Psyllid ID: psy17588

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--
MSLMKEPPPGMEVDSDKAEQNLNLWTIHMKGAEGTLYDGEEFQLQFKFGPKYPFDSPECTKK
ccccccccccEEEcccccccccccEEEEEEccccccccccEEEEEEEccccccccccEEEEc
cccccccccccEEcccccccccEEEEEEEEcccccEEcccEEEEEEEEcccccccccccccc
mslmkepppgmevdsdkaEQNLNLWTIHmkgaegtlydgeefqlqfkfgpkypfdspectkk
mslmkepppgmevdsdKAEQNLNLWTIHMKGAEGTLYDGEEFQLQFkfgpkypfdspectkk
MSLMKEPPPGMEVDSDKAEQNLNLWTIHMKGAEGTLYDGEEFQLQFKFGPKYPFDSPECTKK
*********************LNLWTIHMKGAEGTLYDGEEFQLQFKFGPKY**********
*****EPPPGMEVDSDKAEQNLNLWTIHMKGAEGTLYDGEEFQLQFKFGPKYPFDSPECTKK
*************DSDKAEQNLNLWTIHMKGAEGTLYDGEEFQLQFKFGPKYPF********
**L*KEPPPGMEVDSDKAEQNLNLWTIHMKGAEGTLYDGEEFQLQFKFGPKYPFDSP*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLMKEPPPGMEVDSDKAEQNLNLWTIHMKGAEGTLYDGEEFQLQFKFGPKYPFDSPECTKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query62 2.2.26 [Sep-21-2011]
Q28FC1151 Ubiquitin-conjugating enz yes N/A 0.935 0.384 0.5 8e-13
B5DEI4151 Ubiquitin-conjugating enz no N/A 0.935 0.384 0.482 2e-12
Q96B02151 Ubiquitin-conjugating enz yes N/A 0.935 0.384 0.482 2e-12
A6H795151 Ubiquitin-conjugating enz yes N/A 0.935 0.384 0.482 2e-12
Q8VDW4151 Ubiquitin-conjugating enz yes N/A 0.935 0.384 0.482 2e-12
Q1JPX4151 Probable ubiquitin-conjug yes N/A 0.935 0.384 0.465 2e-12
Q4VBH4151 Probable ubiquitin-conjug no N/A 0.935 0.384 0.448 6e-11
Q55EY8149 Probable ubiquitin-conjug yes N/A 0.887 0.369 0.448 3e-08
P42743161 Ubiquitin-conjugating enz yes N/A 0.790 0.304 0.442 4e-05
O23239161 Probable ubiquitin-conjug no N/A 0.887 0.341 0.362 0.0002
>sp|Q28FC1|UBE2W_XENTR Ubiquitin-conjugating enzyme E2 W OS=Xenopus tropicalis GN=ube2w PE=2 SV=1 Back     alignment and function desciption
 Score = 72.4 bits (176), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 42/58 (72%)

Query: 1  MSLMKEPPPGMEVDSDKAEQNLNLWTIHMKGAEGTLYDGEEFQLQFKFGPKYPFDSPE 58
          ++L  EPPPGM ++    + ++  W + M+GA GTLY+GE+FQL FKF  +YPFDSP+
Sbjct: 13 LALQNEPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQ 70
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes monoubiquitination. Involved in degradation of misfolded chaperone substrate and DNA repair.
Xenopus tropicalis (taxid: 8364)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: 1EC: 9
>sp|B5DEI4|UBE2W_RAT Ubiquitin-conjugating enzyme E2 W OS=Rattus norvegicus GN=Ube2w PE=2 SV=1 Back     alignment and function description
>sp|Q96B02|UBE2W_HUMAN Ubiquitin-conjugating enzyme E2 W OS=Homo sapiens GN=UBE2W PE=1 SV=1 Back     alignment and function description
>sp|A6H795|UBE2W_BOVIN Ubiquitin-conjugating enzyme E2 W OS=Bos taurus GN=UBE2W PE=2 SV=1 Back     alignment and function description
>sp|Q8VDW4|UBE2W_MOUSE Ubiquitin-conjugating enzyme E2 W OS=Mus musculus GN=Ube2w PE=1 SV=1 Back     alignment and function description
>sp|Q1JPX4|UB2WB_DANRE Probable ubiquitin-conjugating enzyme E2 W-B OS=Danio rerio GN=ube2wb PE=2 SV=1 Back     alignment and function description
>sp|Q4VBH4|UB2WA_DANRE Probable ubiquitin-conjugating enzyme E2 W-A OS=Danio rerio GN=ube2wa PE=2 SV=2 Back     alignment and function description
>sp|Q55EY8|UBE2W_DICDI Probable ubiquitin-conjugating enzyme E2 W OS=Dictyostelium discoideum GN=ube2w PE=3 SV=1 Back     alignment and function description
>sp|P42743|UBC15_ARATH Ubiquitin-conjugating enzyme 15 OS=Arabidopsis thaliana GN=UBC15 PE=2 SV=2 Back     alignment and function description
>sp|O23239|UBC17_ARATH Probable ubiquitin-conjugating enzyme E2 17 OS=Arabidopsis thaliana GN=UBC17 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query62
239790211118 ACYPI002371 [Acyrthosiphon pisum] 0.967 0.508 0.783 2e-21
193609423154 PREDICTED: probable ubiquitin-conjugatin 0.967 0.389 0.783 4e-21
332026457 534 Putative ubiquitin-conjugating enzyme E2 0.967 0.112 0.683 8e-19
332373780 168 unknown [Dendroctonus ponderosae] 0.967 0.357 0.733 1e-18
35761905379 hypothetical protein KGM_19970 [Danaus p 0.951 0.746 0.728 2e-18
91079008154 PREDICTED: similar to AGAP005324-PB [Tri 0.967 0.389 0.766 2e-18
307195251 181 Probable ubiquitin-conjugating enzyme E2 0.967 0.331 0.7 2e-18
383853361 192 PREDICTED: ubiquitin-conjugating enzyme 0.967 0.312 0.7 3e-18
322798725 187 hypothetical protein SINV_13044 [Solenop 0.967 0.320 0.7 5e-18
328791001 164 PREDICTED: probable ubiquitin-conjugatin 0.951 0.359 0.661 2e-17
>gi|239790211|dbj|BAH71680.1| ACYPI002371 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 55/60 (91%)

Query: 1  MSLMKEPPPGMEVDSDKAEQNLNLWTIHMKGAEGTLYDGEEFQLQFKFGPKYPFDSPECT 60
          +SL+KEPPPGM VD D+AEQNLN+WTI+M+GAEGTLYDGE+FQLQFKFG  YPF+SPE T
Sbjct: 16 ISLVKEPPPGMVVDVDQAEQNLNVWTINMQGAEGTLYDGEQFQLQFKFGTSYPFESPEVT 75

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|193609423|ref|XP_001950447.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 W-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|332026457|gb|EGI66585.1| Putative ubiquitin-conjugating enzyme E2 W [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|332373780|gb|AEE62031.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|357619053|gb|EHJ71786.1| hypothetical protein KGM_19970 [Danaus plexippus] Back     alignment and taxonomy information
>gi|91079008|ref|XP_974790.1| PREDICTED: similar to AGAP005324-PB [Tribolium castaneum] gi|270003673|gb|EFA00121.1| hypothetical protein TcasGA2_TC002937 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307195251|gb|EFN77213.1| Probable ubiquitin-conjugating enzyme E2 W [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383853361|ref|XP_003702191.1| PREDICTED: ubiquitin-conjugating enzyme E2 W-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|322798725|gb|EFZ20323.1| hypothetical protein SINV_13044 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|328791001|ref|XP_392626.3| PREDICTED: probable ubiquitin-conjugating enzyme E2 W-like [Apis mellifera] gi|380019359|ref|XP_003693577.1| PREDICTED: ubiquitin-conjugating enzyme E2 W-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query62
FB|FBgn0033544190 CG7220 [Drosophila melanogaste 0.967 0.315 0.65 1.4e-18
UNIPROTKB|Q28FC1151 ube2w "Ubiquitin-conjugating e 0.935 0.384 0.5 6.2e-14
UNIPROTKB|F1NEJ6151 UBE2W "Uncharacterized protein 0.935 0.384 0.482 1.3e-13
UNIPROTKB|F1NEJ7154 UBE2W "Uncharacterized protein 0.935 0.376 0.482 1.3e-13
UNIPROTKB|A6H795151 UBE2W "Ubiquitin-conjugating e 0.935 0.384 0.482 1.3e-13
UNIPROTKB|E2QV56151 UBE2W "Uncharacterized protein 0.935 0.384 0.482 1.3e-13
UNIPROTKB|F1Q244151 UBE2W "Uncharacterized protein 0.935 0.384 0.482 1.3e-13
UNIPROTKB|F6X9L9180 UBE2W "Uncharacterized protein 0.935 0.322 0.482 1.3e-13
UNIPROTKB|C9JJH0159 UBE2W "Ubiquitin-conjugating e 0.935 0.364 0.482 1.3e-13
UNIPROTKB|H0YB73155 UBE2W "Ubiquitin-conjugating e 0.935 0.374 0.482 1.3e-13
FB|FBgn0033544 CG7220 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 224 (83.9 bits), Expect = 1.4e-18, P = 1.4e-18
 Identities = 39/60 (65%), Positives = 50/60 (83%)

Query:     1 MSLMKEPPPGMEVDSDKAEQNLNLWTIHMKGAEGTLYDGEEFQLQFKFGPKYPFDSPECT 60
             MSL+KEPPPG+ +D++  +QNL+ W I++KG EGTLY+GE+FQL FKF  KYPFDSPE T
Sbjct:    52 MSLIKEPPPGVTIDTESVQQNLSEWKINIKGFEGTLYEGEDFQLLFKFNNKYPFDSPEVT 111
GO:0006508 "proteolysis" evidence=ISS
GO:0004842 "ubiquitin-protein ligase activity" evidence=ISS
UNIPROTKB|Q28FC1 ube2w "Ubiquitin-conjugating enzyme E2 W" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|F1NEJ6 UBE2W "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NEJ7 UBE2W "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A6H795 UBE2W "Ubiquitin-conjugating enzyme E2 W" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QV56 UBE2W "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q244 UBE2W "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6X9L9 UBE2W "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|C9JJH0 UBE2W "Ubiquitin-conjugating enzyme E2 W" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0YB73 UBE2W "Ubiquitin-conjugating enzyme E2 W" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query62
pfam00179139 pfam00179, UQ_con, Ubiquitin-conjugating enzyme 4e-12
cd00195141 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, ca 3e-09
smart00212145 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, 6e-09
PTZ00390152 PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; 4e-05
COG5078153 COG5078, COG5078, Ubiquitin-protein ligase [Posttr 0.003
>gnl|CDD|215772 pfam00179, UQ_con, Ubiquitin-conjugating enzyme Back     alignment and domain information 
 Score = 56.1 bits (136), Expect = 4e-12
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 1  MSLMKEPPPGMEVDSDKAEQNLNLWTIHMKGAEGTLYDGEEFQLQFKFGPKYPFDSPECT 60
            L+K+PPPG+       + NL  W + + G EGT Y+G  F+L  +F   YPF  P+  
Sbjct: 7  KELLKDPPPGISAFPV--DDNLFEWEVTIIGPEGTPYEGGVFKLDIEFPEDYPFKPPKVK 64

Proteins destined for proteasome-mediated degradation may be ubiquitinated. Ubiquitination follows conjugation of ubiquitin to a conserved cysteine residue of UBC homologues. TSG101 is one of several UBC homologues that lacks this active site cysteine. Length = 139
>gnl|CDD|238117 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>gnl|CDD|214562 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>gnl|CDD|240397 PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information
>gnl|CDD|227410 COG5078, COG5078, Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 62
KOG0417|consensus148 99.93
COG5078153 Ubiquitin-protein ligase [Posttranslational modifi 99.91
KOG0419|consensus152 99.89
PLN00172147 ubiquitin conjugating enzyme; Provisional 99.87
PTZ00390152 ubiquitin-conjugating enzyme; Provisional 99.87
KOG0426|consensus165 99.84
KOG0425|consensus171 99.84
PF00179140 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IP 99.82
cd00195141 UBCc Ubiquitin-conjugating enzyme E2, catalytic (U 99.82
KOG0418|consensus 200 99.78
KOG0421|consensus175 99.78
smart00212145 UBCc Ubiquitin-conjugating enzyme E2, catalytic do 99.78
KOG0424|consensus158 99.77
KOG0894|consensus 244 99.77
KOG0428|consensus 314 99.6
KOG0427|consensus161 99.58
KOG0416|consensus 189 99.54
KOG0422|consensus153 99.49
KOG0423|consensus 223 99.4
KOG0420|consensus184 99.39
KOG0896|consensus138 99.13
KOG0429|consensus 258 99.1
KOG0895|consensus 1101 99.08
KOG0895|consensus 1101 99.0
PF05773113 RWD: RWD domain; InterPro: IPR006575 The RWD eukar 96.57
smart00591107 RWD domain in RING finger and WD repeat containing 95.72
PF14461133 Prok-E2_B: Prokaryotic E2 family B 94.75
PF05743121 UEV: UEV domain; InterPro: IPR008883 The N-termina 93.98
PF14462122 Prok-E2_E: Prokaryotic E2 family E 92.25
KOG4018|consensus 215 90.2
PF08694161 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1 89.81
cd00421146 intradiol_dioxygenase Intradiol dioxygenases catal 87.42
KOG0897|consensus122 85.82
cd03457188 intradiol_dioxygenase_like Intradiol dioxygenase s 85.01
cd03459158 3,4-PCD Protocatechuate 3,4-dioxygenase (3,4-PCD) 83.64
KOG0309|consensus 1081 82.52
TIGR02423193 protocat_alph protocatechuate 3,4-dioxygenase, alp 80.85
>KOG0417|consensus Back     alignment and domain information 
Probab=99.93  E-value=5.3e-26  Score=131.21  Aligned_cols=59  Identities=32%  Similarity=0.710  Sum_probs=56.6

Q ss_pred             CcccCCCCCeEEeecCCCCCcccEEEEEECCCCCCCCCCEEEEEEEcCCCCCCCCCeEEeC
Q psy17588          2 SLMKEPPPGMEVDSDKAEQNLNLWTIHMKGAEGTLYDGEEFQLQFKFGPKYPFDSPECTKK   62 (62)
Q Consensus         2 ~l~~~~~~~i~~~~~~~~~~l~~w~~~i~gp~~t~y~gg~f~~~i~~~~~yP~~pP~v~F~   62 (62)
                      +|++++++||++.+.  ++|+++|+++|.||.+|+||||+|++.|.||++||++||+|+|+
T Consensus        12 ~l~~dp~~~~~~~~~--~dnl~~w~a~I~GP~~SpYEgG~F~l~I~~p~~YP~~PPkV~F~   70 (148)
T KOG0417|consen   12 DLLRDPPPGCSAGPV--GDNLFHWQATILGPPGSPYEGGVFFLEIHFPEDYPFKPPKVRFL   70 (148)
T ss_pred             HHhcCCCCCCccCCC--CCceeeEEEEEECCCCCCcCCCEEEEEEECCCCCCCCCCceEee
Confidence            568899999999987  99999999999999999999999999999999999999999995

>COG5078 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0419|consensus Back     alignment and domain information
>PLN00172 ubiquitin conjugating enzyme; Provisional Back     alignment and domain information
>PTZ00390 ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information
>KOG0426|consensus Back     alignment and domain information
>KOG0425|consensus Back     alignment and domain information
>PF00179 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IPR000608 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] Back     alignment and domain information
>cd00195 UBCc Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>KOG0418|consensus Back     alignment and domain information
>KOG0421|consensus Back     alignment and domain information
>smart00212 UBCc Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>KOG0424|consensus Back     alignment and domain information
>KOG0894|consensus Back     alignment and domain information
>KOG0428|consensus Back     alignment and domain information
>KOG0427|consensus Back     alignment and domain information
>KOG0416|consensus Back     alignment and domain information
>KOG0422|consensus Back     alignment and domain information
>KOG0423|consensus Back     alignment and domain information
>KOG0420|consensus Back     alignment and domain information
>KOG0896|consensus Back     alignment and domain information
>KOG0429|consensus Back     alignment and domain information
>KOG0895|consensus Back     alignment and domain information
>KOG0895|consensus Back     alignment and domain information
>PF05773 RWD: RWD domain; InterPro: IPR006575 The RWD eukaryotic domain is found in RING finger (IPR001841 from INTERPRO) and WD repeat (IPR001680 from INTERPRO) containing proteins and DEXDc-like helicase (IPR001410 from INTERPRO) subfamily related to the ubiquitin-conjugating enzymes domain (IPR000608 from INTERPRO) Back     alignment and domain information
>smart00591 RWD domain in RING finger and WD repeat containing proteins and DEXDc-like helicases subfamily related to the UBCc domain Back     alignment and domain information
>PF14461 Prok-E2_B: Prokaryotic E2 family B Back     alignment and domain information
>PF05743 UEV: UEV domain; InterPro: IPR008883 The N-terminal ubiquitin E2 variant (UEV) domain is ~145 amino acid residues in length and shows significant sequence similarity to E2 ubiquitin ligases but is unable to catalyze ubiquitin transfer as it lacks the active site cysteine that forms the transient thioester bond with the C terminus of ubiquitin (Ub) Back     alignment and domain information
>PF14462 Prok-E2_E: Prokaryotic E2 family E Back     alignment and domain information
>KOG4018|consensus Back     alignment and domain information
>PF08694 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1; InterPro: IPR014806 Ubiquitin-like (UBL) post-translational modifiers are covalently linked to most, if not all, target protein(s) through an enzymatic cascade analogous to ubiquitylation, consisting of E1 (activating), E2 (conjugating), and E3 (ligating) enzymes Back     alignment and domain information
>cd00421 intradiol_dioxygenase Intradiol dioxygenases catalyze the critical ring-cleavage step in the conversion of catecholate derivatives to citric acid cycle intermediates Back     alignment and domain information
>KOG0897|consensus Back     alignment and domain information
>cd03457 intradiol_dioxygenase_like Intradiol dioxygenase supgroup Back     alignment and domain information
>cd03459 3,4-PCD Protocatechuate 3,4-dioxygenase (3,4-PCD) catalyzes the oxidative ring cleavage of 3,4-dihydroxybenzoate to produce beta-carboxy-cis,cis-muconate Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>TIGR02423 protocat_alph protocatechuate 3,4-dioxygenase, alpha subunit Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query62
2a7l_A136 Structure Of The Human Hypothetical Ubiquitin-Conju 1e-13
>pdb|2A7L|A Chain A, Structure Of The Human Hypothetical Ubiquitin-Conjugating Enzyme, Loc55284 Length = 136 Back     alignment and structure 
Iteration: 1

 Score = 71.2 bits (173), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 42/59 (71%)
Query: 1  MSLMKEPPPGMEVDSDKAEQNLNLWTIHMKGAEGTLYDGEEFQLQFKFGPKYPFDSPEC 59
          ++L  +PPPGM ++    + ++  W + M+GA GTLY+GE+FQL FKF  +YPFDSP+ 
Sbjct: 32 LALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQV 90

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query62
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 8e-19
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 2e-15
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 5e-15
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 2e-10
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 3e-10
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 3e-10
3rz3_A 183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 3e-10
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 3e-10
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 4e-10
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 7e-10
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 7e-10
2pwq_A 216 Ubiquitin conjugating enzyme; structural genomics 9e-10
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 1e-09
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 1e-09
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 1e-09
1yh2_A169 HSPC150 protein similar to ubiquitin-conjugating e 1e-09
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 2e-09
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 2e-09
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 2e-09
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 2e-09
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 3e-09
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 3e-09
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 3e-09
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 3e-09
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 3e-09
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 4e-09
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 4e-09
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 5e-09
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 5e-09
1tte_A 215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 6e-09
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 6e-09
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 8e-09
1ayz_A169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 1e-08
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 2e-08
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 2e-08
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 3e-08
3k9o_A 201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 4e-08
3e46_A 253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 6e-08
1yf9_A171 Ubiquitin carrier protein 4; SGPP, structural geno 7e-08
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 9e-08
2f4w_A 187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 1e-07
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 1e-07
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 1e-06
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 1e-06
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 2e-06
3ceg_A 323 Baculoviral IAP repeat-containing protein 6; apopt 4e-06
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 4e-06
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 4e-06
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 1e-05
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 4e-05
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Length = 136 Back     alignment and structure
 Score = 72.7 bits (179), Expect = 8e-19
 Identities = 28/60 (46%), Positives = 42/60 (70%)

Query: 1  MSLMKEPPPGMEVDSDKAEQNLNLWTIHMKGAEGTLYDGEEFQLQFKFGPKYPFDSPECT 60
          ++L  +PPPGM ++    + ++  W + M+GA GTLY+GE+FQL FKF  +YPFDSP+  
Sbjct: 32 LALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVM 91
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Length = 125 Back     alignment and structure
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Length = 136 Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Length = 172 Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Length = 158 Back     alignment and structure
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Length = 160 Back     alignment and structure
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Length = 183 Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Length = 152 Back     alignment and structure
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Length = 170 Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Length = 154 Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Length = 156 Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Length = 216 Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Length = 149 Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Length = 157 Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Length = 155 Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Length = 149 Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Length = 150 Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Length = 194 Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Length = 152 Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 166 Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Length = 179 Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Length = 179 Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Length = 161 Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} PDB: 3fsh_A 2cyx_A 2kly_A Length = 164 Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Length = 165 Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Length = 138 Back     alignment and structure
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 165 Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} Length = 163 Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Length = 215 Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Length = 156 Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Length = 399 Back     alignment and structure
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 193 Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Length = 159 Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Length = 201 Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Length = 253 Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Length = 171 Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Length = 155 Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 187 Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Length = 172 Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Length = 154 Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Length = 167 Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Length = 190 Back     alignment and structure
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Length = 323 Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Length = 180 Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Length = 167 Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Length = 160 Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Length = 186 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query62
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 99.9
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 99.89
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 99.89
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 99.89
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 99.89
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 99.89
4gpr_A151 Ubiquitin-conjugating enzyme family protein; ubiqu 99.89
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 99.88
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 99.88
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 99.88
1yh2_A169 HSPC150 protein similar to ubiquitin-conjugating e 99.88
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 99.88
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 99.88
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 99.88
1ayz_A169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 99.88
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 99.88
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 99.88
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 99.88
2f4w_A 187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 99.88
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 99.88
2pwq_A 216 Ubiquitin conjugating enzyme; structural genomics 99.88
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 99.88
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 99.88
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 99.88
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 99.87
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 99.87
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 99.87
3rz3_A 183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 99.87
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 99.86
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 99.86
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 99.86
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 99.86
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 99.85
3k9o_A 201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 99.85
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 99.84
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 99.84
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 99.84
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 99.83
1tte_A 215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 99.83
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 99.83
3e46_A 253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 99.83
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 99.83
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 99.83
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 99.82
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 99.82
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 99.81
1yf9_A171 Ubiquitin carrier protein 4; SGPP, structural geno 99.78
3ceg_A 323 Baculoviral IAP repeat-containing protein 6; apopt 99.78
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 99.78
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 99.77
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 99.75
2z6o_A172 UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, p 99.51
3kpa_A168 Probable ubiquitin fold modifier conjugating ENZY; 99.05
3r3q_A162 Suppressor protein STP22 of temperature-sensitive 98.53
3obq_A146 Tumor susceptibility gene 101 protein; protein tra 98.05
2ebm_A128 RWD domain-containing protein 1; alpha+beta sandwi 96.42
2yz0_A138 Serine/threonine-protein kinase GCN2; A-B-B-B-B-A- 96.19
2ebk_A128 RWD domain-containing protein 3; alpha+beta sandwi 95.61
2day_A128 Ring finger protein 25; ligase, metal-binding, UB1 95.32
1ukx_A137 GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple 95.15
2daw_A154 RWD domain containing protein 2; alpha+beta sandwi 94.51
2dax_A152 Protein C21ORF6; RWD domain, alpha+beta sandwich f 94.35
3zqs_A 186 E3 ubiquitin-protein ligase fancl; HET: P6G; 2.00A 83.13
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Back     alignment and structure
Probab=99.90  E-value=8.6e-24  Score=118.92  Aligned_cols=59  Identities=25%  Similarity=0.605  Sum_probs=55.6

Q ss_pred             CcccCCCCCeEEeecCCCCCcccEEEEEECCCCCCCCCCEEEEEEEcCCCCCCCCCeEEeC
Q psy17588          2 SLMKEPPPGMEVDSDKAEQNLNLWTIHMKGAEGTLYDGEEFQLQFKFGPKYPFDSPECTKK   62 (62)
Q Consensus         2 ~l~~~~~~~i~~~~~~~~~~l~~w~~~i~gp~~t~y~gg~f~~~i~~~~~yP~~pP~v~F~   62 (62)
                      ++++++++||++.+.  ++|+++|+++|.||++|+|+||.|+++|.||++||++||+|+|.
T Consensus        17 ~l~~~~~~~~~~~~~--~~~l~~w~~~i~GP~~tpYegg~f~~~i~fp~~YP~~PP~v~f~   75 (125)
T 2fo3_A           17 NFLNNPPINCTLDVH--PNNIRIWIVKYVGLENTIYANEVYKLKIIFPDDYPLKPPIVYFL   75 (125)
T ss_dssp             HHHHSCCTTEEEEEC--TTCTTEEEEEEECCTTSTTTTCEEEEEEECCTTTTTSCCEEEEC
T ss_pred             HHHhCCCCCEEEEeC--cchhhhhheEEeCCCCCCcCCCEEEEEEEcCCCCCCCCCEEEEe
Confidence            466788999999987  88999999999999999999999999999999999999999994
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Back     alignment and structure
>4gpr_A Ubiquitin-conjugating enzyme family protein; ubiquitin conjugation, EHU ehring1, thiol esterification, ligase; 1.60A {Entamoeba histolytica} Back     alignment and structure
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Back     alignment and structure
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 3fsh_A 2cyx_A 2kly_A Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} SCOP: d.20.1.1 Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Back     alignment and structure
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Back     alignment and structure
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Back     alignment and structure
>2z6o_A UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, polymorphism, UBL conjugation pathway, ligase; 1.60A {Homo sapiens} PDB: 2z6p_A 1ywz_A 2in1_A 2k07_A 3e2g_A 3evx_A Back     alignment and structure
>3kpa_A Probable ubiquitin fold modifier conjugating ENZY; UBL conjugation pathway, ligase, structural genomics, PSI; 2.20A {Leishmania major} SCOP: d.20.1.4 Back     alignment and structure
>3r3q_A Suppressor protein STP22 of temperature-sensitive factor receptor and arginine permease...; endosomal sorting, ESCRT-I; 1.45A {Saccharomyces cerevisiae} SCOP: d.20.1.2 PDB: 3r42_A 1uzx_A* Back     alignment and structure
>3obq_A Tumor susceptibility gene 101 protein; protein transprot, ubiquitin binding, protein transport; 1.40A {Homo sapiens} SCOP: d.20.1.2 PDB: 3obs_A 3obu_A 3obx_A 3p9g_A* 3p9h_A* 2f0r_A 1kpp_A 1kpq_A 1m4p_A 1m4q_A 1s1q_A Back     alignment and structure
>2ebm_A RWD domain-containing protein 1; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yz0_A Serine/threonine-protein kinase GCN2; A-B-B-B-B-A-A, amino acid starvation signal response, EIF2alpha kinase, transferase; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ebk_A RWD domain-containing protein 3; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2day_A Ring finger protein 25; ligase, metal-binding, UB1 conjugation, UB1 conjugation pathway, RWD domain, alpha+beta sandwich fold, structural genomics; NMR {Homo sapiens} SCOP: d.20.1.3 PDB: 2dmf_A Back     alignment and structure
>1ukx_A GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple beta-turns, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.20.1.3 Back     alignment and structure
>2daw_A RWD domain containing protein 2; alpha+beta sandwich fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.20.1.3 Back     alignment and structure
>2dax_A Protein C21ORF6; RWD domain, alpha+beta sandwich fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.20.1.3 Back     alignment and structure
>3zqs_A E3 ubiquitin-protein ligase fancl; HET: P6G; 2.00A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 62
d2a7la1117 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 1e-08
d2uyza1156 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, U 1e-07
d2fo3a1109 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating 3e-07
d2z5da1152 d.20.1.1 (A:23-174) Ubiquitin conjugating enzyme, 8e-07
d1yf9a1158 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, 6e-06
d1pzva_161 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {N 1e-05
d2awfa1125 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, U 1e-05
d2e2ca_156 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {C 2e-05
d1yrva1148 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, U 2e-05
d1fzya_149 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 2e-05
d2a4da1139 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, 3e-05
d1z2ua1147 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, U 6e-05
d1zdna1151 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, U 9e-05
d1yh2a1154 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, U 2e-04
d1y8xa1157 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, 3e-04
d1j7db_149 d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {H 4e-04
d2bepa1154 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2 4e-04
d1jata_152 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 7e-04
d1jatb_136 d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {B 7e-04
d2ucza_164 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 8e-04
d2f4za1161 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinsca 0.001
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UBC-related
domain: Ubiquitin-protein ligase W (E2 W)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 45.4 bits (107), Expect = 1e-08
 Identities = 28/60 (46%), Positives = 42/60 (70%)

Query: 1  MSLMKEPPPGMEVDSDKAEQNLNLWTIHMKGAEGTLYDGEEFQLQFKFGPKYPFDSPECT 60
          ++L  +PPPGM ++    + ++  W + M+GA GTLY+GE+FQL FKF  +YPFDSP+  
Sbjct: 13 LALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVM 72
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Length = 109 Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Length = 158 Back     information, alignment and structure
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Length = 161 Back     information, alignment and structure
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Length = 156 Back     information, alignment and structure
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Length = 148 Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Length = 149 Back     information, alignment and structure
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Length = 147 Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Length = 154 Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Length = 152 Back     information, alignment and structure
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Length = 136 Back     information, alignment and structure
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Length = 164 Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Length = 161 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query62
d2fo3a1109 Putative ubiquitin-conjugating enzyme, E2 domain { 99.9
d2awfa1125 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.89
d2a7la1117 Ubiquitin-protein ligase W (E2 W) {Human (Homo sap 99.89
d1yh2a1154 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.89
d1j7db_149 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.89
d2e2ca_156 Ubiquitin conjugating enzyme, UBC {Clam (Spisula s 99.88
d2f4wa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.88
d2ucza_164 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.88
d1yrva1148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.88
d1pzva_161 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 99.87
d1jata_152 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.87
d1zdna1151 Ubiquitin conjugating enzyme, UBC {Human(Homo sapi 99.87
d1z2ua1147 Ubiquitin conjugating enzyme, UBC {Caenorhabditis 99.87
d1c4zd_144 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.87
d1y6la_148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.87
d1fzya_149 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.87
d1z3da1149 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 99.87
d1ayza_153 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.87
d1i7ka_146 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.87
d2uyza1156 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.86
d2f4za1161 Hypothetical protein Tgtwinscan_2721, E2 domain {T 99.85
d2a4da1139 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.85
d1wzva1150 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.82
d2bepa1154 Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain 99.82
d1jatb_136 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.8
d1yf9a1158 Ubiquitin conjugating enzyme, UBC {Leishmania majo 99.76
d2z5da1152 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.75
d1y8xa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.75
d1zuoa1162 Ubiquitin-conjugating enzyme E2 Q2, C-terminal dom 99.59
d1s1qa_141 Tumor susceptibility gene 101 (TSG101) {Human (Hom 99.16
d1uzxa_152 Vacuolar protein sorting-associated {Baker's yeast 98.38
d2daya1115 E3 ubiquitin-protein ligase RNF25 {Human (Homo sap 94.9
d2daxa1140 Uncharacterized protein C21orf6 {Human (Homo sapie 93.77
d1ukxa_137 EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mu 93.55
d2dawa1141 RWD domain-containing protein 2 {Human (Homo sapie 93.47
d2in1a1162 Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapie 90.07
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UBC-related
domain: Putative ubiquitin-conjugating enzyme, E2 domain
species: Plasmodium chabaudi [TaxId: 5825]

Probab=99.90  E-value=2.9e-24  Score=117.29  Aligned_cols=59  Identities=25%  Similarity=0.605  Sum_probs=56.3

Q ss_pred             CcccCCCCCeEEeecCCCCCcccEEEEEECCCCCCCCCCEEEEEEEcCCCCCCCCCeEEeC
Q psy17588          2 SLMKEPPPGMEVDSDKAEQNLNLWTIHMKGAEGTLYDGEEFQLQFKFGPKYPFDSPECTKK   62 (62)
Q Consensus         2 ~l~~~~~~~i~~~~~~~~~~l~~w~~~i~gp~~t~y~gg~f~~~i~~~~~yP~~pP~v~F~   62 (62)
                      +|+++++.||++.+.  ++|+++|+++|.||++|+|+||.|+++|.||++||++||+|+|.
T Consensus         9 ~l~~~~~~g~~~~~~--~~~~~~w~~~i~gp~~tpy~gg~f~~~i~fp~~YP~~pP~v~F~   67 (109)
T d2fo3a1           9 NFLNNPPINCTLDVH--PNNIRIWIVKYVGLENTIYANEVYKLKIIFPDDYPLKPPIVYFL   67 (109)
T ss_dssp             HHHHSCCTTEEEEEC--TTCTTEEEEEEECCTTSTTTTCEEEEEEECCTTTTTSCCEEEEC
T ss_pred             HHHhCCCCCEEEEEc--CCcccEEEEEEecCchhhhcCCCceEEEEeccccCCCCCeEEEE
Confidence            577899999999997  89999999999999999999999999999999999999999994
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Back     information, alignment and structure
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Back     information, alignment and structure
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Back     information, alignment and structure
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Back     information, alignment and structure
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Back     information, alignment and structure
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Back     information, alignment and structure
>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Back     information, alignment and structure
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Back     information, alignment and structure
>d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2daya1 d.20.1.3 (A:8-122) E3 ubiquitin-protein ligase RNF25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2daxa1 d.20.1.3 (A:8-147) Uncharacterized protein C21orf6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukxa_ d.20.1.3 (A:) EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dawa1 d.20.1.3 (A:8-148) RWD domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2in1a1 d.20.1.4 (A:3-164) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure