO1 "Protein SCO1 homolog, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A1A4J8 SCO1 "Protein SCO1 homolog, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1559538 Sco1 "SCO1 cytochrome c oxidase assembly protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9NS66 SCO1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O43819 SCO2 "Protein SCO2 homolog, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5SUC9SCO1_MOUSENo assigned EC number0.56520.41500.1549yesN/A
A1A4J8SCO1_BOVINNo assigned EC number0.57440.41500.1442yesN/A
O75880SCO1_HUMANNo assigned EC number0.57440.41500.1461yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query106
cd02968142 cd02968, SCO, SCO (an acronym for Synthesis of Cyt 8e-05
>gnl|CDD|239266 cd02968, SCO, SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold Back     alignment and domain information
 Score = 38.7 bits (91), Expect = 8e-05
 Identities = 12/22 (54%), Positives = 16/22 (72%)

Query: 39  QVDHTIIMYLIDPEGLFVDYYG 60
            VDH+  +YL+DP+G  V YYG
Sbjct: 120 LVDHSAAIYLVDPDGKLVRYYG 141


Members of this family are required for the proper assembly of cytochrome c oxidase (COX). They contain a metal binding motif, typically CXXXC, which is located in a flexible loop. COX, the terminal enzyme in the respiratory chain, is imbedded in the inner mitochondrial membrane of all eukaryotes and in the plasma membrane of some prokaryotes. It is composed of two subunits, COX I and COX II. It has been proposed that Sco1 specifically delivers copper to the CuA site, a dinuclear copper center, of the COX II subunit. Mutations in human Sco1 and Sco2 cause fatal infantile hepatoencephalomyopathy and cardioencephalomyopathy, respectively. Both disorders are associated with severe COX deficiency in affected tissues. More recently, it has been argued that the redox sensitivity of the copper binding properties of Sco1 implies that it participates in signaling events rather than functioning as a chaperone that transfers copper to COX II. Length = 142

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 106
KOG2792|consensus280 99.63
COG1999207 Uncharacterized protein SCO1/SenC/PrrC, involved i 99.17
PF02630174 SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This fam 98.55
TIGR02540153 gpx7 putative glutathione peroxidase Gpx7. This mo 97.25
cd02968142 SCO SCO (an acronym for Synthesis of Cytochrome c 96.42
PLN02399236 phospholipid hydroperoxide glutathione peroxidase 95.01
PLN02412167 probable glutathione peroxidase 94.98
PTZ00056199 glutathione peroxidase; Provisional 94.86
PTZ00256183 glutathione peroxidase; Provisional 94.81
COG0386162 BtuE Glutathione peroxidase [Posttranslational mod 94.74
PRK10606183 btuE putative glutathione peroxidase; Provisional 94.6
cd00340152 GSH_Peroxidase Glutathione (GSH) peroxidase family 93.18
PRK15412185 thiol:disulfide interchange protein DsbE; Provisio 92.81
PRK03147173 thiol-disulfide oxidoreductase; Provisional 92.69
TIGR00385173 dsbE periplasmic protein thiol:disulfide oxidoredu 92.08
cd03015173 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- 90.96
KOG1651|consensus171 89.81
PRK09437154 bcp thioredoxin-dependent thiol peroxidase; Review 89.09
cd02969171 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot 88.63
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 88.04
cd02958114 UAS UAS family; UAS is a domain of unknown functio 87.99
cd03017140 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit 87.48
cd03016203 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub 87.42
TIGR03137187 AhpC peroxiredoxin. This gene contains two invaria 87.18
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 86.59
PF0282460 TGS: TGS domain; InterPro: IPR004095 The TGS domai 85.54
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 85.04
TIGR01626184 ytfJ_HI0045 conserved hypothetical protein YtfJ-fa 85.0
PTZ00253199 tryparedoxin peroxidase; Provisional 84.58
PRK13599215 putative peroxiredoxin; Provisional 84.25
PRK13190202 putative peroxiredoxin; Provisional 84.21
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 83.98
PRK13189222 peroxiredoxin; Provisional 83.42
PRK10382187 alkyl hydroperoxide reductase subunit C; Provision 81.21
PRK15000200 peroxidase; Provisional 80.19
>KOG2792|consensus Back     alignment and domain information
Probab=99.63  E-value=2.3e-16  Score=125.87  Aligned_cols=69  Identities=38%  Similarity=0.599  Sum_probs=61.6

Q ss_pred             cCCccccce--eeEEEEEecccccCCCCceeEecceeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHHHHH
Q psy17586         11 GGTLPLCRP--LMYSIISTIPYLLSFIFWFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKYE   80 (106)
Q Consensus        11 ~g~~~~~~~--~~y~v~~~~~~~~~~~~dY~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~~~~   80 (106)
                      -||.+.+++  +.||||+++++.+. ++||+||||+++|||||+|+|+.+|+.+.+++++++.|+..|+.|+
T Consensus       209 TGT~eqvk~vak~yRVYfs~gp~d~-~~DYlVDHSi~mYLidPeg~Fvd~~GrN~~~~~~~~~I~~~v~~y~  279 (280)
T KOG2792|consen  209 TGTTEQVKQVAKKYRVYFSTGPKDE-DQDYLVDHSIFMYLIDPEGEFVDYYGRNYDADELADSILKHVASYR  279 (280)
T ss_pred             cCCHHHHHHHHHHhEEeeccCCCCC-CCCeeeeeeEEEEEECCCcceehhhcccCCHHHHHHHHHHHHHhcc
Confidence            488888887  34999999866444 7899999999999999999999999999999999999999998875



>COG1999 Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems [General function prediction only] Back     alignment and domain information
>PF02630 SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This family is involved in biogenesis of respiratory and photosynthetic systems Back     alignment and domain information
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7 Back     alignment and domain information
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold Back     alignment and domain information
>PLN02399 phospholipid hydroperoxide glutathione peroxidase Back     alignment and domain information
>PLN02412 probable glutathione peroxidase Back     alignment and domain information
>PTZ00056 glutathione peroxidase; Provisional Back     alignment and domain information
>PTZ00256 glutathione peroxidase; Provisional Back     alignment and domain information
>COG0386 BtuE Glutathione peroxidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10606 btuE putative glutathione peroxidase; Provisional Back     alignment and domain information
>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>KOG1651|consensus Back     alignment and domain information
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed Back     alignment and domain information
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine Back     alignment and domain information
>TIGR03137 AhpC peroxiredoxin Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>PF02824 TGS: TGS domain; InterPro: IPR004095 The TGS domain is present in a number of enzymes, for example, in threonyl-tRNA synthetase (ThrRS), GTPase, and guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase (SpoT) [] Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 Back     alignment and domain information
>PTZ00253 tryparedoxin peroxidase; Provisional Back     alignment and domain information
>PRK13599 putative peroxiredoxin; Provisional Back     alignment and domain information
>PRK13190 putative peroxiredoxin; Provisional Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>PRK13189 peroxiredoxin; Provisional Back     alignment and domain information
>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional Back     alignment and domain information
>PRK15000 peroxidase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query106
2hrf_A173 Solution Structure Of Cu(i) P174l Hsco1 Length = 17 3e-09
2gqk_A173 Solution Structure Of Human Ni(Ii)-Sco1 Length = 17 3e-09
2ggt_A164 Crystal Structure Of Human Sco1 Complexed With Nick 7e-09
1wp0_A165 Human Sco1 Length = 165 9e-08
2rli_A171 Solution Structure Of Cu(i) Human Sco2 Length = 171 1e-07
2b7j_A200 Crystal Structure Of Yeast Sco1 With Copper Bound L 3e-04
>pdb|2HRF|A Chain A, Solution Structure Of Cu(i) P174l Hsco1 Length = 173 Back     alignment and structure

Iteration: 1

Score = 56.6 bits (135), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 3/47 (6%) Query: 40 VDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKYENLKKKS 86 VDHTIIMYLI P+G F+DY+GQNK+ E++ SI +M Y +KKS Sbjct: 130 VDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPY---RKKS 173
>pdb|2GQK|A Chain A, Solution Structure Of Human Ni(Ii)-Sco1 Length = 173 Back     alignment and structure
>pdb|2GGT|A Chain A, Crystal Structure Of Human Sco1 Complexed With Nickel. Length = 164 Back     alignment and structure
>pdb|1WP0|A Chain A, Human Sco1 Length = 165 Back     alignment and structure
>pdb|2RLI|A Chain A, Solution Structure Of Cu(i) Human Sco2 Length = 171 Back     alignment and structure
>pdb|2B7J|A Chain A, Crystal Structure Of Yeast Sco1 With Copper Bound Length = 200 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query106
2b7k_A200 SCO1 protein; metallochaperone, cytochrome C oxida 7e-11
2rli_A171 SCO2 protein homolog, mitochondrial; copper protei 1e-09
2ggt_A164 SCO1 protein homolog, mitochondrial; copper chaper 3e-09
3me7_A170 Putative uncharacterized protein; electron transfe 2e-06
1xzo_A174 BSSCO, hypothetical protein YPMQ; thioredoxin-like 3e-05
>2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A Length = 200 Back     alignment and structure
 Score = 55.1 bits (133), Expect = 7e-11
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 5/55 (9%)

Query: 39  QVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKY-----ENLKKKSWF 88
            VDH+I  YL+DPEG FVD  G+N   +   + I+ ++  Y        +K++W+
Sbjct: 141 LVDHSIFFYLMDPEGQFVDALGRNYDEKTGVDKIVEHVKSYVPAEQRAKQKEAWY 195


>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} Length = 171 Back     alignment and structure
>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A Length = 164 Back     alignment and structure
>3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A Length = 170 Back     alignment and structure
>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A Length = 174 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query106
2ggt_A164 SCO1 protein homolog, mitochondrial; copper chaper 98.53
2rli_A171 SCO2 protein homolog, mitochondrial; copper protei 98.41
4hde_A170 SCO1/SENC family lipoprotein; structural genomics, 98.38
2b7k_A200 SCO1 protein; metallochaperone, cytochrome C oxida 98.35
3me7_A170 Putative uncharacterized protein; electron transfe 97.41
2r37_A207 Glutathione peroxidase 3; plasma, structural genom 97.17
1xzo_A174 BSSCO, hypothetical protein YPMQ; thioredoxin-like 96.92
3ixr_A179 Bacterioferritin comigratory protein; alpha beta p 96.88
3kij_A180 Probable glutathione peroxidase 8; human PDI-perox 96.8
2vup_A190 Glutathione peroxidase-like protein; oxidoreductas 96.77
3gkn_A163 Bacterioferritin comigratory protein; BCP, PRX, at 96.6
2v1m_A169 Glutathione peroxidase; selenium, selenocysteine, 96.44
3dwv_A187 Glutathione peroxidase-like protein; alpha beta, 3 96.37
2k6v_A172 Putative cytochrome C oxidase assembly protein; th 96.36
2f8a_A208 Glutathione peroxidase 1; thioredoxin fold, struct 96.34
2p5q_A170 Glutathione peroxidase 5; thioredoxin fold, oxidor 96.13
3cmi_A171 Peroxiredoxin HYR1; thioredoxin-like fold, oxidore 96.11
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 96.06
2i3y_A215 Epididymal secretory glutathione peroxidase; thior 96.05
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 95.99
2gs3_A185 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 95.89
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 95.88
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 95.85
2p31_A181 CL683, glutathione peroxidase 7; thioredoxin fold, 95.59
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like 95.59
4evm_A138 Thioredoxin family protein; structural genomics, n 95.57
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 95.57
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 95.52
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 95.47
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 95.47
2l5o_A153 Putative thioredoxin; structural genomics, unknown 95.45
2obi_A183 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 95.42
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 95.29
3drn_A161 Peroxiredoxin, bacterioferritin comigratory prote 95.18
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 95.17
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 94.87
3raz_A151 Thioredoxin-related protein; structural genomics, 94.87
2yzh_A171 Probable thiol peroxidase; redox protein, antioxid 94.86
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 94.85
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 94.77
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 94.74
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 94.65
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 94.54
3f9u_A172 Putative exported cytochrome C biogenesis-related; 94.17
2jsy_A167 Probable thiol peroxidase; solution structure, ant 94.07
2ywi_A196 Hypothetical conserved protein; uncharacterized co 93.97
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 93.79
1we0_A187 Alkyl hydroperoxide reductase C; peroxiredoxin, AH 93.71
1n8j_A186 AHPC, alkyl hydroperoxide reductase C22 protein; p 93.6
3ztl_A222 Thioredoxin peroxidase; oxidoreductase, reductase, 93.5
3id6_A 268 NOP5, PRE mRNA splicing protein; C/D guide RNA, 2' 93.45
3p7x_A166 Probable thiol peroxidase; thioredoxin fold, oxido 93.44
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 93.31
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 93.28
1psq_A163 Probable thiol peroxidase; structural genomics, NY 92.83
2lrn_A152 Thiol:disulfide interchange protein; structural ge 92.65
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 92.59
1zof_A198 Alkyl hydroperoxide-reductase; decamer, toroide-sh 92.52
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 92.16
2i81_A213 2-Cys peroxiredoxin; structural genomics consortiu 91.88
2hyx_A 352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 91.54
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 91.51
2kuc_A130 Putative disulphide-isomerase; structural genomics 91.25
2cvb_A188 Probable thiol-disulfide isomerase/thioredoxin; re 91.19
3qpm_A240 Peroxiredoxin; oxidoreductase, thioredoxin fold, p 91.1
3u5r_E218 Uncharacterized protein; structural genomics, PSI- 90.98
1prx_A224 HORF6; peroxiredoxin, hydrogen peroxide, redox reg 90.87
2pn8_A211 Peroxiredoxin-4; thioredoxin, oxidoreductase, stru 90.84
4gqc_A164 Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f 90.7
1uul_A202 Tryparedoxin peroxidase homologue; peroxiredoxin, 90.62
2c0d_A221 Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th 90.48
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 90.46
2h01_A192 2-Cys peroxiredoxin; thioredoxin peroxidase, struc 90.29
1xcc_A220 1-Cys peroxiredoxin; unknown function, structural 90.27
3pla_A 388 NOP5, PRE mRNA splicing protein; RNA-binding, SAM, 90.26
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 90.12
2v2g_A233 Peroxiredoxin 6; oxidoreductase, antioxidant enzym 89.35
1zye_A220 Thioredoxin-dependent peroxide reductase; catenane 89.24
1xvw_A160 Hypothetical protein RV2238C/MT2298; thioredoxin f 89.2
2l57_A126 Uncharacterized protein; structural genomics, unkn 88.35
3tjj_A254 Peroxiredoxin-4; thioredoxin fold, sulfenylation, 88.22
1q98_A165 Thiol peroxidase, TPX; structural genomics, NYSGXR 87.29
3zrd_A200 Thiol peroxidase; oxidoreductase, 2Cys peroxiredox 87.2
2lrt_A152 Uncharacterized protein; structural genomics, thio 87.02
4g2e_A157 Peroxiredoxin; redox protein, structural genomics, 86.74
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 86.65
2a4v_A159 Peroxiredoxin DOT5; yeast nuclear thiol peroxidase 86.23
1qmv_A197 Human thioredoxin peroxidase-B; peroxiredoxin, sul 86.2
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 86.18
1xvq_A175 Thiol peroxidase; thioredoxin fold, structural gen 85.6
4eo3_A 322 Bacterioferritin comigratory protein/NADH dehydro; 83.64
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 83.55
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 83.44
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 83.36
3a2v_A249 Probable peroxiredoxin; thioredoxin peroxidase, hy 82.84
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 82.67
2l5l_A136 Thioredoxin; structural genomics, electron transpo 81.54
>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A Back     alignment and structure
Probab=98.53  E-value=5.1e-08  Score=65.76  Aligned_cols=57  Identities=44%  Similarity=0.666  Sum_probs=48.0

Q ss_pred             EEEEEecccccCCCCceeEecceeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHHHH
Q psy17586         22 YSIISTIPYLLSFIFWFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKY   79 (106)
Q Consensus        22 y~v~~~~~~~~~~~~dY~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~~~   79 (106)
                      |+|.+.+.. ....++|+++|+..+||+||+|+++..+....++++|.+.|+.+|+++
T Consensus       107 ~~v~~~p~~-~~~~~~~~~~~~~~~~lid~~G~i~~~~~g~~~~~~l~~~l~~ll~~~  163 (164)
T 2ggt_A          107 YRVYYSPGP-KDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPY  163 (164)
T ss_dssp             TTCCEEEEE-ECTTSCEEEEECCEEEEECTTSCEEEEEETTCCHHHHHHHHHHHHGGG
T ss_pred             cCeEEEecC-CCCCCCeeEeccceEEEECCCCeEEEEeCCCCCHHHHHHHHHHHHHhc
Confidence            777666533 223568999999999999999999999988889999999999998765



>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} Back     alignment and structure
>4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis} Back     alignment and structure
>2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A Back     alignment and structure
>3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A Back     alignment and structure
>2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} Back     alignment and structure
>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A Back     alignment and structure
>3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} Back     alignment and structure
>3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A Back     alignment and structure
>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} Back     alignment and structure
>3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A Back     alignment and structure
>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A Back     alignment and structure
>3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A Back     alignment and structure
>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} Back     alignment and structure
>2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A Back     alignment and structure
>2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A Back     alignment and structure
>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Back     alignment and structure
>2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A Back     alignment and structure
>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Back     alignment and structure
>1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A Back     alignment and structure
>3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D Back     alignment and structure
>3id6_A NOP5, PRE mRNA splicing protein; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} Back     alignment and structure
>3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0 Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} Back     alignment and structure
>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} Back     alignment and structure
>1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10 Back     alignment and structure
>2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A Back     alignment and structure
>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Back     alignment and structure
>2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Back     alignment and structure
>1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 PDB: 3tb2_A Back     alignment and structure
>3pla_A NOP5, PRE mRNA splicing protein; RNA-binding, SAM, box C/D RNA; HET: SAH; 3.15A {Sulfolobus solfataricus} PDB: 3id5_A* Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A Back     alignment and structure
>1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 Back     alignment and structure
>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C Back     alignment and structure
>1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 Back     alignment and structure
>3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Back     alignment and structure
>2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 Back     alignment and structure
>1qmv_A Human thioredoxin peroxidase-B; peroxiredoxin, sulphinic acid; 1.7A {Homo sapiens} SCOP: c.47.1.10 PDB: 1qq2_A 2z9s_A 2rii_A 3hy2_A* Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Back     alignment and structure
>1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A Back     alignment and structure
>4eo3_A Bacterioferritin comigratory protein/NADH dehydro; thioredoxin-fold, alpha-beta-aplha sandwich fold, antioxidan oxidoreductase, FMN binding; HET: FMN; 1.65A {Thermotoga maritima} Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 106
d1wp0a1160 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco 8e-06
d2b7ka1169 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco 6e-04
>d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} Length = 160 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione peroxidase-like
domain: Thioredoxin-like protein Sco1 (YpmQ), soluble domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 40.1 bits (92), Expect = 8e-06
 Identities = 24/43 (55%), Positives = 32/43 (74%)

Query: 37  WFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKY 79
            + VDHTIIMYLI P+G F+DY+GQNK+  E++ SI  +M  Y
Sbjct: 118 DYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPY 160


>d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} Length = 169 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query106
d1wp0a1160 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 99.1
d2b7ka1169 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 98.73
d1xzoa1172 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 98.11
d2f8aa1184 Glutathione peroxidase {Human (Homo sapiens) [TaxI 95.95
d1z5ye1136 Thioredoxin-like protein CcmG (CycY, DsbE) {Escher 95.37
d1knga_144 Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr 94.58
d2b5xa1143 thiol:disulfide oxidoreductase YkuV {Bacillus subt 94.46
d2fy6a1143 Peptide methionine sulfoxide reductase MsrA/MsrB, 93.52
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 92.04
d1jfua_176 Membrane-anchored thioredoxin-like protein TlpA, s 91.25
d2cx4a1160 Bacterioferritin comigratory protein {Archaeon Aer 90.44
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 89.92
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 89.78
d1e2ya_167 Tryparedoxin peroxidase (thioredoxin peroxidase ho 87.67
d2zcta1237 Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} 86.56
d1zofa1170 Thioredoxin reductase TsaA {Helicobacter pylori [T 85.75
d2bmxa1169 Alkyl hydroperoxide reductase AhpC {Mycobacterium 85.67
d1zyea1158 Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ 81.55
d1uula_194 Tryparedoxin peroxidase (thioredoxin peroxidase ho 80.47
d1n8ja_186 Alkyl hydroperoxide reductase AhpC {Salmonella typ 80.07
>d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione peroxidase-like
domain: Thioredoxin-like protein Sco1 (YpmQ), soluble domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.10  E-value=1.4e-11  Score=82.09  Aligned_cols=57  Identities=44%  Similarity=0.666  Sum_probs=48.0

Q ss_pred             EEEEEecccccCCCCceeEecceeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHHHH
Q psy17586         22 YSIISTIPYLLSFIFWFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKY   79 (106)
Q Consensus        22 y~v~~~~~~~~~~~~dY~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~~~   79 (106)
                      |.++..+.. ...+++|.|+||..+||+||+|+++..|+...++++|+++|+++|++|
T Consensus       104 ~~~~~~~~~-~~~~~~~~~~H~~~~~LId~~G~i~~~~~~~~~~~~i~~~I~~~lk~~  160 (160)
T d1wp0a1         104 YRVYYSPGP-KDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPY  160 (160)
T ss_dssp             TTCCEEECC-CCGGGCCCEEECCEEEEECTTSCEEEEEETTCCHHHHHHHHHHHHTTC
T ss_pred             hheeeeccc-CCCCCCceEeccceEEEECCCCcEEEEECCCCCHHHHHHHHHHHHhcC
Confidence            666555443 233567999999999999999999999999999999999999999764



>d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure