Psyllid ID: psy17588
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 62 | ||||||
| 239790211 | 118 | ACYPI002371 [Acyrthosiphon pisum] | 0.967 | 0.508 | 0.783 | 2e-21 | |
| 193609423 | 154 | PREDICTED: probable ubiquitin-conjugatin | 0.967 | 0.389 | 0.783 | 4e-21 | |
| 332026457 | 534 | Putative ubiquitin-conjugating enzyme E2 | 0.967 | 0.112 | 0.683 | 8e-19 | |
| 332373780 | 168 | unknown [Dendroctonus ponderosae] | 0.967 | 0.357 | 0.733 | 1e-18 | |
| 357619053 | 79 | hypothetical protein KGM_19970 [Danaus p | 0.951 | 0.746 | 0.728 | 2e-18 | |
| 91079008 | 154 | PREDICTED: similar to AGAP005324-PB [Tri | 0.967 | 0.389 | 0.766 | 2e-18 | |
| 307195251 | 181 | Probable ubiquitin-conjugating enzyme E2 | 0.967 | 0.331 | 0.7 | 2e-18 | |
| 383853361 | 192 | PREDICTED: ubiquitin-conjugating enzyme | 0.967 | 0.312 | 0.7 | 3e-18 | |
| 322798725 | 187 | hypothetical protein SINV_13044 [Solenop | 0.967 | 0.320 | 0.7 | 5e-18 | |
| 328791001 | 164 | PREDICTED: probable ubiquitin-conjugatin | 0.951 | 0.359 | 0.661 | 2e-17 |
| >gi|239790211|dbj|BAH71680.1| ACYPI002371 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 106 bits (264), Expect = 2e-21, Method: Compositional matrix adjust.
Identities = 47/60 (78%), Positives = 55/60 (91%)
Query: 1 MSLMKEPPPGMEVDSDKAEQNLNLWTIHMKGAEGTLYDGEEFQLQFKFGPKYPFDSPECT 60
+SL+KEPPPGM VD D+AEQNLN+WTI+M+GAEGTLYDGE+FQLQFKFG YPF+SPE T
Sbjct: 16 ISLVKEPPPGMVVDVDQAEQNLNVWTINMQGAEGTLYDGEQFQLQFKFGTSYPFESPEVT 75
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|193609423|ref|XP_001950447.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 W-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|332026457|gb|EGI66585.1| Putative ubiquitin-conjugating enzyme E2 W [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|332373780|gb|AEE62031.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
| >gi|357619053|gb|EHJ71786.1| hypothetical protein KGM_19970 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|91079008|ref|XP_974790.1| PREDICTED: similar to AGAP005324-PB [Tribolium castaneum] gi|270003673|gb|EFA00121.1| hypothetical protein TcasGA2_TC002937 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|307195251|gb|EFN77213.1| Probable ubiquitin-conjugating enzyme E2 W [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|383853361|ref|XP_003702191.1| PREDICTED: ubiquitin-conjugating enzyme E2 W-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|322798725|gb|EFZ20323.1| hypothetical protein SINV_13044 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|328791001|ref|XP_392626.3| PREDICTED: probable ubiquitin-conjugating enzyme E2 W-like [Apis mellifera] gi|380019359|ref|XP_003693577.1| PREDICTED: ubiquitin-conjugating enzyme E2 W-like [Apis florea] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 62 | ||||||
| FB|FBgn0033544 | 190 | CG7220 [Drosophila melanogaste | 0.967 | 0.315 | 0.65 | 1.4e-18 | |
| UNIPROTKB|Q28FC1 | 151 | ube2w "Ubiquitin-conjugating e | 0.935 | 0.384 | 0.5 | 6.2e-14 | |
| UNIPROTKB|F1NEJ6 | 151 | UBE2W "Uncharacterized protein | 0.935 | 0.384 | 0.482 | 1.3e-13 | |
| UNIPROTKB|F1NEJ7 | 154 | UBE2W "Uncharacterized protein | 0.935 | 0.376 | 0.482 | 1.3e-13 | |
| UNIPROTKB|A6H795 | 151 | UBE2W "Ubiquitin-conjugating e | 0.935 | 0.384 | 0.482 | 1.3e-13 | |
| UNIPROTKB|E2QV56 | 151 | UBE2W "Uncharacterized protein | 0.935 | 0.384 | 0.482 | 1.3e-13 | |
| UNIPROTKB|F1Q244 | 151 | UBE2W "Uncharacterized protein | 0.935 | 0.384 | 0.482 | 1.3e-13 | |
| UNIPROTKB|F6X9L9 | 180 | UBE2W "Uncharacterized protein | 0.935 | 0.322 | 0.482 | 1.3e-13 | |
| UNIPROTKB|C9JJH0 | 159 | UBE2W "Ubiquitin-conjugating e | 0.935 | 0.364 | 0.482 | 1.3e-13 | |
| UNIPROTKB|H0YB73 | 155 | UBE2W "Ubiquitin-conjugating e | 0.935 | 0.374 | 0.482 | 1.3e-13 |
| FB|FBgn0033544 CG7220 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 224 (83.9 bits), Expect = 1.4e-18, P = 1.4e-18
Identities = 39/60 (65%), Positives = 50/60 (83%)
Query: 1 MSLMKEPPPGMEVDSDKAEQNLNLWTIHMKGAEGTLYDGEEFQLQFKFGPKYPFDSPECT 60
MSL+KEPPPG+ +D++ +QNL+ W I++KG EGTLY+GE+FQL FKF KYPFDSPE T
Sbjct: 52 MSLIKEPPPGVTIDTESVQQNLSEWKINIKGFEGTLYEGEDFQLLFKFNNKYPFDSPEVT 111
|
|
| UNIPROTKB|Q28FC1 ube2w "Ubiquitin-conjugating enzyme E2 W" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NEJ6 UBE2W "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NEJ7 UBE2W "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6H795 UBE2W "Ubiquitin-conjugating enzyme E2 W" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QV56 UBE2W "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1Q244 UBE2W "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6X9L9 UBE2W "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9JJH0 UBE2W "Ubiquitin-conjugating enzyme E2 W" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0YB73 UBE2W "Ubiquitin-conjugating enzyme E2 W" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 62 | |||
| pfam00179 | 139 | pfam00179, UQ_con, Ubiquitin-conjugating enzyme | 4e-12 | |
| cd00195 | 141 | cd00195, UBCc, Ubiquitin-conjugating enzyme E2, ca | 3e-09 | |
| smart00212 | 145 | smart00212, UBCc, Ubiquitin-conjugating enzyme E2, | 6e-09 | |
| PTZ00390 | 152 | PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; | 4e-05 | |
| COG5078 | 153 | COG5078, COG5078, Ubiquitin-protein ligase [Posttr | 0.003 |
| >gnl|CDD|215772 pfam00179, UQ_con, Ubiquitin-conjugating enzyme | Back alignment and domain information |
|---|
Score = 56.1 bits (136), Expect = 4e-12
Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 2/60 (3%)
Query: 1 MSLMKEPPPGMEVDSDKAEQNLNLWTIHMKGAEGTLYDGEEFQLQFKFGPKYPFDSPECT 60
L+K+PPPG+ + NL W + + G EGT Y+G F+L +F YPF P+
Sbjct: 7 KELLKDPPPGISAFPV--DDNLFEWEVTIIGPEGTPYEGGVFKLDIEFPEDYPFKPPKVK 64
|
Proteins destined for proteasome-mediated degradation may be ubiquitinated. Ubiquitination follows conjugation of ubiquitin to a conserved cysteine residue of UBC homologues. TSG101 is one of several UBC homologues that lacks this active site cysteine. Length = 139 |
| >gnl|CDD|238117 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain | Back alignment and domain information |
|---|
| >gnl|CDD|214562 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, catalytic domain homologues | Back alignment and domain information |
|---|
| >gnl|CDD|240397 PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227410 COG5078, COG5078, Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 62 | |||
| KOG0417|consensus | 148 | 99.93 | ||
| COG5078 | 153 | Ubiquitin-protein ligase [Posttranslational modifi | 99.91 | |
| KOG0419|consensus | 152 | 99.89 | ||
| PLN00172 | 147 | ubiquitin conjugating enzyme; Provisional | 99.87 | |
| PTZ00390 | 152 | ubiquitin-conjugating enzyme; Provisional | 99.87 | |
| KOG0426|consensus | 165 | 99.84 | ||
| KOG0425|consensus | 171 | 99.84 | ||
| PF00179 | 140 | UQ_con: Ubiquitin-conjugating enzyme; InterPro: IP | 99.82 | |
| cd00195 | 141 | UBCc Ubiquitin-conjugating enzyme E2, catalytic (U | 99.82 | |
| KOG0418|consensus | 200 | 99.78 | ||
| KOG0421|consensus | 175 | 99.78 | ||
| smart00212 | 145 | UBCc Ubiquitin-conjugating enzyme E2, catalytic do | 99.78 | |
| KOG0424|consensus | 158 | 99.77 | ||
| KOG0894|consensus | 244 | 99.77 | ||
| KOG0428|consensus | 314 | 99.6 | ||
| KOG0427|consensus | 161 | 99.58 | ||
| KOG0416|consensus | 189 | 99.54 | ||
| KOG0422|consensus | 153 | 99.49 | ||
| KOG0423|consensus | 223 | 99.4 | ||
| KOG0420|consensus | 184 | 99.39 | ||
| KOG0896|consensus | 138 | 99.13 | ||
| KOG0429|consensus | 258 | 99.1 | ||
| KOG0895|consensus | 1101 | 99.08 | ||
| KOG0895|consensus | 1101 | 99.0 | ||
| PF05773 | 113 | RWD: RWD domain; InterPro: IPR006575 The RWD eukar | 96.57 | |
| smart00591 | 107 | RWD domain in RING finger and WD repeat containing | 95.72 | |
| PF14461 | 133 | Prok-E2_B: Prokaryotic E2 family B | 94.75 | |
| PF05743 | 121 | UEV: UEV domain; InterPro: IPR008883 The N-termina | 93.98 | |
| PF14462 | 122 | Prok-E2_E: Prokaryotic E2 family E | 92.25 | |
| KOG4018|consensus | 215 | 90.2 | ||
| PF08694 | 161 | UFC1: Ubiquitin-fold modifier-conjugating enzyme 1 | 89.81 | |
| cd00421 | 146 | intradiol_dioxygenase Intradiol dioxygenases catal | 87.42 | |
| KOG0897|consensus | 122 | 85.82 | ||
| cd03457 | 188 | intradiol_dioxygenase_like Intradiol dioxygenase s | 85.01 | |
| cd03459 | 158 | 3,4-PCD Protocatechuate 3,4-dioxygenase (3,4-PCD) | 83.64 | |
| KOG0309|consensus | 1081 | 82.52 | ||
| TIGR02423 | 193 | protocat_alph protocatechuate 3,4-dioxygenase, alp | 80.85 |
| >KOG0417|consensus | Back alignment and domain information |
|---|
Probab=99.93 E-value=5.3e-26 Score=131.21 Aligned_cols=59 Identities=32% Similarity=0.710 Sum_probs=56.6
Q ss_pred CcccCCCCCeEEeecCCCCCcccEEEEEECCCCCCCCCCEEEEEEEcCCCCCCCCCeEEeC
Q psy17588 2 SLMKEPPPGMEVDSDKAEQNLNLWTIHMKGAEGTLYDGEEFQLQFKFGPKYPFDSPECTKK 62 (62)
Q Consensus 2 ~l~~~~~~~i~~~~~~~~~~l~~w~~~i~gp~~t~y~gg~f~~~i~~~~~yP~~pP~v~F~ 62 (62)
+|++++++||++.+. ++|+++|+++|.||.+|+||||+|++.|.||++||++||+|+|+
T Consensus 12 ~l~~dp~~~~~~~~~--~dnl~~w~a~I~GP~~SpYEgG~F~l~I~~p~~YP~~PPkV~F~ 70 (148)
T KOG0417|consen 12 DLLRDPPPGCSAGPV--GDNLFHWQATILGPPGSPYEGGVFFLEIHFPEDYPFKPPKVRFL 70 (148)
T ss_pred HHhcCCCCCCccCCC--CCceeeEEEEEECCCCCCcCCCEEEEEEECCCCCCCCCCceEee
Confidence 568899999999987 99999999999999999999999999999999999999999995
|
|
| >COG5078 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0419|consensus | Back alignment and domain information |
|---|
| >PLN00172 ubiquitin conjugating enzyme; Provisional | Back alignment and domain information |
|---|
| >PTZ00390 ubiquitin-conjugating enzyme; Provisional | Back alignment and domain information |
|---|
| >KOG0426|consensus | Back alignment and domain information |
|---|
| >KOG0425|consensus | Back alignment and domain information |
|---|
| >PF00179 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IPR000608 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] | Back alignment and domain information |
|---|
| >cd00195 UBCc Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain | Back alignment and domain information |
|---|
| >KOG0418|consensus | Back alignment and domain information |
|---|
| >KOG0421|consensus | Back alignment and domain information |
|---|
| >smart00212 UBCc Ubiquitin-conjugating enzyme E2, catalytic domain homologues | Back alignment and domain information |
|---|
| >KOG0424|consensus | Back alignment and domain information |
|---|
| >KOG0894|consensus | Back alignment and domain information |
|---|
| >KOG0428|consensus | Back alignment and domain information |
|---|
| >KOG0427|consensus | Back alignment and domain information |
|---|
| >KOG0416|consensus | Back alignment and domain information |
|---|
| >KOG0422|consensus | Back alignment and domain information |
|---|
| >KOG0423|consensus | Back alignment and domain information |
|---|
| >KOG0420|consensus | Back alignment and domain information |
|---|
| >KOG0896|consensus | Back alignment and domain information |
|---|
| >KOG0429|consensus | Back alignment and domain information |
|---|
| >KOG0895|consensus | Back alignment and domain information |
|---|
| >KOG0895|consensus | Back alignment and domain information |
|---|
| >PF05773 RWD: RWD domain; InterPro: IPR006575 The RWD eukaryotic domain is found in RING finger (IPR001841 from INTERPRO) and WD repeat (IPR001680 from INTERPRO) containing proteins and DEXDc-like helicase (IPR001410 from INTERPRO) subfamily related to the ubiquitin-conjugating enzymes domain (IPR000608 from INTERPRO) | Back alignment and domain information |
|---|
| >smart00591 RWD domain in RING finger and WD repeat containing proteins and DEXDc-like helicases subfamily related to the UBCc domain | Back alignment and domain information |
|---|
| >PF14461 Prok-E2_B: Prokaryotic E2 family B | Back alignment and domain information |
|---|
| >PF05743 UEV: UEV domain; InterPro: IPR008883 The N-terminal ubiquitin E2 variant (UEV) domain is ~145 amino acid residues in length and shows significant sequence similarity to E2 ubiquitin ligases but is unable to catalyze ubiquitin transfer as it lacks the active site cysteine that forms the transient thioester bond with the C terminus of ubiquitin (Ub) | Back alignment and domain information |
|---|
| >PF14462 Prok-E2_E: Prokaryotic E2 family E | Back alignment and domain information |
|---|
| >KOG4018|consensus | Back alignment and domain information |
|---|
| >PF08694 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1; InterPro: IPR014806 Ubiquitin-like (UBL) post-translational modifiers are covalently linked to most, if not all, target protein(s) through an enzymatic cascade analogous to ubiquitylation, consisting of E1 (activating), E2 (conjugating), and E3 (ligating) enzymes | Back alignment and domain information |
|---|
| >cd00421 intradiol_dioxygenase Intradiol dioxygenases catalyze the critical ring-cleavage step in the conversion of catecholate derivatives to citric acid cycle intermediates | Back alignment and domain information |
|---|
| >KOG0897|consensus | Back alignment and domain information |
|---|
| >cd03457 intradiol_dioxygenase_like Intradiol dioxygenase supgroup | Back alignment and domain information |
|---|
| >cd03459 3,4-PCD Protocatechuate 3,4-dioxygenase (3,4-PCD) catalyzes the oxidative ring cleavage of 3,4-dihydroxybenzoate to produce beta-carboxy-cis,cis-muconate | Back alignment and domain information |
|---|
| >KOG0309|consensus | Back alignment and domain information |
|---|
| >TIGR02423 protocat_alph protocatechuate 3,4-dioxygenase, alpha subunit | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 62 | ||||
| 2a7l_A | 136 | Structure Of The Human Hypothetical Ubiquitin-Conju | 1e-13 |
| >pdb|2A7L|A Chain A, Structure Of The Human Hypothetical Ubiquitin-Conjugating Enzyme, Loc55284 Length = 136 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 62 | |||
| 2a7l_A | 136 | Hypothetical ubiquitin-conjugating enzyme LOC55284 | 8e-19 | |
| 2fo3_A | 125 | Ubiquitin-conjugating enzyme; SGC, UBC, structural | 2e-15 | |
| 2h2y_A | 136 | Ubiquitin-conjugating enzyme; structural genomics, | 5e-15 | |
| 2awf_A | 172 | Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co | 2e-10 | |
| 1zdn_A | 158 | Ubiquitin-conjugating enzyme E2S; structural genom | 3e-10 | |
| 2a4d_A | 160 | Ubiquitin-conjugating enzyme E2 variant 1; alterna | 3e-10 | |
| 3rz3_A | 183 | Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj | 3e-10 | |
| 2onu_A | 152 | Ubiquitin-conjugating enzyme, putative; UBC, plasm | 3e-10 | |
| 2hlw_A | 170 | Ubiquitin-conjugating enzyme E2 variant 1; ubiquit | 4e-10 | |
| 2c2v_B | 154 | Ubiquitin-conjugating enzyme E2 N; chaperone, heat | 7e-10 | |
| 2e2c_A | 156 | Ubiquitin conjugating enzyme; ubiquitin conjugatio | 7e-10 | |
| 2pwq_A | 216 | Ubiquitin conjugating enzyme; structural genomics | 9e-10 | |
| 2r0j_A | 149 | Ubiquitin carrier protein; ubiquitin conjugating, | 1e-09 | |
| 2gjd_A | 157 | Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT | 1e-09 | |
| 1jat_A | 155 | Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig | 1e-09 | |
| 1yh2_A | 169 | HSPC150 protein similar to ubiquitin-conjugating e | 1e-09 | |
| 1fxt_A | 149 | Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM | 2e-09 | |
| 1z2u_A | 150 | Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro | 2e-09 | |
| 3bzh_A | 194 | Ubiquitin-conjugating enzyme E2 E1; structural gen | 2e-09 | |
| 2aak_A | 152 | UBC1, ubiquitin conjugating enzyme; ubiquitin conj | 2e-09 | |
| 2ayv_A | 166 | Ubiquitin-conjugating enzyme E2; structural genomi | 3e-09 | |
| 2z5d_A | 179 | Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig | 3e-09 | |
| 1i7k_A | 179 | Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A | 3e-09 | |
| 2grr_A | 161 | Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj | 3e-09 | |
| 3h8k_A | 164 | Ubiquitin-conjugating enzyme E2 G2; alpha beta, al | 3e-09 | |
| 2c4o_A | 165 | Ubiquitin-conjugating enzyme E2 D2; thioesterifica | 4e-09 | |
| 1jat_B | 138 | Ubiquitin-conjugating enzyme variant MMS2; UEV, li | 4e-09 | |
| 2ucz_A | 165 | UBC7, ubiquitin conjugating enzyme; ubiquitin conj | 5e-09 | |
| 3rcz_B | 163 | SUMO-conjugating enzyme UBC9; SUMO-like domain, pr | 5e-09 | |
| 1tte_A | 215 | Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq | 6e-09 | |
| 2q0v_A | 156 | Ubiquitin-conjugating enzyme E2, putative; malaria | 6e-09 | |
| 4ddg_A | 399 | Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI | 8e-09 | |
| 1ayz_A | 169 | UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin | 1e-08 | |
| 2f4z_A | 193 | Tgtwinscan_2721 - E2 domain; ubiquitin conjugating | 2e-08 | |
| 1yrv_A | 169 | Ubiquitin-conjugating ligase MGC351130; structural | 2e-08 | |
| 2bep_A | 159 | Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 | 3e-08 | |
| 3k9o_A | 201 | Ubiquitin-conjugating enzyme E2 K; E2-25K, complex | 4e-08 | |
| 3e46_A | 253 | Ubiquitin-conjugating enzyme E2-25 kDa; huntington | 6e-08 | |
| 1yf9_A | 171 | Ubiquitin carrier protein 4; SGPP, structural geno | 7e-08 | |
| 1wzv_A | 155 | Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A | 9e-08 | |
| 2f4w_A | 187 | Ubiquitin-conjugating enzyme E2, J2; endoplasmic r | 1e-07 | |
| 2y9m_A | 172 | Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra | 1e-07 | |
| 1c4z_D | 154 | UBCH7, ubiquitin conjugating enzyme E2; bilobal st | 1e-06 | |
| 3fn1_B | 167 | NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin | 1e-06 | |
| 3o2u_A | 190 | NEDD8-conjugating enzyme UBC12; E2 conjugase, liga | 2e-06 | |
| 3ceg_A | 323 | Baculoviral IAP repeat-containing protein 6; apopt | 4e-06 | |
| 2nvu_C | 180 | NEDD8-conjugating enzyme UBC12; multifunction macr | 4e-06 | |
| 4ds2_A | 167 | Ubiquitin-conjugating enzyme E2, putative; structu | 4e-06 | |
| 1y8x_A | 160 | Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju | 1e-05 | |
| 1zuo_A | 186 | Hypothetical protein LOC92912; ligase, ubiquitin-c | 4e-05 |
| >2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Length = 136 | Back alignment and structure |
|---|
Score = 72.7 bits (179), Expect = 8e-19
Identities = 28/60 (46%), Positives = 42/60 (70%)
Query: 1 MSLMKEPPPGMEVDSDKAEQNLNLWTIHMKGAEGTLYDGEEFQLQFKFGPKYPFDSPECT 60
++L +PPPGM ++ + ++ W + M+GA GTLY+GE+FQL FKF +YPFDSP+
Sbjct: 32 LALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVM 91
|
| >2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Length = 125 | Back alignment and structure |
|---|
| >2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Length = 136 | Back alignment and structure |
|---|
| >2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Length = 172 | Back alignment and structure |
|---|
| >1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Length = 158 | Back alignment and structure |
|---|
| >2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Length = 160 | Back alignment and structure |
|---|
| >3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Length = 183 | Back alignment and structure |
|---|
| >2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Length = 152 | Back alignment and structure |
|---|
| >2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Length = 154 | Back alignment and structure |
|---|
| >2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Length = 156 | Back alignment and structure |
|---|
| >2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Length = 216 | Back alignment and structure |
|---|
| >2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Length = 149 | Back alignment and structure |
|---|
| >2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Length = 157 | Back alignment and structure |
|---|
| >1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Length = 155 | Back alignment and structure |
|---|
| >1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 169 | Back alignment and structure |
|---|
| >1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Length = 149 | Back alignment and structure |
|---|
| >1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Length = 150 | Back alignment and structure |
|---|
| >3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Length = 194 | Back alignment and structure |
|---|
| >2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Length = 152 | Back alignment and structure |
|---|
| >2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 166 | Back alignment and structure |
|---|
| >2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Length = 179 | Back alignment and structure |
|---|
| >1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Length = 179 | Back alignment and structure |
|---|
| >2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Length = 161 | Back alignment and structure |
|---|
| >3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} PDB: 3fsh_A 2cyx_A 2kly_A Length = 164 | Back alignment and structure |
|---|
| >2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Length = 165 | Back alignment and structure |
|---|
| >1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Length = 138 | Back alignment and structure |
|---|
| >2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 165 | Back alignment and structure |
|---|
| >3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} Length = 163 | Back alignment and structure |
|---|
| >1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Length = 215 | Back alignment and structure |
|---|
| >2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Length = 156 | Back alignment and structure |
|---|
| >4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Length = 399 | Back alignment and structure |
|---|
| >1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 169 | Back alignment and structure |
|---|
| >2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 193 | Back alignment and structure |
|---|
| >1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Length = 169 | Back alignment and structure |
|---|
| >2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Length = 159 | Back alignment and structure |
|---|
| >3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Length = 201 | Back alignment and structure |
|---|
| >3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Length = 253 | Back alignment and structure |
|---|
| >1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Length = 171 | Back alignment and structure |
|---|
| >1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Length = 155 | Back alignment and structure |
|---|
| >2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 187 | Back alignment and structure |
|---|
| >2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Length = 172 | Back alignment and structure |
|---|
| >1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Length = 154 | Back alignment and structure |
|---|
| >3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Length = 167 | Back alignment and structure |
|---|
| >3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Length = 190 | Back alignment and structure |
|---|
| >3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Length = 323 | Back alignment and structure |
|---|
| >2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Length = 180 | Back alignment and structure |
|---|
| >4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Length = 167 | Back alignment and structure |
|---|
| >1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Length = 160 | Back alignment and structure |
|---|
| >1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Length = 186 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 62 | |||
| 2fo3_A | 125 | Ubiquitin-conjugating enzyme; SGC, UBC, structural | 99.9 | |
| 2h2y_A | 136 | Ubiquitin-conjugating enzyme; structural genomics, | 99.89 | |
| 2c2v_B | 154 | Ubiquitin-conjugating enzyme E2 N; chaperone, heat | 99.89 | |
| 1zdn_A | 158 | Ubiquitin-conjugating enzyme E2S; structural genom | 99.89 | |
| 2ayv_A | 166 | Ubiquitin-conjugating enzyme E2; structural genomi | 99.89 | |
| 2r0j_A | 149 | Ubiquitin carrier protein; ubiquitin conjugating, | 99.89 | |
| 4gpr_A | 151 | Ubiquitin-conjugating enzyme family protein; ubiqu | 99.89 | |
| 2ucz_A | 165 | UBC7, ubiquitin conjugating enzyme; ubiquitin conj | 99.88 | |
| 2c4o_A | 165 | Ubiquitin-conjugating enzyme E2 D2; thioesterifica | 99.88 | |
| 2awf_A | 172 | Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co | 99.88 | |
| 1yh2_A | 169 | HSPC150 protein similar to ubiquitin-conjugating e | 99.88 | |
| 1fxt_A | 149 | Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM | 99.88 | |
| 1z2u_A | 150 | Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro | 99.88 | |
| 2a7l_A | 136 | Hypothetical ubiquitin-conjugating enzyme LOC55284 | 99.88 | |
| 1ayz_A | 169 | UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin | 99.88 | |
| 2e2c_A | 156 | Ubiquitin conjugating enzyme; ubiquitin conjugatio | 99.88 | |
| 1yrv_A | 169 | Ubiquitin-conjugating ligase MGC351130; structural | 99.88 | |
| 3h8k_A | 164 | Ubiquitin-conjugating enzyme E2 G2; alpha beta, al | 99.88 | |
| 2f4w_A | 187 | Ubiquitin-conjugating enzyme E2, J2; endoplasmic r | 99.88 | |
| 1jat_A | 155 | Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig | 99.88 | |
| 2pwq_A | 216 | Ubiquitin conjugating enzyme; structural genomics | 99.88 | |
| 2aak_A | 152 | UBC1, ubiquitin conjugating enzyme; ubiquitin conj | 99.88 | |
| 3rcz_B | 163 | SUMO-conjugating enzyme UBC9; SUMO-like domain, pr | 99.88 | |
| 1jat_B | 138 | Ubiquitin-conjugating enzyme variant MMS2; UEV, li | 99.88 | |
| 2q0v_A | 156 | Ubiquitin-conjugating enzyme E2, putative; malaria | 99.87 | |
| 3bzh_A | 194 | Ubiquitin-conjugating enzyme E2 E1; structural gen | 99.87 | |
| 1i7k_A | 179 | Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A | 99.87 | |
| 3rz3_A | 183 | Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj | 99.87 | |
| 2a4d_A | 160 | Ubiquitin-conjugating enzyme E2 variant 1; alterna | 99.86 | |
| 2gjd_A | 157 | Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT | 99.86 | |
| 2f4z_A | 193 | Tgtwinscan_2721 - E2 domain; ubiquitin conjugating | 99.86 | |
| 2bep_A | 159 | Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 | 99.86 | |
| 2grr_A | 161 | Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj | 99.85 | |
| 3k9o_A | 201 | Ubiquitin-conjugating enzyme E2 K; E2-25K, complex | 99.85 | |
| 2hlw_A | 170 | Ubiquitin-conjugating enzyme E2 variant 1; ubiquit | 99.84 | |
| 1c4z_D | 154 | UBCH7, ubiquitin conjugating enzyme E2; bilobal st | 99.84 | |
| 1wzv_A | 155 | Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A | 99.84 | |
| 3fn1_B | 167 | NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin | 99.83 | |
| 1tte_A | 215 | Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq | 99.83 | |
| 2onu_A | 152 | Ubiquitin-conjugating enzyme, putative; UBC, plasm | 99.83 | |
| 3e46_A | 253 | Ubiquitin-conjugating enzyme E2-25 kDa; huntington | 99.83 | |
| 4ddg_A | 399 | Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI | 99.83 | |
| 1y8x_A | 160 | Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju | 99.83 | |
| 2y9m_A | 172 | Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra | 99.82 | |
| 2nvu_C | 180 | NEDD8-conjugating enzyme UBC12; multifunction macr | 99.82 | |
| 4ds2_A | 167 | Ubiquitin-conjugating enzyme E2, putative; structu | 99.81 | |
| 1yf9_A | 171 | Ubiquitin carrier protein 4; SGPP, structural geno | 99.78 | |
| 3ceg_A | 323 | Baculoviral IAP repeat-containing protein 6; apopt | 99.78 | |
| 2z5d_A | 179 | Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig | 99.78 | |
| 1zuo_A | 186 | Hypothetical protein LOC92912; ligase, ubiquitin-c | 99.77 | |
| 3o2u_A | 190 | NEDD8-conjugating enzyme UBC12; E2 conjugase, liga | 99.75 | |
| 2z6o_A | 172 | UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, p | 99.51 | |
| 3kpa_A | 168 | Probable ubiquitin fold modifier conjugating ENZY; | 99.05 | |
| 3r3q_A | 162 | Suppressor protein STP22 of temperature-sensitive | 98.53 | |
| 3obq_A | 146 | Tumor susceptibility gene 101 protein; protein tra | 98.05 | |
| 2ebm_A | 128 | RWD domain-containing protein 1; alpha+beta sandwi | 96.42 | |
| 2yz0_A | 138 | Serine/threonine-protein kinase GCN2; A-B-B-B-B-A- | 96.19 | |
| 2ebk_A | 128 | RWD domain-containing protein 3; alpha+beta sandwi | 95.61 | |
| 2day_A | 128 | Ring finger protein 25; ligase, metal-binding, UB1 | 95.32 | |
| 1ukx_A | 137 | GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple | 95.15 | |
| 2daw_A | 154 | RWD domain containing protein 2; alpha+beta sandwi | 94.51 | |
| 2dax_A | 152 | Protein C21ORF6; RWD domain, alpha+beta sandwich f | 94.35 | |
| 3zqs_A | 186 | E3 ubiquitin-protein ligase fancl; HET: P6G; 2.00A | 83.13 |
| >2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 | Back alignment and structure |
|---|
Probab=99.90 E-value=8.6e-24 Score=118.92 Aligned_cols=59 Identities=25% Similarity=0.605 Sum_probs=55.6
Q ss_pred CcccCCCCCeEEeecCCCCCcccEEEEEECCCCCCCCCCEEEEEEEcCCCCCCCCCeEEeC
Q psy17588 2 SLMKEPPPGMEVDSDKAEQNLNLWTIHMKGAEGTLYDGEEFQLQFKFGPKYPFDSPECTKK 62 (62)
Q Consensus 2 ~l~~~~~~~i~~~~~~~~~~l~~w~~~i~gp~~t~y~gg~f~~~i~~~~~yP~~pP~v~F~ 62 (62)
++++++++||++.+. ++|+++|+++|.||++|+|+||.|+++|.||++||++||+|+|.
T Consensus 17 ~l~~~~~~~~~~~~~--~~~l~~w~~~i~GP~~tpYegg~f~~~i~fp~~YP~~PP~v~f~ 75 (125)
T 2fo3_A 17 NFLNNPPINCTLDVH--PNNIRIWIVKYVGLENTIYANEVYKLKIIFPDDYPLKPPIVYFL 75 (125)
T ss_dssp HHHHSCCTTEEEEEC--TTCTTEEEEEEECCTTSTTTTCEEEEEEECCTTTTTSCCEEEEC
T ss_pred HHHhCCCCCEEEEeC--cchhhhhheEEeCCCCCCcCCCEEEEEEEcCCCCCCCCCEEEEe
Confidence 466788999999987 88999999999999999999999999999999999999999994
|
| >2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A | Back alignment and structure |
|---|
| >4gpr_A Ubiquitin-conjugating enzyme family protein; ubiquitin conjugation, EHU ehring1, thiol esterification, ligase; 1.60A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A | Back alignment and structure |
|---|
| >2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A | Back alignment and structure |
|---|
| >1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A | Back alignment and structure |
|---|
| >1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... | Back alignment and structure |
|---|
| >2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 3fsh_A 2cyx_A 2kly_A | Back alignment and structure |
|---|
| >2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F | Back alignment and structure |
|---|
| >2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} | Back alignment and structure |
|---|
| >2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A | Back alignment and structure |
|---|
| >3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B | Back alignment and structure |
|---|
| >2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C | Back alignment and structure |
|---|
| >3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A | Back alignment and structure |
|---|
| >1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A | Back alignment and structure |
|---|
| >2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A | Back alignment and structure |
|---|
| >2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B | Back alignment and structure |
|---|
| >2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A | Back alignment and structure |
|---|
| >2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A | Back alignment and structure |
|---|
| >3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A | Back alignment and structure |
|---|
| >2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C | Back alignment and structure |
|---|
| >1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A | Back alignment and structure |
|---|
| >3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A | Back alignment and structure |
|---|
| >1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 | Back alignment and structure |
|---|
| >2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* | Back alignment and structure |
|---|
| >4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A | Back alignment and structure |
|---|
| >1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A | Back alignment and structure |
|---|
| >2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A | Back alignment and structure |
|---|
| >3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C | Back alignment and structure |
|---|
| >2z6o_A UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, polymorphism, UBL conjugation pathway, ligase; 1.60A {Homo sapiens} PDB: 2z6p_A 1ywz_A 2in1_A 2k07_A 3e2g_A 3evx_A | Back alignment and structure |
|---|
| >3kpa_A Probable ubiquitin fold modifier conjugating ENZY; UBL conjugation pathway, ligase, structural genomics, PSI; 2.20A {Leishmania major} SCOP: d.20.1.4 | Back alignment and structure |
|---|
| >3r3q_A Suppressor protein STP22 of temperature-sensitive factor receptor and arginine permease...; endosomal sorting, ESCRT-I; 1.45A {Saccharomyces cerevisiae} SCOP: d.20.1.2 PDB: 3r42_A 1uzx_A* | Back alignment and structure |
|---|
| >3obq_A Tumor susceptibility gene 101 protein; protein transprot, ubiquitin binding, protein transport; 1.40A {Homo sapiens} SCOP: d.20.1.2 PDB: 3obs_A 3obu_A 3obx_A 3p9g_A* 3p9h_A* 2f0r_A 1kpp_A 1kpq_A 1m4p_A 1m4q_A 1s1q_A | Back alignment and structure |
|---|
| >2ebm_A RWD domain-containing protein 1; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yz0_A Serine/threonine-protein kinase GCN2; A-B-B-B-B-A-A, amino acid starvation signal response, EIF2alpha kinase, transferase; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ebk_A RWD domain-containing protein 3; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2day_A Ring finger protein 25; ligase, metal-binding, UB1 conjugation, UB1 conjugation pathway, RWD domain, alpha+beta sandwich fold, structural genomics; NMR {Homo sapiens} SCOP: d.20.1.3 PDB: 2dmf_A | Back alignment and structure |
|---|
| >1ukx_A GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple beta-turns, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.20.1.3 | Back alignment and structure |
|---|
| >2daw_A RWD domain containing protein 2; alpha+beta sandwich fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.20.1.3 | Back alignment and structure |
|---|
| >2dax_A Protein C21ORF6; RWD domain, alpha+beta sandwich fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.20.1.3 | Back alignment and structure |
|---|
| >3zqs_A E3 ubiquitin-protein ligase fancl; HET: P6G; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 62 | ||||
| d2a7la1 | 117 | d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 | 1e-08 | |
| d2uyza1 | 156 | d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, U | 1e-07 | |
| d2fo3a1 | 109 | d.20.1.1 (A:9-117) Putative ubiquitin-conjugating | 3e-07 | |
| d2z5da1 | 152 | d.20.1.1 (A:23-174) Ubiquitin conjugating enzyme, | 8e-07 | |
| d1yf9a1 | 158 | d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, | 6e-06 | |
| d1pzva_ | 161 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {N | 1e-05 | |
| d2awfa1 | 125 | d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, U | 1e-05 | |
| d2e2ca_ | 156 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {C | 2e-05 | |
| d1yrva1 | 148 | d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, U | 2e-05 | |
| d1fzya_ | 149 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B | 2e-05 | |
| d2a4da1 | 139 | d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, | 3e-05 | |
| d1z2ua1 | 147 | d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, U | 6e-05 | |
| d1zdna1 | 151 | d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, U | 9e-05 | |
| d1yh2a1 | 154 | d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, U | 2e-04 | |
| d1y8xa1 | 157 | d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, | 3e-04 | |
| d1j7db_ | 149 | d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {H | 4e-04 | |
| d2bepa1 | 154 | d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2 | 4e-04 | |
| d1jata_ | 152 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B | 7e-04 | |
| d1jatb_ | 136 | d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {B | 7e-04 | |
| d2ucza_ | 164 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B | 8e-04 | |
| d2f4za1 | 161 | d.20.1.1 (A:32-192) Hypothetical protein Tgtwinsca | 0.001 |
| >d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: UBC-like superfamily: UBC-like family: UBC-related domain: Ubiquitin-protein ligase W (E2 W) species: Human (Homo sapiens) [TaxId: 9606]
Score = 45.4 bits (107), Expect = 1e-08
Identities = 28/60 (46%), Positives = 42/60 (70%)
Query: 1 MSLMKEPPPGMEVDSDKAEQNLNLWTIHMKGAEGTLYDGEEFQLQFKFGPKYPFDSPECT 60
++L +PPPGM ++ + ++ W + M+GA GTLY+GE+FQL FKF +YPFDSP+
Sbjct: 13 LALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVM 72
|
| >d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Length = 109 | Back information, alignment and structure |
|---|
| >d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Length = 158 | Back information, alignment and structure |
|---|
| >d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Length = 161 | Back information, alignment and structure |
|---|
| >d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Length = 156 | Back information, alignment and structure |
|---|
| >d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Length = 148 | Back information, alignment and structure |
|---|
| >d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Length = 149 | Back information, alignment and structure |
|---|
| >d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
| >d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Length = 147 | Back information, alignment and structure |
|---|
| >d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Length = 151 | Back information, alignment and structure |
|---|
| >d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Length = 154 | Back information, alignment and structure |
|---|
| >d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Length = 157 | Back information, alignment and structure |
|---|
| >d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Length = 149 | Back information, alignment and structure |
|---|
| >d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Length = 154 | Back information, alignment and structure |
|---|
| >d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Length = 152 | Back information, alignment and structure |
|---|
| >d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Length = 136 | Back information, alignment and structure |
|---|
| >d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Length = 164 | Back information, alignment and structure |
|---|
| >d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Length = 161 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 62 | |||
| d2fo3a1 | 109 | Putative ubiquitin-conjugating enzyme, E2 domain { | 99.9 | |
| d2awfa1 | 125 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.89 | |
| d2a7la1 | 117 | Ubiquitin-protein ligase W (E2 W) {Human (Homo sap | 99.89 | |
| d1yh2a1 | 154 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.89 | |
| d1j7db_ | 149 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.89 | |
| d2e2ca_ | 156 | Ubiquitin conjugating enzyme, UBC {Clam (Spisula s | 99.88 | |
| d2f4wa1 | 157 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.88 | |
| d2ucza_ | 164 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 99.88 | |
| d1yrva1 | 148 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.88 | |
| d1pzva_ | 161 | Ubiquitin conjugating enzyme, UBC {Nematode (Caeno | 99.87 | |
| d1jata_ | 152 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 99.87 | |
| d1zdna1 | 151 | Ubiquitin conjugating enzyme, UBC {Human(Homo sapi | 99.87 | |
| d1z2ua1 | 147 | Ubiquitin conjugating enzyme, UBC {Caenorhabditis | 99.87 | |
| d1c4zd_ | 144 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.87 | |
| d1y6la_ | 148 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.87 | |
| d1fzya_ | 149 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 99.87 | |
| d1z3da1 | 149 | Ubiquitin conjugating enzyme, UBC {Nematode (Caeno | 99.87 | |
| d1ayza_ | 153 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 99.87 | |
| d1i7ka_ | 146 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.87 | |
| d2uyza1 | 156 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.86 | |
| d2f4za1 | 161 | Hypothetical protein Tgtwinscan_2721, E2 domain {T | 99.85 | |
| d2a4da1 | 139 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.85 | |
| d1wzva1 | 150 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.82 | |
| d2bepa1 | 154 | Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain | 99.82 | |
| d1jatb_ | 136 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 99.8 | |
| d1yf9a1 | 158 | Ubiquitin conjugating enzyme, UBC {Leishmania majo | 99.76 | |
| d2z5da1 | 152 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.75 | |
| d1y8xa1 | 157 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.75 | |
| d1zuoa1 | 162 | Ubiquitin-conjugating enzyme E2 Q2, C-terminal dom | 99.59 | |
| d1s1qa_ | 141 | Tumor susceptibility gene 101 (TSG101) {Human (Hom | 99.16 | |
| d1uzxa_ | 152 | Vacuolar protein sorting-associated {Baker's yeast | 98.38 | |
| d2daya1 | 115 | E3 ubiquitin-protein ligase RNF25 {Human (Homo sap | 94.9 | |
| d2daxa1 | 140 | Uncharacterized protein C21orf6 {Human (Homo sapie | 93.77 | |
| d1ukxa_ | 137 | EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mu | 93.55 | |
| d2dawa1 | 141 | RWD domain-containing protein 2 {Human (Homo sapie | 93.47 | |
| d2in1a1 | 162 | Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapie | 90.07 |
| >d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: UBC-like superfamily: UBC-like family: UBC-related domain: Putative ubiquitin-conjugating enzyme, E2 domain species: Plasmodium chabaudi [TaxId: 5825]
Probab=99.90 E-value=2.9e-24 Score=117.29 Aligned_cols=59 Identities=25% Similarity=0.605 Sum_probs=56.3
Q ss_pred CcccCCCCCeEEeecCCCCCcccEEEEEECCCCCCCCCCEEEEEEEcCCCCCCCCCeEEeC
Q psy17588 2 SLMKEPPPGMEVDSDKAEQNLNLWTIHMKGAEGTLYDGEEFQLQFKFGPKYPFDSPECTKK 62 (62)
Q Consensus 2 ~l~~~~~~~i~~~~~~~~~~l~~w~~~i~gp~~t~y~gg~f~~~i~~~~~yP~~pP~v~F~ 62 (62)
+|+++++.||++.+. ++|+++|+++|.||++|+|+||.|+++|.||++||++||+|+|.
T Consensus 9 ~l~~~~~~g~~~~~~--~~~~~~w~~~i~gp~~tpy~gg~f~~~i~fp~~YP~~pP~v~F~ 67 (109)
T d2fo3a1 9 NFLNNPPINCTLDVH--PNNIRIWIVKYVGLENTIYANEVYKLKIIFPDDYPLKPPIVYFL 67 (109)
T ss_dssp HHHHSCCTTEEEEEC--TTCTTEEEEEEECCTTSTTTTCEEEEEEECCTTTTTSCCEEEEC
T ss_pred HHHhCCCCCEEEEEc--CCcccEEEEEEecCchhhhcCCCceEEEEeccccCCCCCeEEEE
Confidence 577899999999997 89999999999999999999999999999999999999999994
|
| >d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} | Back information, alignment and structure |
|---|
| >d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2daya1 d.20.1.3 (A:8-122) E3 ubiquitin-protein ligase RNF25 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2daxa1 d.20.1.3 (A:8-147) Uncharacterized protein C21orf6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ukxa_ d.20.1.3 (A:) EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dawa1 d.20.1.3 (A:8-148) RWD domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2in1a1 d.20.1.4 (A:3-164) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|