Psyllid ID: psy17634

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MTSIIKMTSLSGTMDESPPCYLLQVDEFKILLDCGWDEMFSMDFVKELKRHVHHIDAVLLSYPDVAHLGALPYMVGKCGLSCPIFATIPVYKMGQMFMYDLFQVRYDTFLKLLLTLELA
cccEEEEEEEEccccccccEEEEEEccEEEEEEEccccccccccHHHHHcccccccEEEEEcccccccccHHHHHHcccccccEEEEHHHHHHHHHHHHHHHHHHHHHHHccccccccc
cccEEEEEEccccccccccEEEEEEccEEEEEEccccccccHHHHccccccccHccEEEEEccccHHHcHHHHHHHHccccccEEEcccHHHHHHHHHHHHHHHHccccccccEEcccc
MTSIIkmtslsgtmdesppcyllqvDEFKILLDCGWDEMFSMDFVKELKRHVHHIDAvllsypdvahlgalpymvgkcglscpifatipvykmgQMFMYDLFQVRYDTFLKLLLTLELA
mtsiikmtslsgtmdesppCYLLQVDEFKILLDCGWDEMFSMDFVKELKRHVHHIDAVLLSYPDVAHLGALPYMVGKCGLSCPIFATIPVYKMGQMFMYDLFQVRYDTFLKLLLTLELA
MTSIIKMTSLSGTMDESPPCYLLQVDEFKILLDCGWDEMFSMDFVKELKRHVHHIDAVLLSYPDVAHLGALPYMVGKCGLSCPIFATIPVYKMGQMFMYDLFQVRYDTFlkllltlelA
******************PCYLLQVDEFKILLDCGWDEMFSMDFVKELKRHVHHIDAVLLSYPDVAHLGALPYMVGKCGLSCPIFATIPVYKMGQMFMYDLFQVRYDTFLKLLLTL***
*TSIIKMTSLSGTMDESPPCYLLQVDEFKILLDCGWDEMFSMDFVKELKRHVHHIDAVLLSYPDVAHLGALPYMVGKCGLSCPIFATIPVYKMGQMFMYDLFQVRYDTFLKLLLTLEL*
MTSIIKMTSLSGTMDESPPCYLLQVDEFKILLDCGWDEMFSMDFVKELKRHVHHIDAVLLSYPDVAHLGALPYMVGKCGLSCPIFATIPVYKMGQMFMYDLFQVRYDTFLKLLLTLELA
*TSIIKMTSLSGTMDESPPCYLLQVDEFKILLDCGWDEMFSMDFVKELKRHVHHIDAVLLSYPDVAHLGALPYMVGKCGLSCPIFATIPVYKMGQMFMYDLFQVRYDTFLKLLLTLE**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSIIKMTSLSGTMDESPPCYLLQVDEFKILLDCGWDEMFSMDFVKELKRHVHHIDAVLLSYPDVAHLGALPYMVGKCGLSCPIFATIPVYKMGQMFMYDLFQVRYDTFLKLLLTLELA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query119 2.2.26 [Sep-21-2011]
Q9V3D6 756 Probable cleavage and pol yes N/A 0.899 0.141 0.700 1e-45
Q9P2I0 782 Cleavage and polyadenylat yes N/A 0.983 0.149 0.700 7e-44
Q10568 782 Cleavage and polyadenylat yes N/A 0.983 0.149 0.700 7e-44
O35218 782 Cleavage and polyadenylat yes N/A 0.983 0.149 0.683 6e-43
Q9W799 783 Cleavage and polyadenylat N/A N/A 0.907 0.137 0.703 5e-42
A8XUS3 842 Probable cleavage and pol N/A N/A 0.899 0.127 0.588 5e-35
O17403 843 Probable cleavage and pol yes N/A 0.899 0.126 0.598 5e-35
Q55BS1 784 Cleavage and polyadenylat yes N/A 0.865 0.131 0.553 8e-29
Q9LKF9 739 Cleavage and polyadenylat yes N/A 0.882 0.142 0.447 2e-23
Q652P4 738 Cleavage and polyadenylat yes N/A 0.882 0.142 0.466 1e-21
>sp|Q9V3D6|CPSF2_DROME Probable cleavage and polyadenylation specificity factor subunit 2 OS=Drosophila melanogaster GN=Cpsf100 PE=1 SV=1 Back     alignment and function desciption
 Score =  181 bits (459), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 75/107 (70%), Positives = 93/107 (86%)

Query: 1   MTSIIKMTSLSGTMDESPPCYLLQVDEFKILLDCGWDEMFSMDFVKELKRHVHHIDAVLL 60
           MTSIIK+ ++SG MDESPPCY+LQ+D+ +ILLDCGWDE F  +F+KELKR VH +DAVLL
Sbjct: 1   MTSIIKLHTISGAMDESPPCYILQIDDVRILLDCGWDEKFDANFIKELKRQVHTLDAVLL 60

Query: 61  SYPDVAHLGALPYMVGKCGLSCPIFATIPVYKMGQMFMYDLFQVRYD 107
           S+PD  HLGALPY+VGK GL+CPI+ATIPV+KMGQMFMYDL+   ++
Sbjct: 61  SHPDAYHLGALPYLVGKLGLNCPIYATIPVFKMGQMFMYDLYMSHFN 107
CPSF plays a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A)polymerase and other factors to bring about cleavage and poly(A) addition.
Drosophila melanogaster (taxid: 7227)
>sp|Q9P2I0|CPSF2_HUMAN Cleavage and polyadenylation specificity factor subunit 2 OS=Homo sapiens GN=CPSF2 PE=1 SV=2 Back     alignment and function description
>sp|Q10568|CPSF2_BOVIN Cleavage and polyadenylation specificity factor subunit 2 OS=Bos taurus GN=CPSF2 PE=1 SV=1 Back     alignment and function description
>sp|O35218|CPSF2_MOUSE Cleavage and polyadenylation specificity factor subunit 2 OS=Mus musculus GN=Cpsf2 PE=1 SV=1 Back     alignment and function description
>sp|Q9W799|CPSF2_XENLA Cleavage and polyadenylation specificity factor subunit 2 OS=Xenopus laevis GN=cpsf2 PE=1 SV=1 Back     alignment and function description
>sp|A8XUS3|CPSF2_CAEBR Probable cleavage and polyadenylation specificity factor subunit 2 OS=Caenorhabditis briggsae GN=cpsf-2 PE=3 SV=2 Back     alignment and function description
>sp|O17403|CPSF2_CAEEL Probable cleavage and polyadenylation specificity factor subunit 2 OS=Caenorhabditis elegans GN=cpsf-2 PE=3 SV=1 Back     alignment and function description
>sp|Q55BS1|CPSF2_DICDI Cleavage and polyadenylation specificity factor subunit 2 OS=Dictyostelium discoideum GN=cpsf2 PE=3 SV=1 Back     alignment and function description
>sp|Q9LKF9|CPSF2_ARATH Cleavage and polyadenylation specificity factor subunit 2 OS=Arabidopsis thaliana GN=CPSF100 PE=1 SV=2 Back     alignment and function description
>sp|Q652P4|CPSF2_ORYSJ Cleavage and polyadenylation specificity factor subunit 2 OS=Oryza sativa subsp. japonica GN=Os09g0569400 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query119
345480428 739 PREDICTED: probable cleavage and polyade 0.983 0.158 0.743 1e-49
350400562 737 PREDICTED: probable cleavage and polyade 0.899 0.145 0.775 2e-49
340713940 737 PREDICTED: probable cleavage and polyade 0.899 0.145 0.775 2e-49
270010824 733 hypothetical protein TcasGA2_TC014506 [T 0.899 0.145 0.785 3e-49
383852782 737 PREDICTED: probable cleavage and polyade 0.899 0.145 0.775 3e-49
380025109 737 PREDICTED: probable cleavage and polyade 0.899 0.145 0.775 3e-49
332028657 737 Putative cleavage and polyadenylation sp 0.899 0.145 0.775 3e-49
322783252 737 hypothetical protein SINV_80021 [Solenop 0.899 0.145 0.766 5e-49
307203591 685 Probable cleavage and polyadenylation sp 0.899 0.156 0.775 5e-49
328780437 730 PREDICTED: probable cleavage and polyade 0.899 0.146 0.766 5e-49
>gi|345480428|ref|XP_001601407.2| PREDICTED: probable cleavage and polyadenylation specificity factor subunit 2-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 87/117 (74%), Positives = 101/117 (86%)

Query: 1   MTSIIKMTSLSGTMDESPPCYLLQVDEFKILLDCGWDEMFSMDFVKELKRHVHHIDAVLL 60
           MTSIIK+ ++SG +DESPPCY+LQVDE +ILLDCGWDE F  DF+KELKRHVH IDAVLL
Sbjct: 1   MTSIIKLHAISGALDESPPCYILQVDELRILLDCGWDEKFDPDFIKELKRHVHQIDAVLL 60

Query: 61  SYPDVAHLGALPYMVGKCGLSCPIFATIPVYKMGQMFMYDLFQVRYDTFLKLLLTLE 117
           SYPD  HLGALPY+VGKCGLSCPI+ATIPVYKMGQMFMYD++Q R++     L TL+
Sbjct: 61  SYPDPLHLGALPYLVGKCGLSCPIYATIPVYKMGQMFMYDIYQSRHNMEDFNLFTLD 117

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350400562|ref|XP_003485880.1| PREDICTED: probable cleavage and polyadenylation specificity factor subunit 2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340713940|ref|XP_003395491.1| PREDICTED: probable cleavage and polyadenylation specificity factor subunit 2-like isoform 1 [Bombus terrestris] gi|340713942|ref|XP_003395492.1| PREDICTED: probable cleavage and polyadenylation specificity factor subunit 2-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|270010824|gb|EFA07272.1| hypothetical protein TcasGA2_TC014506 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383852782|ref|XP_003701904.1| PREDICTED: probable cleavage and polyadenylation specificity factor subunit 2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380025109|ref|XP_003696322.1| PREDICTED: probable cleavage and polyadenylation specificity factor subunit 2-like [Apis florea] Back     alignment and taxonomy information
>gi|332028657|gb|EGI68691.1| Putative cleavage and polyadenylation specificity factor subunit 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322783252|gb|EFZ10838.1| hypothetical protein SINV_80021 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307203591|gb|EFN82620.1| Probable cleavage and polyadenylation specificity factor subunit 2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328780437|ref|XP_394940.3| PREDICTED: probable cleavage and polyadenylation specificity factor subunit 2 [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query119
UNIPROTKB|F1SD85 385 CPSF2 "Uncharacterized protein 0.907 0.280 0.731 9.6e-41
UNIPROTKB|F1NMN0 782 CPSF2 "Uncharacterized protein 0.907 0.138 0.731 3.4e-40
FB|FBgn0027873 756 Cpsf100 "Cleavage and polyaden 0.899 0.141 0.700 4.9e-40
UNIPROTKB|Q10568 782 CPSF2 "Cleavage and polyadenyl 0.907 0.138 0.731 5.6e-40
UNIPROTKB|E2R496 782 CPSF2 "Uncharacterized protein 0.907 0.138 0.731 5.6e-40
UNIPROTKB|Q9P2I0 782 CPSF2 "Cleavage and polyadenyl 0.907 0.138 0.731 5.6e-40
ZFIN|ZDB-GENE-040718-79 790 cpsf2 "cleavage and polyadenyl 0.907 0.136 0.731 5.9e-40
MGI|MGI:1861601 782 Cpsf2 "cleavage and polyadenyl 0.907 0.138 0.712 4.2e-39
RGD|1309687 782 Cpsf2 "cleavage and polyadenyl 0.907 0.138 0.712 4.2e-39
UNIPROTKB|Q9W799 783 cpsf2 "Cleavage and polyadenyl 0.907 0.137 0.703 1.1e-38
UNIPROTKB|F1SD85 CPSF2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 433 (157.5 bits), Expect = 9.6e-41, P = 9.6e-41
 Identities = 79/108 (73%), Positives = 92/108 (85%)

Query:     1 MTSIIKMTSLSGTMDESPPCYLLQVDEFKILLDCGWDEMFSMDFVKELKRHVHHIDAVLL 60
             MTSIIK+T+LSG  +ES  CYLLQVDEF+ LLDCGWDE FSMD +  L++HVH IDAVLL
Sbjct:     1 MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL 60

Query:    61 SYPDVAHLGALPYMVGKCGLSCPIFATIPVYKMGQMFMYDLFQVRYDT 108
             S+PD  HLGALPY VGK GL+C I+ATIPVYKMGQMFMYDL+Q R++T
Sbjct:    61 SHPDPLHLGALPYAVGKLGLNCAIYATIPVYKMGQMFMYDLYQSRHNT 108
GO:0016787 "hydrolase activity" evidence=IEA
GO:0006379 "mRNA cleavage" evidence=IEA
GO:0006378 "mRNA polyadenylation" evidence=IEA
GO:0005847 "mRNA cleavage and polyadenylation specificity factor complex" evidence=IEA
UNIPROTKB|F1NMN0 CPSF2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0027873 Cpsf100 "Cleavage and polyadenylation specificity factor 100" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q10568 CPSF2 "Cleavage and polyadenylation specificity factor subunit 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R496 CPSF2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9P2I0 CPSF2 "Cleavage and polyadenylation specificity factor subunit 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-79 cpsf2 "cleavage and polyadenylation specific factor 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1861601 Cpsf2 "cleavage and polyadenylation specific factor 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309687 Cpsf2 "cleavage and polyadenylation specific factor 2, 100kDa" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9W799 cpsf2 "Cleavage and polyadenylation specificity factor subunit 2" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O17403CPSF2_CAEELNo assigned EC number0.59810.89910.1269yesN/A
Q10568CPSF2_BOVINNo assigned EC number0.70080.98310.1496yesN/A
Q55BS1CPSF2_DICDINo assigned EC number0.55330.86550.1313yesN/A
Q9P2I0CPSF2_HUMANNo assigned EC number0.70080.98310.1496yesN/A
O35218CPSF2_MOUSENo assigned EC number0.68370.98310.1496yesN/A
Q9V3D6CPSF2_DROMENo assigned EC number0.70090.89910.1415yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query119
COG1782 637 COG1782, COG1782, Predicted metal-dependent RNase, 7e-08
TIGR03675 630 TIGR03675, arCOG00543, arCOG00543 universal archae 1e-06
COG1236 427 COG1236, YSH1, Predicted exonuclease of the beta-l 3e-06
pfam00753148 pfam00753, Lactamase_B, Metallo-beta-lactamase sup 7e-06
COG0595 555 COG0595, COG0595, mRNA degradation ribonucleases J 3e-05
smart00849177 smart00849, Lactamase_B, Metallo-beta-lactamase su 1e-04
PRK11921 394 PRK11921, PRK11921, metallo-beta-lactamase/flavodo 0.004
>gnl|CDD|224696 COG1782, COG1782, Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] Back     alignment and domain information 
 Score = 48.9 bits (117), Expect = 7e-08
 Identities = 25/91 (27%), Positives = 45/91 (49%), Gaps = 9/91 (9%)

Query: 5   IKMTSLSGTMDESPPCYLLQVDEFKILLDCG------WDEMFSMDFVKELKRHVHHIDAV 58
           +++T+L G  +      L+   E ++LLDCG       ++ F    V E +     +DAV
Sbjct: 181 VRVTALGGFREVGRSALLVSTPESRVLLDCGVNVAGNGEDAFPYLDVPEFQP--DELDAV 238

Query: 59  LLSYPDVAHLGALPYMVGKCGLSCPIFATIP 89
           ++++  + H G LP +  K G   P++ T P
Sbjct: 239 IITHAHLDHCGFLPLLF-KYGYDGPVYCTPP 268

Length = 637
>gnl|CDD|188365 TIGR03675, arCOG00543, arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein Back     alignment and domain information
>gnl|CDD|224157 COG1236, YSH1, Predicted exonuclease of the beta-lactamase fold involved in RNA processing [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|216099 pfam00753, Lactamase_B, Metallo-beta-lactamase superfamily Back     alignment and domain information
>gnl|CDD|223668 COG0595, COG0595, mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|214854 smart00849, Lactamase_B, Metallo-beta-lactamase superfamily Back     alignment and domain information
>gnl|CDD|237023 PRK11921, PRK11921, metallo-beta-lactamase/flavodoxin domain-containing protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 119
COG1782 637 Predicted metal-dependent RNase, consists of a met 99.83
TIGR03675 630 arCOG00543 arCOG00543 universal archaeal KH-domain 99.81
KOG1135|consensus 764 99.8
TIGR00649 422 MG423 conserved hypothetical protein. Contains an 99.75
KOG1136|consensus 501 99.69
COG0595 555 mRNA degradation ribonucleases J1/J2 (metallo-beta 99.68
PRK00055 270 ribonuclease Z; Reviewed 99.65
COG1236 427 YSH1 Predicted exonuclease of the beta-lactamase f 99.63
COG1237 259 Metal-dependent hydrolases of the beta-lactamase s 99.6
TIGR02651 299 RNase_Z ribonuclease Z. Processing of the 3-prime 99.55
PF00753194 Lactamase_B: Metallo-beta-lactamase superfamily; I 99.54
PRK05184 302 pyrroloquinoline quinone biosynthesis protein PqqB 99.51
smart00849183 Lactamase_B Metallo-beta-lactamase superfamily. Ap 99.5
KOG1137|consensus 668 99.49
PRK02113 252 putative hydrolase; Provisional 99.48
TIGR02649 303 true_RNase_BN ribonuclease BN. Members of this pro 99.48
PRK11244 250 phnP carbon-phosphorus lyase complex accessory pro 99.47
COG1234 292 ElaC Metal-dependent hydrolases of the beta-lactam 99.44
PRK02126 334 ribonuclease Z; Provisional 99.43
TIGR02108 302 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B. 99.43
PRK00685 228 metal-dependent hydrolase; Provisional 99.42
PLN02469 258 hydroxyacylglutathione hydrolase 99.42
PRK11921 394 metallo-beta-lactamase/flavodoxin domain-containin 99.41
PRK04286 298 hypothetical protein; Provisional 99.4
TIGR03413 248 GSH_gloB hydroxyacylglutathione hydrolase. Members 99.37
PRK05452 479 anaerobic nitric oxide reductase flavorubredoxin; 99.37
PRK10241 251 hydroxyacylglutathione hydrolase; Provisional 99.36
PLN02398 329 hydroxyacylglutathione hydrolase 99.36
TIGR03307 238 PhnP phosphonate metabolism protein PhnP. This fam 99.29
PLN02962 251 hydroxyacylglutathione hydrolase 99.28
COG0426 388 FpaA Uncharacterized flavoproteins [Energy product 99.22
PRK11539 755 ComEC family competence protein; Provisional 99.15
TIGR00361 662 ComEC_Rec2 DNA internalization-related competence 99.13
COG0491 252 GloB Zn-dependent hydrolases, including glyoxylase 99.12
PF12706194 Lactamase_B_2: Beta-lactamase superfamily domain; 99.01
COG1235 269 PhnP Metal-dependent hydrolases of the beta-lactam 98.9
KOG0813|consensus 265 98.86
COG2333 293 ComEC Predicted hydrolase (metallo-beta-lactamase 98.82
PF13483163 Lactamase_B_3: Beta-lactamase superfamily domain; 98.68
COG2220 258 Predicted Zn-dependent hydrolases of the beta-lact 98.65
TIGR02650 277 RNase_Z_T_toga ribonuclease Z, Thermotoga type. Me 98.64
PRK11709 355 putative L-ascorbate 6-phosphate lactonase; Provis 98.64
KOG2121|consensus 746 98.32
COG2015 655 Alkyl sulfatase and related hydrolases [Secondary 98.14
COG2248 304 Predicted hydrolase (metallo-beta-lactamase superf 98.1
PF02112 335 PDEase_II: cAMP phosphodiesterases class-II; Inter 98.1
PF1369163 Lactamase_B_4: tRNase Z endonuclease 97.68
KOG0814|consensus 237 97.47
KOG1138|consensus 653 96.99
PF14597199 Lactamase_B_5: Metallo-beta-lactamase superfamily; 96.98
COG5212 356 PDE1 Low-affinity cAMP phosphodiesterase [Signal t 96.97
KOG3592|consensus 934 96.95
KOG1137|consensus 668 96.87
KOG4736|consensus 302 96.06
KOG1361|consensus 481 92.7
PF14234 285 DUF4336: Domain of unknown function (DUF4336) 89.45
KOG3798|consensus 343 81.31
>COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] Back     alignment and domain information 
Probab=99.83  E-value=1.2e-20  Score=142.49  Aligned_cols=102  Identities=25%  Similarity=0.452  Sum_probs=86.0

Q ss_pred             CcEEEEEecCCCCCCCCEEEEEeCCeEEEEecCCCCCcC-HHHHHHh---hcCCCCccEEEecCCChhhcCChHHHHhhc
Q psy17634          3 SIIKMTSLSGTMDESPPCYLLQVDEFKILLDCGWDEMFS-MDFVKEL---KRHVHHIDAVLLSYPDVAHLGALPYMVGKC   78 (119)
Q Consensus         3 ~~m~i~~lg~~~~~~~~~~li~~~~~~iLiD~G~~~~~~-~~~~~~l---~~~~~~i~~illTH~H~DH~ggl~~l~~~~   78 (119)
                      .+++++.+||+.++|.+|+++++++..+|+|||.+.+.. .....++   ......+|||+|||+|.||+|-+|.|. ++
T Consensus       179 ~wvRvt~LGg~~EVGRSa~lv~T~eSrVLlDcG~n~a~~~~~~~Pyl~vpE~~~~~lDAViiTHAHLDH~G~lP~Lf-kY  257 (637)
T COG1782         179 RWVRVTALGGFREVGRSALLVSTPESRVLLDCGVNVAGNGEDAFPYLDVPEFQPDELDAVIITHAHLDHCGFLPLLF-KY  257 (637)
T ss_pred             ceEEEEeeccchhccceeEEEecCCceEEEeccccCCCCccccCcccccccccccccceEEEeecccccccchhhhh-hc
Confidence            468999999999999999999999999999999876542 1222222   224447999999999999999999999 89


Q ss_pred             CCCCcEEechhhHHHHHHhhHHHHhhh
Q psy17634         79 GLSCPIFATIPVYKMGQMFMYDLFQVR  105 (119)
Q Consensus        79 ~~~~~v~~~~~~~~~~~~~~~~~~~~~  105 (119)
                      +|+.|||++++|.+++-.+..|+....
T Consensus       258 gy~GPVY~T~PTRDlm~LLq~Dyi~va  284 (637)
T COG1782         258 GYDGPVYCTPPTRDLMVLLQLDYIEVA  284 (637)
T ss_pred             CCCCCeeeCCCcHHHHHHHHHHHHHHH
Confidence            999999999999999999888887654

>TIGR03675 arCOG00543 arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein Back     alignment and domain information
>KOG1135|consensus Back     alignment and domain information
>TIGR00649 MG423 conserved hypothetical protein Back     alignment and domain information
>KOG1136|consensus Back     alignment and domain information
>COG0595 mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair] Back     alignment and domain information
>PRK00055 ribonuclease Z; Reviewed Back     alignment and domain information
>COG1236 YSH1 Predicted exonuclease of the beta-lactamase fold involved in RNA processing [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1237 Metal-dependent hydrolases of the beta-lactamase superfamily II [General function prediction only] Back     alignment and domain information
>TIGR02651 RNase_Z ribonuclease Z Back     alignment and domain information
>PF00753 Lactamase_B: Metallo-beta-lactamase superfamily; InterPro: IPR001279 Apart from the beta-lactamases and metallo-beta-lactamases, a number of other proteins contain this domain [] Back     alignment and domain information
>PRK05184 pyrroloquinoline quinone biosynthesis protein PqqB; Provisional Back     alignment and domain information
>smart00849 Lactamase_B Metallo-beta-lactamase superfamily Back     alignment and domain information
>KOG1137|consensus Back     alignment and domain information
>PRK02113 putative hydrolase; Provisional Back     alignment and domain information
>TIGR02649 true_RNase_BN ribonuclease BN Back     alignment and domain information
>PRK11244 phnP carbon-phosphorus lyase complex accessory protein; Provisional Back     alignment and domain information
>COG1234 ElaC Metal-dependent hydrolases of the beta-lactamase superfamily III [General function prediction only] Back     alignment and domain information
>PRK02126 ribonuclease Z; Provisional Back     alignment and domain information
>TIGR02108 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B Back     alignment and domain information
>PRK00685 metal-dependent hydrolase; Provisional Back     alignment and domain information
>PLN02469 hydroxyacylglutathione hydrolase Back     alignment and domain information
>PRK11921 metallo-beta-lactamase/flavodoxin domain-containing protein; Provisional Back     alignment and domain information
>PRK04286 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03413 GSH_gloB hydroxyacylglutathione hydrolase Back     alignment and domain information
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional Back     alignment and domain information
>PRK10241 hydroxyacylglutathione hydrolase; Provisional Back     alignment and domain information
>PLN02398 hydroxyacylglutathione hydrolase Back     alignment and domain information
>TIGR03307 PhnP phosphonate metabolism protein PhnP Back     alignment and domain information
>PLN02962 hydroxyacylglutathione hydrolase Back     alignment and domain information
>COG0426 FpaA Uncharacterized flavoproteins [Energy production and conversion] Back     alignment and domain information
>PRK11539 ComEC family competence protein; Provisional Back     alignment and domain information
>TIGR00361 ComEC_Rec2 DNA internalization-related competence protein ComEC/Rec2 Back     alignment and domain information
>COG0491 GloB Zn-dependent hydrolases, including glyoxylases [General function prediction only] Back     alignment and domain information
>PF12706 Lactamase_B_2: Beta-lactamase superfamily domain; PDB: 3BV6_F 1WW1_A 2E7Y_A 3RPC_D 3ZWF_A 3JXP_A 1XTO_A 2CBN_A 3G1P_B 3P2U_A Back     alignment and domain information
>COG1235 PhnP Metal-dependent hydrolases of the beta-lactamase superfamily I [General function prediction only] Back     alignment and domain information
>KOG0813|consensus Back     alignment and domain information
>COG2333 ComEC Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>PF13483 Lactamase_B_3: Beta-lactamase superfamily domain; PDB: 1VJN_B 3KL7_A Back     alignment and domain information
>COG2220 Predicted Zn-dependent hydrolases of the beta-lactamase fold [General function prediction only] Back     alignment and domain information
>TIGR02650 RNase_Z_T_toga ribonuclease Z, Thermotoga type Back     alignment and domain information
>PRK11709 putative L-ascorbate 6-phosphate lactonase; Provisional Back     alignment and domain information
>KOG2121|consensus Back     alignment and domain information
>COG2015 Alkyl sulfatase and related hydrolases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG2248 Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>PF02112 PDEase_II: cAMP phosphodiesterases class-II; InterPro: IPR000396 Cyclic-AMP phosphodiesterase (3 Back     alignment and domain information
>PF13691 Lactamase_B_4: tRNase Z endonuclease Back     alignment and domain information
>KOG0814|consensus Back     alignment and domain information
>KOG1138|consensus Back     alignment and domain information
>PF14597 Lactamase_B_5: Metallo-beta-lactamase superfamily; PDB: 2P97_B Back     alignment and domain information
>COG5212 PDE1 Low-affinity cAMP phosphodiesterase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3592|consensus Back     alignment and domain information
>KOG1137|consensus Back     alignment and domain information
>KOG4736|consensus Back     alignment and domain information
>KOG1361|consensus Back     alignment and domain information
>PF14234 DUF4336: Domain of unknown function (DUF4336) Back     alignment and domain information
>KOG3798|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query119
2xr1_A 640 Dimeric Archaeal Cleavage And Polyadenylation Speci 3e-06
2ycb_A 636 Structure Of The Archaeal Beta-Casp Protein With N- 3e-05
>pdb|2XR1|A Chain A, Dimeric Archaeal Cleavage And Polyadenylation Specificity Factor With N-Terminal Kh Domains (Kh-Cpsf) From Methanosarcina Mazei Length = 640 Back     alignment and structure 
Iteration: 1

 Score = 46.6 bits (109), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 29/105 (27%), Positives = 53/105 (50%), Gaps = 7/105 (6%)
Query: 5   IKMTSLSGTMDESPPCYLLQVDEFKILLDCGW-----DEMFSMDFVKELKRHVHHIDAVL 59
           +++T+L G  +    C+LL   E +IL+DCG      + M    +V E+   ++ IDAV+
Sbjct: 184 VRVTALGGCKEVGRSCFLLSTPESRILIDCGVNVGSDENMTPYLYVPEV-FPLNQIDAVI 242
Query: 60  LSYPDVAHLGALPYMVGKCGLSCPIFATIPVYKMGQMFMYDLFQV 104
           +++  + H G +P +  K G   P++ T P   +  +   D   V
Sbjct: 243 VTHAHLDHQGLVPLLF-KYGYEGPVYCTPPTRDLMVLLQLDYIDV 286
>pdb|2YCB|A Chain A, Structure Of The Archaeal Beta-Casp Protein With N-Terminal Kh Domains From Methanothermobacter Thermautotrophicus Length = 636 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query119
2i7x_A 717 Protein CFT2; polyadenylation, metallo-B-lactamase 7e-26
2ycb_A 636 Beta-CAsp RNAse, cleavage and polyadenylation spec 1e-11
2xr1_A 640 Cleavage and polyadenylation specificity factor 1 2e-11
2i7t_A 459 Cleavage and polyadenylation specificity factor 73 2e-11
3af5_A 651 Putative uncharacterized protein PH1404; archaeal 6e-11
3iek_A 431 Ribonuclease TTHA0252; metallo beta lactamase fold 4e-10
2p4z_A 284 Metal-dependent hydrolases of the beta-lactamase s 7e-05
3zq4_A 555 Ribonuclease J 1, RNAse J1; hydrolase, RNA maturat 2e-04
3bk2_A 562 RNAse J, metal dependent hydrolase; endoribonuclea 2e-04
1zkp_A 268 Hypothetical protein BA1088; zinc binding protein, 4e-04
1k07_A 263 FEZ-1 beta-lactamase; monomer with alpha-beta/BETA 6e-04
>2i7x_A Protein CFT2; polyadenylation, metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination, double-strand break repair; 2.50A {Saccharomyces cerevisiae} SCOP: d.157.1.10 Length = 717 Back     alignment and structure
 Score = 99.9 bits (248), Expect = 7e-26
 Identities = 23/108 (21%), Positives = 46/108 (42%), Gaps = 9/108 (8%)

Query: 7   MTSLSGTMDE---SPPCYLLQVDEFKILLDCGWDEMFS--MDFVKELKRHVHHIDAVLLS 61
           MT      D+   +    +++ D   +L+D GW+         +K  ++ +  ID ++LS
Sbjct: 1   MTYKYNCCDDGSGTTVGSVVRFDNVTLLIDPGWNPSKVSYEQCIKYWEKVIPEIDVIILS 60

Query: 62  YPDVAHLGALPYMV----GKCGLSCPIFATIPVYKMGQMFMYDLFQVR 105
            P +  LGA   +             ++AT+PV  +G++   D +   
Sbjct: 61  QPTIECLGAHSLLYYNFTSHFISRIQVYATLPVINLGRVSTIDSYASA 108
>2ycb_A Beta-CAsp RNAse, cleavage and polyadenylation specificity factor; hydrolase, KH, metallo-beta-lactamase; 3.10A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 636 Back     alignment and structure
>2xr1_A Cleavage and polyadenylation specificity factor 1 subunit; hydrolase, metallo-beta-lactamase, beta-CAsp, RNA processing; 2.59A {Methanosarcina mazei} Length = 640 Back     alignment and structure
>2i7t_A Cleavage and polyadenylation specificity factor 73 kDa subunit; metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination; 2.10A {Homo sapiens} SCOP: d.157.1.10 PDB: 2i7v_A Length = 459 Back     alignment and structure
>3af5_A Putative uncharacterized protein PH1404; archaeal CPSF, beta-CAsp family, KH domain, ribonuclease, ME beta-lactamase superfamily, archaea; 2.60A {Pyrococcus horikoshii} PDB: 3af6_A* Length = 651 Back     alignment and structure
>3iek_A Ribonuclease TTHA0252; metallo beta lactamase fold, endonuclease, hydrolase, metal- nuclease, RNA-binding, rRNA processing; HET: FLC; 2.05A {Thermus thermophilus} PDB: 2dkf_A* 3iel_A* 3iem_A* 2zdf_A* 3idz_A* 2zdd_A* 3ie0_A* 2zde_A* 3ie1_A* 2zdw_A* 3a4y_A* 2yvd_A* 3ie2_A* Length = 431 Back     alignment and structure
>2p4z_A Metal-dependent hydrolases of the beta-lactamase superfamily II; metal-dependent hydrolases of the beta-lactamase superfamily hydrolase; 2.10A {Thermoanaerobacter tengcongensis} Length = 284 Back     alignment and structure
>3zq4_A Ribonuclease J 1, RNAse J1; hydrolase, RNA maturation; 3.00A {Bacillus subtilis} Length = 555 Back     alignment and structure
>3bk2_A RNAse J, metal dependent hydrolase; endoribonuclease, exoribonuclease, metallo-beta-lactamase; HET: U5P; 2.10A {Thermus thermophilus} PDB: 3bk1_A* 3t3o_A* 3t3n_A* Length = 562 Back     alignment and structure
>1zkp_A Hypothetical protein BA1088; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.50A {Bacillus anthracis str} SCOP: d.157.1.9 Length = 268 Back     alignment and structure
>1k07_A FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alpha fold. two monomers PER AS UNIT., hydrolase; HET: GOL; 1.65A {Fluoribacter gormanii} SCOP: d.157.1.1 PDB: 1jt1_A* 1l9y_A Length = 263 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query119
3iek_A 431 Ribonuclease TTHA0252; metallo beta lactamase fold 99.82
2i7t_A 459 Cleavage and polyadenylation specificity factor 73 99.78
3zq4_A 555 Ribonuclease J 1, RNAse J1; hydrolase, RNA maturat 99.77
2ycb_A 636 Beta-CAsp RNAse, cleavage and polyadenylation spec 99.76
3bk2_A 562 RNAse J, metal dependent hydrolase; endoribonuclea 99.76
2i7x_A 717 Protein CFT2; polyadenylation, metallo-B-lactamase 99.76
3af5_A 651 Putative uncharacterized protein PH1404; archaeal 99.74
2xr1_A 640 Cleavage and polyadenylation specificity factor 1 99.74
2az4_A 429 Hypothetical protein EF2904; structural genomics, 99.72
2cbn_A 306 Ribonuclease Z; phosphodiesterase beta lactamase t 99.67
2zwr_A207 Metallo-beta-lactamase superfamily protein; hydrol 99.67
1zkp_A 268 Hypothetical protein BA1088; zinc binding protein, 99.63
3zwf_A 368 Zinc phosphodiesterase ELAC protein 1; beta-lactam 99.63
1y44_A 320 Ribonuclease Z; zinc-dependent metal hydrolase, hy 99.63
3iog_A 227 Beta-lactamase; hydrolase, antibiotic resistance, 99.61
3dha_A254 N-acyl homoserine lactone hydrolase; zinc bimetall 99.6
3q6v_A 233 Beta-lactamase; metalloenzyme, alpha-beta, hydrola 99.6
3l6n_A219 Metallo-beta-lactamase; zinc, hydolase, antibiotic 99.59
4hl2_A243 Beta-lactamase NDM-1; structural genomics, PSI-bio 99.59
2xf4_A210 Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A 99.59
3md7_A 293 Beta-lactamase-like; ssgcid, hydrolase, structural 99.58
4eyb_A270 Beta-lactamase NDM-1; metallo beta lactamase, anti 99.57
3aj3_A 274 MLR6805 protein, 4-pyridoxolactonase; Zn-protein, 99.57
1k07_A 263 FEZ-1 beta-lactamase; monomer with alpha-beta/BETA 99.57
3m8t_A 294 'BLR6230 protein; subclass B3 beta-lactamase, zinc 99.56
3esh_A 280 Protein similar to metal-dependent hydrolase; stru 99.56
2p4z_A 284 Metal-dependent hydrolases of the beta-lactamase s 99.55
3g1p_A 258 Protein PHNP; C-P lyase, phosphodiesterase, phosph 99.54
1m2x_A223 Class B carbapenemase BLAB-1; alpha-beta/BETA-alph 99.54
1sml_A 269 Protein (penicillinase); metallo-beta-lactamase, a 99.54
4ax1_B 303 Metallo-beta-lactamase AIM-1; hydrolase, antibioti 99.53
1ztc_A221 Hypothetical protein TM0894; structural genomics, 99.52
3jxp_A 321 Coenzyme PQQ synthesis protein B; alpha-beta prote 99.52
4efz_A 298 Metallo-beta-lactamase family protein; structural 99.51
1jjt_A228 IMP-1 metallo beta-lactamase; metallo-beta-lactama 99.51
1mqo_A227 Beta-lactamase II; alpha-beta/BETA-alpha fold, hyd 99.51
1a7t_A232 Metallo-beta-lactamase; hydrolase (beta-lactamase) 99.51
3hnn_A 262 Putative diflavin flavoprotein A 5; PSI-2, protein 99.51
4dik_A 410 Flavoprotein; TM0755, electron transport, DI-iron 99.51
2y8b_A265 Metallo-B-lactamase; hydrolase, cephalosporins, an 99.5
2r2d_A 276 AGR_PTI_140P, Zn-dependent hydrolases; lactonase, 99.5
2vw8_A 303 PA1000, PQSE; quinolone signal response protein, s 99.49
2qed_A 258 Hydroxyacylglutathione hydrolase; metallo-B- super 99.49
3adr_A 261 Putative uncharacterized protein ST1585; quorum se 99.48
2zo4_A 317 Metallo-beta-lactamase family protein; hydrolase; 99.47
1xm8_A 254 Glyoxalase II; structural genomics, protein struct 99.46
3tp9_A 474 Beta-lactamase and rhodanese domain protein; struc 99.45
2fhx_A 246 SPM-1; metallo-beta-lactamase, dinuclear zinc, ant 99.45
2gcu_A 245 Putative hydroxyacylglutathione hydrolase 3; ethyl 99.45
2ohh_A 404 Type A flavoprotein FPRA; beta-lactamase like doma 99.45
1qh5_A 260 Glyoxalase II, protein (hydroxyacylglutathione hyd 99.44
1ycg_A 398 Nitric oxide reductase; DIIRON site, oxidoreductas 99.44
1e5d_A 402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase 99.44
1p9e_A 331 Methyl parathion hydrolase; Zn containing; 2.40A { 99.44
3kl7_A 235 Putative metal-dependent hydrolase; structural gen 99.43
2p18_A 311 Glyoxalase II; metalloprotein, beta sandwich, alph 99.41
2bib_A 547 CBPE, teichoic acid phosphorylcholine esterase/ ch 99.4
4ad9_A 289 Lactb2, beta-lactamase-like protein 2; hydrolase, 99.39
3r2u_A 466 Metallo-beta-lactamase family protein; structural 99.37
2q9u_A 414 A-type flavoprotein; flavodoxin like, beta lactama 99.37
3rpc_A 264 Possible metal-dependent hydrolase; structural gen 99.36
2cfu_A 658 SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1 99.33
2e7y_A 280 TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, 99.32
3h3e_A 267 Uncharacterized protein TM1679; structural genomic 99.28
2wyl_A 360 L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 99.24
3bv6_A 379 Metal-dependent hydrolase; metallo protein, beta-l 99.24
2p97_A201 Hypothetical protein; putative metal-dependent hyd 99.22
2yhe_A 668 SEC-alkyl sulfatase; hydrolase, inversion, metallo 98.81
1vjn_A 220 Zn-dependent hydrolase of metallo-beta-lactamase s 99.0
4b87_A 367 DNA cross-LINK repair 1A protein; dclre1A, DCLRE, 98.86
3zdk_A 336 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A 98.65
>3iek_A Ribonuclease TTHA0252; metallo beta lactamase fold, endonuclease, hydrolase, metal- nuclease, RNA-binding, rRNA processing; HET: FLC; 2.05A {Thermus thermophilus} SCOP: d.157.1.10 PDB: 2dkf_A* 3iel_A* 3iem_A* 2zdf_A* 3idz_A* 2zdd_A* 3ie0_A* 2zde_A* 3ie1_A* 2zdw_A* 3a4y_A* 2yvd_A* 3ie2_A* Back     alignment and structure
Probab=99.82  E-value=4.5e-20  Score=138.90  Aligned_cols=96  Identities=22%  Similarity=0.346  Sum_probs=79.0

Q ss_pred             EEEEEecCCCCCCCCEEEEEeCCeEEEEecCCCCCcCH-HHHHHhhcCCCCccEEEecCCChhhcCChHHHHhhcCCCCc
Q psy17634          5 IKMTSLSGTMDESPPCYLLQVDEFKILLDCGWDEMFSM-DFVKELKRHVHHIDAVLLSYPDVAHLGALPYMVGKCGLSCP   83 (119)
Q Consensus         5 m~i~~lg~~~~~~~~~~li~~~~~~iLiD~G~~~~~~~-~~~~~l~~~~~~i~~illTH~H~DH~ggl~~l~~~~~~~~~   83 (119)
                      |+|+++|+.+++++||++|+.++..+|||||+...... ..+..+..+..+||+||+||+|.||+||++.+.+ .++++|
T Consensus         1 M~i~~LG~~~~vg~s~~li~~~~~~iLID~G~~~~~~~~~~~~~~~~~~~~Id~VllTH~H~DH~gglp~l~~-~~~~~~   79 (431)
T 3iek_A            1 MRIVPFGAAREVTGSAHLLLAGGRRVLLDCGMFQGKEEARNHAPFGFDPKEVDAVLLTHAHLDHVGRLPKLFR-EGYRGP   79 (431)
T ss_dssp             CEEEECSCSSSSSCCCEEEEETTEEEEECCCCCCGGGGGGGGSCCSSCGGGCCEEECSCCCHHHHTTHHHHHH-TTCCSC
T ss_pred             CEEEEeCCCCCCCCcEEEEEECCeEEEEeCCCCcchhhccchhhcCCCcccCCEEEECCCChHHhccHHHHHH-cCCCCe
Confidence            78999999999999999999999999999999554311 1123344456789999999999999999999984 445899


Q ss_pred             EEechhhHHHHHHhhHHH
Q psy17634         84 IFATIPVYKMGQMFMYDL  101 (119)
Q Consensus        84 v~~~~~~~~~~~~~~~~~  101 (119)
                      ||+++++.++++..+.+.
T Consensus        80 Iy~t~~t~~l~~~~l~d~   97 (431)
T 3iek_A           80 VYATRATVLLMEIVLEDA   97 (431)
T ss_dssp             EEECHHHHHHHHHHHHHH
T ss_pred             EEEcHHHHHHHHHHHHHH
Confidence            999999999988777665
>2i7t_A Cleavage and polyadenylation specificity factor 73 kDa subunit; metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination; 2.10A {Homo sapiens} SCOP: d.157.1.10 PDB: 2i7v_A Back     alignment and structure
>3zq4_A Ribonuclease J 1, RNAse J1; hydrolase, RNA maturation; 3.00A {Bacillus subtilis} Back     alignment and structure
>2ycb_A Beta-CAsp RNAse, cleavage and polyadenylation specificity factor; hydrolase, KH, metallo-beta-lactamase; 3.10A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>3bk2_A RNAse J, metal dependent hydrolase; endoribonuclease, exoribonuclease, metallo-beta-lactamase; HET: U5P; 2.10A {Thermus thermophilus} PDB: 3bk1_A* 3t3o_A* 3t3n_A* Back     alignment and structure
>2i7x_A Protein CFT2; polyadenylation, metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination, double-strand break repair; 2.50A {Saccharomyces cerevisiae} SCOP: d.157.1.10 Back     alignment and structure
>3af5_A Putative uncharacterized protein PH1404; archaeal CPSF, beta-CAsp family, KH domain, ribonuclease, ME beta-lactamase superfamily, archaea; 2.60A {Pyrococcus horikoshii} PDB: 3af6_A* Back     alignment and structure
>2xr1_A Cleavage and polyadenylation specificity factor 1 subunit; hydrolase, metallo-beta-lactamase, beta-CAsp, RNA processing; 2.59A {Methanosarcina mazei} Back     alignment and structure
>2az4_A Hypothetical protein EF2904; structural genomics, PSI, protein STR initiative, midwest center for structural genomics, MCSG, U function; 2.00A {Enterococcus faecalis} SCOP: d.157.1.10 Back     alignment and structure
>2cbn_A Ribonuclease Z; phosphodiesterase beta lactamase tRNAse Z, hydrolase, metal- binding, endonuclease, tRNA processing, zinc; 2.9A {Escherichia coli} SCOP: d.157.1.7 Back     alignment and structure
>2zwr_A Metallo-beta-lactamase superfamily protein; hydrolase; 2.20A {Thermus thermophilus} PDB: 2zzi_A Back     alignment and structure
>1zkp_A Hypothetical protein BA1088; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.50A {Bacillus anthracis str} SCOP: d.157.1.9 Back     alignment and structure
>3zwf_A Zinc phosphodiesterase ELAC protein 1; beta-lactamase, hydrolase, metal-binding, tRNA processing, zinc-binding, catabolism; 1.70A {Homo sapiens} Back     alignment and structure
>1y44_A Ribonuclease Z; zinc-dependent metal hydrolase, hydrolase; HET: MES; 2.10A {Bacillus subtilis} SCOP: d.157.1.7 PDB: 2fk6_A* Back     alignment and structure
>3iog_A Beta-lactamase; hydrolase, antibiotic resistance, metal-binding; HET: SDF; 1.41A {Aeromonas hydrophila} SCOP: d.157.1.1 PDB: 1x8i_A 3fai_A* 3iof_A* 1x8h_A 2qds_A* 2gkl_A* 1x8g_A* 3f9o_A 3t9m_A 3sw3_A Back     alignment and structure
>3dha_A N-acyl homoserine lactone hydrolase; zinc bimetallohydrolase, quorum quenching; HET: C6L GOL; 0.95A {Bacillus thuringiensis serovar kurstakorganism_taxid} PDB: 3dhb_A* 3dhc_A* 2a7m_A* 2br6_A 2btn_A Back     alignment and structure
>3q6v_A Beta-lactamase; metalloenzyme, alpha-beta, hydrolase; 1.37A {Serratia fonticola} PDB: 3sd9_A Back     alignment and structure
>3l6n_A Metallo-beta-lactamase; zinc, hydolase, antibiotics resistance, hydrolase; 1.65A {Chryseobacterium indologenes} SCOP: d.157.1.0 Back     alignment and structure
>4hl2_A Beta-lactamase NDM-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ZZ7; 1.05A {Klebsiella pneumoniae} PDB: 4hl1_A* 4h0d_A* 4gyu_A* 4gyq_A 3q6x_A* 3spu_A 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Back     alignment and structure
>2xf4_A Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salmonella enterica} Back     alignment and structure
>3md7_A Beta-lactamase-like; ssgcid, hydrolase, structural genomics, structural genomics center for infectious disease; HET: 5GP TLA; 1.27A {Brucella melitensis biovar abortus} PDB: 3qh8_A* 3py6_A* 3py5_A* Back     alignment and structure
>4eyb_A Beta-lactamase NDM-1; metallo beta lactamase, antibiotic, hydrolase-antibiotic COM; HET: 0WO; 1.16A {Klebsiella pneumoniae} PDB: 4ey2_A* 4eyf_A* 4exy_A 4exs_B 4eyl_A* 3spu_A 3q6x_A* 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Back     alignment and structure
>3aj3_A MLR6805 protein, 4-pyridoxolactonase; Zn-protein, metallo-beta-lactamase, hydrolase; 1.58A {Mesorhizobium loti} PDB: 3aj0_A Back     alignment and structure
>1k07_A FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alpha fold. two monomers PER AS UNIT., hydrolase; HET: GOL; 1.65A {Fluoribacter gormanii} SCOP: d.157.1.1 PDB: 1jt1_A* 1l9y_A Back     alignment and structure
>3m8t_A 'BLR6230 protein; subclass B3 beta-lactamase, zinc enzyme, sulfonamide complex hydrolase-hydrolase inhibitor complex; HET: 4NZ; 1.33A {Bradyrhizobium japonicum} PDB: 3lvz_A* 2gmn_A Back     alignment and structure
>3esh_A Protein similar to metal-dependent hydrolase; structural genomics, PSI-2, protein structure initiative; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>2p4z_A Metal-dependent hydrolases of the beta-lactamase superfamily II; metal-dependent hydrolases of the beta-lactamase superfamily hydrolase; 2.10A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>3g1p_A Protein PHNP; C-P lyase, phosphodiesterase, phosphonate utilization, alkylphosphonate uptake; 1.40A {Escherichia coli} PDB: 3p2u_A Back     alignment and structure
>1m2x_A Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fold., hydrolase; HET: MCO; 1.50A {Elizabethkingia meningoseptica} SCOP: d.157.1.1 Back     alignment and structure
>1sml_A Protein (penicillinase); metallo-beta-lactamase, antibiotic resistance, binuclear zinc, hydrolase; 1.70A {Stenotrophomonas maltophilia} SCOP: d.157.1.1 PDB: 2aio_A* 2fm6_A 2fu6_A 2fu7_A* 2fu8_A* 2fu9_A* 2gfj_A* 2gfk_A* 2h6a_A 2hb9_A* 2qdt_A* 2qjs_A 2qin_A Back     alignment and structure
>4ax1_B Metallo-beta-lactamase AIM-1; hydrolase, antibiotic resistance, acquired B3, drug binding; 1.40A {Pseudomonas aeruginosa} PDB: 4awy_B 4awz_A 4ax0_B Back     alignment and structure
>1ztc_A Hypothetical protein TM0894; structural genomics, joint center for structural genomics, J protein structure initiative, PSI, hydrolase; HET: MSE; 2.10A {Thermotoga maritima} SCOP: d.157.1.11 Back     alignment and structure
>3jxp_A Coenzyme PQQ synthesis protein B; alpha-beta protein, PQQ biosynthesis, transport, biosyntheti; 2.20A {Pseudomonas putida} SCOP: d.157.1.6 PDB: 1xto_A Back     alignment and structure
>4efz_A Metallo-beta-lactamase family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>1jjt_A IMP-1 metallo beta-lactamase; metallo-beta-lactamase inhibitor, succinic acid inhibitor, I metallo-beta-lactamase, hydrolase; HET: BDS; 1.80A {Pseudomonas aeruginosa} SCOP: d.157.1.1 PDB: 1dd6_A* 1vgn_A* 2doo_A* 1wup_A 1wuo_A 1jje_A* 1ddk_A Back     alignment and structure
>1mqo_A Beta-lactamase II; alpha-beta/BETA-alpha fold, hydrolase; HET: CIT; 1.35A {Bacillus cereus} SCOP: d.157.1.1 PDB: 1bc2_A 1bvt_A* 3i0v_A 3i11_A 3i13_A 3i14_A 3i15_A 2uyx_A 2bc2_A 3bc2_A 2bfl_A 2bfk_A 2bfz_B 2bg2_A 2bg7_A 2bg8_A 1dxk_A 3kns_A 3knr_A 2bfz_A ... Back     alignment and structure
>1a7t_A Metallo-beta-lactamase; hydrolase (beta-lactamase), zinc; HET: MES; 1.85A {Bacteroides fragilis} SCOP: d.157.1.1 PDB: 1a8t_A* 2bmi_A 1kr3_A 1znb_A 2znb_A 3znb_A 4znb_A 1hlk_A* Back     alignment and structure
>4dik_A Flavoprotein; TM0755, electron transport, DI-iron protein; 1.75A {Thermotoga maritima} PDB: 4dil_A 1vme_A* Back     alignment and structure
>2y8b_A Metallo-B-lactamase; hydrolase, cephalosporins, antibiotic recognition; 1.70A {Pseudomonas aeruginosa} PDB: 2y8a_A 2y87_A 2yz3_A* 2whg_A* 2wrs_A* 1ko3_A 1ko2_A Back     alignment and structure
>2r2d_A AGR_PTI_140P, Zn-dependent hydrolases; lactonase, N-acyl hompserine lactone, DI-nuclear zinc center quenching, AIIB, phosphate; HET: PO4; 1.75A {Agrobacterium tumefaciens} Back     alignment and structure
>2vw8_A PA1000, PQSE; quinolone signal response protein, signaling protein, SSPF; 1.45A {Pseudomonas aeruginosa PAO1} PDB: 2q0j_A 2q0i_A 3dh8_A* Back     alignment and structure
>2qed_A Hydroxyacylglutathione hydrolase; metallo-B- superfamily, salmonella typhimurium LT2; 1.45A {Salmonella typhimurium} SCOP: d.157.1.2 Back     alignment and structure
>3adr_A Putative uncharacterized protein ST1585; quorum sensing, quinolone signal, metallo-beta-lactamase FOL conserved hypothetical protein; HET: EPE; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
>2zo4_A Metallo-beta-lactamase family protein; hydrolase; 2.10A {Thermus thermophilus} Back     alignment and structure
>1xm8_A Glyoxalase II; structural genomics, protein structure initiative, CESG, AT2G31350, metallo-hydrolase, zinc/iron binuclear center; 1.74A {Arabidopsis thaliana} SCOP: d.157.1.2 PDB: 2q42_A Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2fhx_A SPM-1; metallo-beta-lactamase, dinuclear zinc, antibiotic resistanc hydrolase, metal binding protein; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2gcu_A Putative hydroxyacylglutathione hydrolase 3; ethylmalonic encephalopathy, ETHE1, structural genomics, protein structure initiative; 1.48A {Arabidopsis thaliana} Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidore; HET: FMN; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 2ohi_A* 2ohj_A* Back     alignment and structure
>1qh5_A Glyoxalase II, protein (hydroxyacylglutathione hydrolase); metallo-hydrolase; HET: GSH GBP; 1.45A {Homo sapiens} SCOP: d.157.1.2 PDB: 1qh3_A* Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Back     alignment and structure
>1p9e_A Methyl parathion hydrolase; Zn containing; 2.40A {Pseudomonas SP} SCOP: d.157.1.5 Back     alignment and structure
>3kl7_A Putative metal-dependent hydrolase; structural genomics, JOI for structural genomics, JCSG; 2.30A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>2p18_A Glyoxalase II; metalloprotein, beta sandwich, alpha-helical domain, hydrola; HET: SPD; 1.80A {Leishmania infantum} PDB: 2p1e_A* Back     alignment and structure
>2bib_A CBPE, teichoic acid phosphorylcholine esterase/ choline protein; choline-binding protein, PCE, phosphorylcholine estera hydrolase; HET: PC BTB; 1.92A {Streptococcus pneumoniae} SCOP: b.109.1.1 d.157.1.8 PDB: 1wra_A* Back     alignment and structure
>4ad9_A Lactb2, beta-lactamase-like protein 2; hydrolase, metallo-beta lactamase, mitochondria; 2.60A {Homo sapiens} Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Back     alignment and structure
>3rpc_A Possible metal-dependent hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.49A {Veillonella parvula} Back     alignment and structure
>2cfu_A SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1.9A {Pseudomonas aeruginosa} SCOP: d.106.1.3 d.157.1.13 PDB: 2cfz_A* 2cg2_A 2cg3_A* Back     alignment and structure
>2e7y_A TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.97A {Thermotoga maritima} SCOP: d.157.1.7 PDB: 1ww1_A Back     alignment and structure
>3h3e_A Uncharacterized protein TM1679; structural genomics, surface entropy reduction, ISFI, beta- lactamase superfamily, PSI-2; 2.75A {Thermotoga maritima} Back     alignment and structure
>2wyl_A L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 2.59A {Escherichia coli} PDB: 2wym_A* Back     alignment and structure
>3bv6_A Metal-dependent hydrolase; metallo protein, beta-lactamase like fold, MCSG, structural PSI-2, protein structure initiative; 1.80A {Vibrio cholerae o1 biovar eltor} Back     alignment and structure
>2p97_A Hypothetical protein; putative metal-dependent hydrolase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.157.1.12 Back     alignment and structure
>2yhe_A SEC-alkyl sulfatase; hydrolase, inversion, metallo-beta-lactamase fold; 2.70A {Pseudomonas SP} Back     alignment and structure
>1vjn_A Zn-dependent hydrolase of metallo-beta-lactamase superfamily TM0207; metallo-hydrolase/oxidoreductase fold, structural genomics; 2.00A {Thermotoga maritima} SCOP: d.157.1.4 Back     alignment and structure
>4b87_A DNA cross-LINK repair 1A protein; dclre1A, DCLRE, interstrand crosslink repair, hydrolase, NIT mustard, cancer, chemotherapy, PSO2 homolog,; HET: DNA; 2.16A {Homo sapiens} Back     alignment and structure
>3zdk_A 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 119
d2i7xa1 514 d.157.1.10 (A:1-422,A:626-717) Cleavage factor two 3e-23
d2i7ta1 451 d.157.1.10 (A:9-459) Cleavage and polyadenylation 9e-16
d2dkfa1 431 d.157.1.10 (A:1-431) Putative RNA-degradation prot 1e-15
d1vmea2 250 d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755, 1e-04
d1wraa1 305 d.157.1.8 (A:30-334) Teichoic acid phosphorylcholi 0.001
d2gmna1 264 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Br 0.002
d1k07a_ 262 d.157.1.1 (A:) Zn metallo-beta-lactamase {Fluoriba 0.004
>d2i7xa1 d.157.1.10 (A:1-422,A:626-717) Cleavage factor two protein 2, CFT2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 514 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: beta-CASP RNA-metabolising hydrolases
domain: Cleavage factor two protein 2, CFT2
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 90.7 bits (224), Expect = 3e-23
 Identities = 20/93 (21%), Positives = 41/93 (44%), Gaps = 6/93 (6%)

Query: 19  PCYLLQVDEFKILLDCGWDEMFS--MDFVKELKRHVHHIDAVLLSYPDVAHLGALPYMV- 75
              +++ D   +L+D GW+         +K  ++ +  ID ++LS P +  LGA   +  
Sbjct: 16  VGSVVRFDNVTLLIDPGWNPSKVSYEQCIKYWEKVIPEIDVIILSQPTIECLGAHSLLYY 75

Query: 76  ---GKCGLSCPIFATIPVYKMGQMFMYDLFQVR 105
                      ++AT+PV  +G++   D +   
Sbjct: 76  NFTSHFISRIQVYATLPVINLGRVSTIDSYASA 108
>d2i7ta1 d.157.1.10 (A:9-459) Cleavage and polyadenylation specificity factor subunit 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 451 Back     information, alignment and structure
>d2dkfa1 d.157.1.10 (A:1-431) Putative RNA-degradation protein TTHA0252 {Thermus thermophilus [TaxId: 274]} Length = 431 Back     information, alignment and structure
>d1vmea2 d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 250 Back     information, alignment and structure
>d1wraa1 d.157.1.8 (A:30-334) Teichoic acid phosphorylcholine esterase Pce (LytD), N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 305 Back     information, alignment and structure
>d2gmna1 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Bradyrhizobium japonicum [TaxId: 375]} Length = 264 Back     information, alignment and structure
>d1k07a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Fluoribacter gormanii, (Legionella gormanii) FEZ-1 [TaxId: 464]} Length = 262 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query119
d2i7ta1 451 Cleavage and polyadenylation specificity factor su 99.86
d2dkfa1 431 Putative RNA-degradation protein TTHA0252 {Thermus 99.85
d2i7xa1 514 Cleavage factor two protein 2, CFT2 {Baker's yeast 99.82
d2aioa1 266 Zn metallo-beta-lactamase {Xanthomonas maltophilia 99.64
d1zkpa1 244 Hypothetical protein BA1088 (BAS1016) {Bacillus an 99.62
d2cbna1 305 Ribonuclease Z (RNase Z) {Escherichia coli [TaxId: 99.62
d2gmna1 264 Zn metallo-beta-lactamase {Bradyrhizobium japonicu 99.61
d1y44a1 307 Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId 99.57
d1x8ha_ 228 Zn metallo-beta-lactamase {Aeromonas hydrophila, C 99.55
d1k07a_ 262 Zn metallo-beta-lactamase {Fluoribacter gormanii, 99.53
d1ztca1207 Hypothetical protein TM0894 {Thermotoga maritima [ 99.52
d1p9ea_ 294 Methyl parathion hydrolase {Pseudomonas sp. WBC-3 99.51
d1xtoa_ 304 Coenzyme PQQ synthesis protein B, PqqB {Pseudomona 99.5
d1vmea2 250 ROO-like flavoprotein TM0755, N-terminal domain {T 99.5
d2q0ia1 298 Quinolone signal response protein PqsE {Pseudomona 99.49
d1jjta_220 Zn metallo-beta-lactamase {Pseudomonas aeruginosa, 99.46
d1ko3a_230 Zn metallo-beta-lactamase {Pseudomonas aeruginosa, 99.44
d1m2xa_219 Zn metallo-beta-lactamase {Chryseobacterium mening 99.43
d1mqoa_221 Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 99.41
d1ycga2 249 Nitric oxide reductase N-terminal domain {Moorella 99.4
d1wraa1 305 Teichoic acid phosphorylcholine esterase Pce (LytD 99.4
d2e7ya1 280 Ribonuclease Z (RNase Z) {Thermotoga maritima [Tax 99.38
d1znba_230 Zn metallo-beta-lactamase {Bacteroides fragilis [T 99.37
d1e5da2 249 Rubredoxin oxygen:oxidoreductase (ROO), N-terminal 99.35
d1xm8a_ 254 Glyoxalase II (hydroxyacylglutathione hydrolase) { 99.29
d1qh5a_ 260 Glyoxalase II (hydroxyacylglutathione hydrolase) { 99.27
d2qeda1 251 Glyoxalase II (hydroxyacylglutathione hydrolase) { 99.26
d2cfua2 505 Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI 99.18
d2p97a1200 Hypothetical protein Ava3068 {Anabaena variabilis 99.01
d2az4a1183 Hypothetical protein EF2904 {Enterococcus faecalis 98.96
d1vjna_ 209 Hypothetical protein TM0207 {Thermotoga maritima [ 98.73
>d2i7ta1 d.157.1.10 (A:9-459) Cleavage and polyadenylation specificity factor subunit 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: beta-CASP RNA-metabolising hydrolases
domain: Cleavage and polyadenylation specificity factor subunit 3
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.86  E-value=7.1e-22  Score=145.30  Aligned_cols=98  Identities=22%  Similarity=0.339  Sum_probs=80.3

Q ss_pred             cEEEEEecCCCCCCCCEEEEEeCCeEEEEecCCCCCcCHH-HHHHh-hcCCCCccEEEecCCChhhcCChHHHHhhcCCC
Q psy17634          4 IIKMTSLSGTMDESPPCYLLQVDEFKILLDCGWDEMFSMD-FVKEL-KRHVHHIDAVLLSYPDVAHLGALPYMVGKCGLS   81 (119)
Q Consensus         4 ~m~i~~lg~~~~~~~~~~li~~~~~~iLiD~G~~~~~~~~-~~~~l-~~~~~~i~~illTH~H~DH~ggl~~l~~~~~~~   81 (119)
                      .|.++++||.+++|+||++|+.++..||||||++...... .+..+ .....++|+|||||+|.||+||++++..+.+++
T Consensus         3 ~~~~~plGG~~eIG~n~~lv~~~~~~il~D~G~~~~~~~~~~~p~~~~~~~~~id~i~lTH~H~DH~ggLp~l~~~~~~~   82 (451)
T d2i7ta1           3 QLLIRPLGAGQEVGRSCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLIDPAEIDLLLISHFHLDHCGALPWFLQKTSFK   82 (451)
T ss_dssp             EEEEEEEESSSSSSSCEEEEEETTEEEEECCCCCTTSCGGGGSCCGGGSCGGGCCEEECCCSSHHHHTTHHHHHHHSSCC
T ss_pred             cEEEEEccCCCcccccEEEEEECCeEEEEeCCCCCCccccccCCCccCCCHhhCCEEEECCCcHHHhCchHHHHHhcCCC
Confidence            5899999999999999999999999999999986543221 11111 124567999999999999999999998776678


Q ss_pred             CcEEechhhHHHHHHhhHHH
Q psy17634         82 CPIFATIPVYKMGQMFMYDL  101 (119)
Q Consensus        82 ~~v~~~~~~~~~~~~~~~~~  101 (119)
                      .|||+++.+.++++..+.+.
T Consensus        83 ~pIy~s~~T~~l~~~~~~~~  102 (451)
T d2i7ta1          83 GRTFMTHATKAIYRWLLSDY  102 (451)
T ss_dssp             SEEEEEHHHHHHHHHHHHHH
T ss_pred             CCEEechhHhhhhhhhhhhh
Confidence            99999999999988776654
>d2dkfa1 d.157.1.10 (A:1-431) Putative RNA-degradation protein TTHA0252 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2i7xa1 d.157.1.10 (A:1-422,A:626-717) Cleavage factor two protein 2, CFT2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2aioa1 d.157.1.1 (A:23-311) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]} Back     information, alignment and structure
>d1zkpa1 d.157.1.9 (A:1-244) Hypothetical protein BA1088 (BAS1016) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d2cbna1 d.157.1.7 (A:1-305) Ribonuclease Z (RNase Z) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gmna1 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1y44a1 d.157.1.7 (A:1-307) Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1x8ha_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Aeromonas hydrophila, CphA [TaxId: 644]} Back     information, alignment and structure
>d1k07a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Fluoribacter gormanii, (Legionella gormanii) FEZ-1 [TaxId: 464]} Back     information, alignment and structure
>d1ztca1 d.157.1.11 (A:1-207) Hypothetical protein TM0894 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p9ea_ d.157.1.5 (A:) Methyl parathion hydrolase {Pseudomonas sp. WBC-3 [TaxId: 165468]} Back     information, alignment and structure
>d1xtoa_ d.157.1.6 (A:) Coenzyme PQQ synthesis protein B, PqqB {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vmea2 d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2q0ia1 d.157.1.14 (A:1-298) Quinolone signal response protein PqsE {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jjta_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]} Back     information, alignment and structure
>d1ko3a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, VIM-2 [TaxId: 287]} Back     information, alignment and structure
>d1m2xa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Chryseobacterium meningosepticum, carbapenemase BLAB-1 [TaxId: 238]} Back     information, alignment and structure
>d1mqoa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ycga2 d.157.1.3 (A:2-250) Nitric oxide reductase N-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1wraa1 d.157.1.8 (A:30-334) Teichoic acid phosphorylcholine esterase Pce (LytD), N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2e7ya1 d.157.1.7 (A:1-280) Ribonuclease Z (RNase Z) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1znba_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacteroides fragilis [TaxId: 817]} Back     information, alignment and structure
>d1e5da2 d.157.1.3 (A:2-250) Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1xm8a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qh5a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qeda1 d.157.1.2 (A:1-251) Glyoxalase II (hydroxyacylglutathione hydrolase) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2p97a1 d.157.1.12 (A:1-200) Hypothetical protein Ava3068 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d2az4a1 d.157.1.10 (A:56-238) Hypothetical protein EF2904 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1vjna_ d.157.1.4 (A:) Hypothetical protein TM0207 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure