Psyllid ID: psy1766


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210----
MSIICANQTFPSTLPSTSVIICFYNEHPATLYRSVQTLLSRTGQSLLHEIILVNDFSEYPSNLHGEVETFVKGLNNGRVHLYRTSKREGLIRARMFGAKYATGKVLVFLDSHIEVNTHWLEPLLVPIAERTNTVTVPIIDIINADTFQYTSSALVRGGFNWGLHFKWENLPKVKTSSNPSYLPLQYTSSALVRGGFNWGLHFKWENLPKGTHTW
cccccccccccccccccEEEEEEEcccHHHHHHHHHHHHcccHHHHHcEEEEEEcccccccccHHHHHHHHHccccccEEEEEcccccHHHHHHHHccccccccEEEEEEEEEccccccHHHHHHHHHccccEEEEEEEEEEEccccEEEcccccEEEEEccEEEEEEEccHHHHccccccccccccccccccccccccccccccccccccccc
cccHHccccccccccccEEEEEEccHHHHHHHHHHHHHHHccHHHHHHHEEEEccccccHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHcHHHccccEEEEEccccHcccccHHHHHHHHHHcccEEEEEEEEEEcccccEEccccccEcccccEEEEEEccccHHHHHHcccccccccccccccccEEEEcHHHHHcccccccccc
msiicanqtfpstlpstsVIICFYNEHPATLYRSVQTLLSRTGQSLLHEIILVndfseypsnlhgEVETFVKGLNNGRVHLYRTSKREGLIRARMFGAKYATGKVLVFLDSHievnthwlepllvpiaertntvtvpiidiinadtfqytssalvrggfnwglhfkwenlpkvktssnpsylplqytssalvrggfnwglhfkwenlpkgthtw
msiicanqtfpstlpsTSVIICFYNEHPATLYRSVQTLLSRTGQSLLHEIILVNDFSEYPSNLHGEVETFvkglnngrVHLYRTSKREGLIRARMFGAKYATGKVLVFLDSHIEVNTHWLEPLLVPIAERTNTVTVPIIDIINADTFQYTSSALVRGGFNWGLHFKWENLPKVKTSSNPSYLPLQYTSSALVRGGFNWGlhfkwenlpkgthtw
MSIICANQTFPSTLPSTSVIICFYNEHPATLYRSVQTLLSRTGQSLLHEIILVNDFSEYPSNLHGEVETFVKGLNNGRVHLYRTSKREGLIRARMFGAKYATGKVLVFLDSHIEVNTHWLEPLLVPIAERTNTVTVPIIDIINADTFQYTSSALVRGGFNWGLHFKWENLPKVKTSSNPSYLPLQYTSSALVRGGFNWGLHFKWENLPKGTHTW
***ICANQTFPSTLPSTSVIICFYNEHPATLYRSVQTLLSRTGQSLLHEIILVNDFSEYPSNLHGEVETFVKGLNNGRVHLYRTSKREGLIRARMFGAKYATGKVLVFLDSHIEVNTHWLEPLLVPIAERTNTVTVPIIDIINADTFQYTSSALVRGGFNWGLHFKWENLPKVKTSSNPSYLPLQYTSSALVRGGFNWGLHFKWENL*******
**IICANQTFPSTLPSTSVIICFYNEHPATLYRSVQTLLSRTGQSLLHEIILVNDFSEYPSNLHGEVETFVKGLNNGRVHLYRTSKREGLIRARMFGAKYATGKVLVFLDSHIEVNTHWLEPLLVPIAERTNTVTVPIIDIINADTFQYTSSALVRGGFNWGLHFKWENL****************TSSALVRGGFNWGLHFKWENLPKGTHTW
MSIICANQTFPSTLPSTSVIICFYNEHPATLYRSVQTLLSRTGQSLLHEIILVNDFSEYPSNLHGEVETFVKGLNNGRVHLYRTSKREGLIRARMFGAKYATGKVLVFLDSHIEVNTHWLEPLLVPIAERTNTVTVPIIDIINADTFQYTSSALVRGGFNWGLHFKWENLPKVKTSSNPSYLPLQYTSSALVRGGFNWGLHFKWENLPKGTHTW
*SIICANQTFPSTLPSTSVIICFYNEHPATLYRSVQTLLSRTGQSLLHEIILVNDFSEYPSNLHGEVETFVKGLNNGRVHLYRTSKREGLIRARMFGAKYATGKVLVFLDSHIEVNTHWLEPLLVPIAERTNTVTVPIIDIINADTFQYTSSALVRGGFNWGLHFKWENLPKVKTSSNPSYLPLQYTSSALVRGGFNWGLHFKWENLPKGTHTW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIICANQTFPSTLPSTSVIICFYNEHPATLYRSVQTLLSRTGQSLLHEIILVNDFSEYPSNLHGEVETFVKGLNNGRVHLYRTSKREGLIRARMFGAKYATGKVLVFLDSHIEVNTHWLEPLLVPIAERTNTVTVPIIDIINADTFQYTSSALVRGGFNWGLHFKWENLPKVKTSSNPSYLPLQYTSSALVRGGFNWGLHFKWENLPKGTHTW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query214 2.2.26 [Sep-21-2011]
Q6P6V1 608 Polypeptide N-acetylgalac yes N/A 0.775 0.273 0.544 2e-49
Q921L8 608 Polypeptide N-acetylgalac yes N/A 0.775 0.273 0.538 4e-49
Q8MVS5 632 Polypeptide N-acetylgalac yes N/A 0.775 0.262 0.551 4e-49
Q8NCW6 608 Polypeptide N-acetylgalac yes N/A 0.775 0.273 0.550 2e-47
Q9D4M9 431 Putative polypeptide N-ac no N/A 0.771 0.382 0.479 6e-41
Q7Z4T8 443 Putative polypeptide N-ac no N/A 0.766 0.370 0.465 3e-39
Q95JX4 443 Putative polypeptide N-ac N/A N/A 0.757 0.365 0.458 1e-38
Q9JJ61 558 Putative polypeptide N-ac no N/A 0.747 0.286 0.488 3e-38
O61394 618 Probable N-acetylgalactos yes N/A 0.775 0.268 0.476 7e-38
Q8N428 558 Putative polypeptide N-ac no N/A 0.747 0.286 0.482 8e-38
>sp|Q6P6V1|GLT11_RAT Polypeptide N-acetylgalactosaminyltransferase 11 OS=Rattus norvegicus GN=Galnt11 PE=2 SV=1 Back     alignment and function desciption
 Score =  195 bits (495), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 123/167 (73%), Gaps = 1/167 (0%)

Query: 5   CANQTFPSTLPSTSVIICFYNEHPATLYRSVQTLLSRTGQSLLHEIILVNDFSEYPSNLH 64
           C  +++P+ LP+ SV+ICFYNE  + L R+V +++ RT   LLHEIILV+D S++  +L 
Sbjct: 141 CRGKSYPTDLPTASVVICFYNEAFSALLRTVHSVVDRTPAHLLHEIILVDDSSDF-DDLK 199

Query: 65  GEVETFVKGLNNGRVHLYRTSKREGLIRARMFGAKYATGKVLVFLDSHIEVNTHWLEPLL 124
           GE++ +++     +V + R  KREGLIR RM GA +ATG+VLVFLDSH EVN  WL+PLL
Sbjct: 200 GELDEYIQRYLPAKVKVIRNMKREGLIRGRMIGAAHATGEVLVFLDSHCEVNVMWLQPLL 259

Query: 125 VPIAERTNTVTVPIIDIINADTFQYTSSALVRGGFNWGLHFKWENLP 171
             I E  +TV  P+IDII+ADT  Y+SS +VRGGFNWGLHFKW+ +P
Sbjct: 260 AIILEDPHTVVCPVIDIISADTLAYSSSPVVRGGFNWGLHFKWDLVP 306




Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Displays the same enzyme activity toward Muc1, Muc4.1, and EA2 than GALNT1. Does not appear to be involved in glycosylation of erythropoietin.
Rattus norvegicus (taxid: 10116)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 4EC: 1
>sp|Q921L8|GLT11_MOUSE Polypeptide N-acetylgalactosaminyltransferase 11 OS=Mus musculus GN=Galnt11 PE=2 SV=1 Back     alignment and function description
>sp|Q8MVS5|GLT35_DROME Polypeptide N-acetylgalactosaminyltransferase 35A OS=Drosophila melanogaster GN=Pgant35A PE=1 SV=2 Back     alignment and function description
>sp|Q8NCW6|GLT11_HUMAN Polypeptide N-acetylgalactosaminyltransferase 11 OS=Homo sapiens GN=GALNT11 PE=2 SV=2 Back     alignment and function description
>sp|Q9D4M9|GLTL5_MOUSE Putative polypeptide N-acetylgalactosaminyltransferase-like protein 5 OS=Mus musculus GN=Galntl5 PE=2 SV=2 Back     alignment and function description
>sp|Q7Z4T8|GLTL5_HUMAN Putative polypeptide N-acetylgalactosaminyltransferase-like protein 5 OS=Homo sapiens GN=GALNTL5 PE=2 SV=3 Back     alignment and function description
>sp|Q95JX4|GLTL5_MACFA Putative polypeptide N-acetylgalactosaminyltransferase-like protein 5 OS=Macaca fascicularis GN=GALNTL5 PE=2 SV=2 Back     alignment and function description
>sp|Q9JJ61|GLTL1_MOUSE Putative polypeptide N-acetylgalactosaminyltransferase-like protein 1 OS=Mus musculus GN=Galntl1 PE=2 SV=2 Back     alignment and function description
>sp|O61394|GALT6_CAEEL Probable N-acetylgalactosaminyltransferase 6 OS=Caenorhabditis elegans GN=gly-6 PE=2 SV=1 Back     alignment and function description
>sp|Q8N428|GLTL1_HUMAN Putative polypeptide N-acetylgalactosaminyltransferase-like protein 1 OS=Homo sapiens GN=GALNTL1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query214
322799307 338 hypothetical protein SINV_03796 [Solenop 0.780 0.494 0.636 2e-58
156544564 637 PREDICTED: polypeptide N-acetylgalactosa 0.780 0.262 0.642 1e-57
340727930 643 PREDICTED: polypeptide N-acetylgalactosa 0.780 0.259 0.619 2e-56
332021082 580 Polypeptide N-acetylgalactosaminyltransf 0.780 0.287 0.613 3e-56
350400046 643 PREDICTED: polypeptide N-acetylgalactosa 0.780 0.259 0.601 7e-56
383862333 637 PREDICTED: polypeptide N-acetylgalactosa 0.780 0.262 0.601 1e-55
307186272 667 Polypeptide N-acetylgalactosaminyltransf 0.780 0.250 0.619 4e-55
307198758 606 Polypeptide N-acetylgalactosaminyltransf 0.775 0.273 0.597 4e-54
242020636 623 UDP-GalNAc:polypeptide N-acetylgalactosa 0.831 0.285 0.575 3e-53
321469963 498 hypothetical protein DAPPUDRAFT_224457 [ 0.836 0.359 0.569 4e-53
>gi|322799307|gb|EFZ20695.1| hypothetical protein SINV_03796 [Solenopsis invicta] Back     alignment and taxonomy information
 Score =  231 bits (588), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 107/168 (63%), Positives = 133/168 (79%), Gaps = 1/168 (0%)

Query: 4   ICANQTFPSTLPSTSVIICFYNEHPATLYRSVQTLLSRTGQSLLHEIILVNDFSEYPSNL 63
           +C  Q +P+ LP+ S+IICFYNEH  TL RS+ T+L RT  +LLHEIILVND+S+  S L
Sbjct: 157 LCGAQKYPANLPNASIIICFYNEHYTTLLRSLHTVLERTPMALLHEIILVNDYSD-SSAL 215

Query: 64  HGEVETFVKGLNNGRVHLYRTSKREGLIRARMFGAKYATGKVLVFLDSHIEVNTHWLEPL 123
           H +++ +++   + RV L++T KREGLIRAR+FGA+ ATGKVL+FLDSHIEVN  W+EPL
Sbjct: 216 HEKIKVYIRNNFDDRVRLFKTEKREGLIRARVFGARKATGKVLIFLDSHIEVNEMWIEPL 275

Query: 124 LVPIAERTNTVTVPIIDIINADTFQYTSSALVRGGFNWGLHFKWENLP 171
           L  IA   N V +P+IDIINADTFQYT S LVRGGFNWGLHFKW+NLP
Sbjct: 276 LSRIAYSRNIVPMPVIDIINADTFQYTGSPLVRGGFNWGLHFKWDNLP 323




Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|156544564|ref|XP_001602677.1| PREDICTED: polypeptide N-acetylgalactosaminyltransferase 35A-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340727930|ref|XP_003402286.1| PREDICTED: polypeptide N-acetylgalactosaminyltransferase 35A-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|332021082|gb|EGI61469.1| Polypeptide N-acetylgalactosaminyltransferase 35A [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|350400046|ref|XP_003485719.1| PREDICTED: polypeptide N-acetylgalactosaminyltransferase 35A-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383862333|ref|XP_003706638.1| PREDICTED: polypeptide N-acetylgalactosaminyltransferase 35A-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307186272|gb|EFN71935.1| Polypeptide N-acetylgalactosaminyltransferase 35A [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307198758|gb|EFN79561.1| Polypeptide N-acetylgalactosaminyltransferase 35A [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242020636|ref|XP_002430758.1| UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase, putative [Pediculus humanus corporis] gi|212515955|gb|EEB18020.1| UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|321469963|gb|EFX80941.1| hypothetical protein DAPPUDRAFT_224457 [Daphnia pulex] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query214
UNIPROTKB|F1P800 608 GALNT11 "Uncharacterized prote 0.915 0.322 0.505 6e-48
UNIPROTKB|E1BDW8 606 GALNT11 "Uncharacterized prote 0.775 0.273 0.544 3e-46
UNIPROTKB|B7Z5G5 527 GALNT11 "cDNA FLJ58212, highly 0.775 0.314 0.550 3e-46
UNIPROTKB|Q8NCW6 608 GALNT11 "Polypeptide N-acetylg 0.775 0.273 0.550 3e-46
FB|FBgn0001970 632 Pgant35A "Polypeptide N-acetyl 0.775 0.262 0.551 1e-45
UNIPROTKB|E1BYU3 608 GALNT11 "Uncharacterized prote 0.775 0.273 0.580 1e-45
MGI|MGI:2444392 608 Galnt11 "UDP-N-acetyl-alpha-D- 0.887 0.312 0.494 1e-45
RGD|735097 608 Galnt11 "UDP-N-acetyl-alpha-D- 0.775 0.273 0.544 1e-45
UNIPROTKB|F1SSN4 608 GALNT11 "Uncharacterized prote 0.775 0.273 0.538 2.1e-45
ZFIN|ZDB-GENE-060929-998 590 galnt11 "UDP-N-acetyl-alpha-D- 0.803 0.291 0.526 5.6e-45
UNIPROTKB|F1P800 GALNT11 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 501 (181.4 bits), Expect = 6.0e-48, P = 6.0e-48
 Identities = 100/198 (50%), Positives = 132/198 (66%)

Query:     5 CANQTFPSTLPSTSVIICFYNEHPATLYRSVQTLLSRTGQSLLHEIILVNDFSEYPSNLH 64
             C +++FP+ LP+ SV+ICFYNE  + L R+V ++L RT   LLHEIILV+D S++  +L 
Sbjct:   141 CRDKSFPADLPAASVVICFYNEALSALLRTVHSVLDRTPAQLLHEIILVDDDSDF-DDLK 199

Query:    65 GEVETFVKGLNNGRVHLYRTSKREGLIRARMFGAKYATGKVLVFLDSHIEVNTHWLEPLL 124
             GE+E +V+    G++ + R  KREGLIR RM GA +ATG+VLVFLDSH EVN  WL+PLL
Sbjct:   200 GELEEYVQKYLPGKIKVIRNIKREGLIRGRMIGAAHATGEVLVFLDSHCEVNVMWLQPLL 259

Query:   125 VPIAERTNTVTVPIIDIINADTFQYTSSALVRGGFNWGLHFKWENLPKVKTSSNPSYLPL 184
               I E   TV  P+IDII+ADT  Y+SS +VRGGFNWGLHFKW+ +P +     P     
Sbjct:   260 AAIQEDQQTVVCPVIDIISADTLAYSSSPVVRGGFNWGLHFKWDLVP-LSELGGPEGATA 318

Query:   185 QYTSSALVRGGFNWGLHF 202
                S  +  G F    H+
Sbjct:   319 PIKSPTMAGGLFAMNRHY 336




GO:0006486 "protein glycosylation" evidence=IEA
GO:0016757 "transferase activity, transferring glycosyl groups" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0005794 "Golgi apparatus" evidence=IEA
UNIPROTKB|E1BDW8 GALNT11 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|B7Z5G5 GALNT11 "cDNA FLJ58212, highly similar to PolypeptideN-acetylgalactosaminyltransferase 11 (EC 2.4.1.41)" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NCW6 GALNT11 "Polypeptide N-acetylgalactosaminyltransferase 11" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0001970 Pgant35A "Polypeptide N-acetylgalactosaminyltransferase 35A" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E1BYU3 GALNT11 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:2444392 Galnt11 "UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 11" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|735097 Galnt11 "UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 11 (GalNAc-T11)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1SSN4 GALNT11 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060929-998 galnt11 "UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 11 (GalNAc-T11)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8NCW6GLT11_HUMAN2, ., 4, ., 1, ., 4, 10.55080.77570.2730yesN/A
Q8MVS5GLT35_DROME2, ., 4, ., 1, ., 4, 10.55170.77570.2626yesN/A
Q6P6V1GLT11_RAT2, ., 4, ., 1, ., 4, 10.54490.77570.2730yesN/A
Q921L8GLT11_MOUSE2, ., 4, ., 1, ., 4, 10.53890.77570.2730yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.4.1.80LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
cd02510 299 cd02510, pp-GalNAc-T, pp-GalNAc-T initiates the fo 3e-71
pfam00535168 pfam00535, Glycos_transf_2, Glycosyl transferase f 6e-25
cd00761156 cd00761, Glyco_tranf_GTA_type, Glycosyltransferase 3e-12
COG0463 291 COG0463, WcaA, Glycosyltransferases involved in ce 3e-10
TIGR03965 467 TIGR03965, mycofact_glyco, mycofactocin system gly 3e-10
COG1215 439 COG1215, COG1215, Glycosyltransferases, probably i 1e-09
COG1216 305 COG1216, COG1216, Predicted glycosyltransferases [ 7e-06
cd04179185 cd04179, DPM_DPG-synthase_like, DPM_DPG-synthase_l 4e-05
cd06434235 cd06434, GT2_HAS, Hyaluronan synthases catalyze po 2e-04
cd04192229 cd04192, GT_2_like_e, Subfamily of Glycosyltransfe 2e-04
cd04186166 cd04186, GT_2_like_c, Subfamily of Glycosyltransfe 5e-04
cd04188211 cd04188, DPG_synthase, DPG_synthase is involved in 8e-04
cd04187181 cd04187, DPM1_like_bac, Bacterial DPM1_like enzyme 0.003
>gnl|CDD|133004 cd02510, pp-GalNAc-T, pp-GalNAc-T initiates the formation of mucin-type O-linked glycans Back     alignment and domain information
 Score =  218 bits (558), Expect = 3e-71
 Identities = 93/179 (51%), Positives = 117/179 (65%), Gaps = 6/179 (3%)

Query: 18  SVIICFYNEHPATLYRSVQTLLSRTGQSLLHEIILVNDFSEYPSNLHGEVETFVKGLNNG 77
           SVII F+NE  +TL R+V ++++RT   LL EIILV+DFS+ P  L   +E + K     
Sbjct: 1   SVIIIFHNEALSTLLRTVHSVINRTPPELLKEIILVDDFSDKP-ELKLLLEEYYKKYL-P 58

Query: 78  RVHLYRTSKREGLIRARMFGAKYATGKVLVFLDSHIEVNTHWLEPLLVPIAERTNTVTVP 137
           +V + R  KREGLIRAR+ GA+ ATG VLVFLDSH EVN  WLEPLL  IAE   TV  P
Sbjct: 59  KVKVLRLKKREGLIRARIAGARAATGDVLVFLDSHCEVNVGWLEPLLARIAENRKTVVCP 118

Query: 138 IIDIINADTFQY-TSSALVRGGFNWGLHFKWENLPKVKTSSNPSYLPLQYTSSALVRGG 195
           IID+I+ADTF+Y  SS   RGGF+W LHFKW  LP+ +        P++   S  + GG
Sbjct: 119 IIDVIDADTFEYRGSSGDARGGFDWSLHFKWLPLPEEERRRESPTAPIR---SPTMAGG 174


UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferases (pp-GalNAc-T) initiate the formation of mucin-type, O-linked glycans by catalyzing the transfer of alpha-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to hydroxyl groups of Ser or Thr residues of core proteins to form the Tn antigen (GalNAc-a-1-O-Ser/Thr). These enzymes are type II membrane proteins with a GT-A type catalytic domain and a lectin domain located on the lumen side of the Golgi apparatus. In human, there are 15 isozymes of pp-GalNAc-Ts, representing the largest of all glycosyltransferase families. Each isozyme has unique but partially redundant substrate specificity for glycosylation sites on acceptor proteins. Length = 299

>gnl|CDD|215980 pfam00535, Glycos_transf_2, Glycosyl transferase family 2 Back     alignment and domain information
>gnl|CDD|132997 cd00761, Glyco_tranf_GTA_type, Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold Back     alignment and domain information
>gnl|CDD|223539 COG0463, WcaA, Glycosyltransferases involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|234419 TIGR03965, mycofact_glyco, mycofactocin system glycosyltransferase Back     alignment and domain information
>gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224137 COG1216, COG1216, Predicted glycosyltransferases [General function prediction only] Back     alignment and domain information
>gnl|CDD|133022 cd04179, DPM_DPG-synthase_like, DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily Back     alignment and domain information
>gnl|CDD|133056 cd06434, GT2_HAS, Hyaluronan synthases catalyze polymerization of hyaluronan Back     alignment and domain information
>gnl|CDD|133035 cd04192, GT_2_like_e, Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>gnl|CDD|133029 cd04186, GT_2_like_c, Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>gnl|CDD|133031 cd04188, DPG_synthase, DPG_synthase is involved in protein N-linked glycosylation Back     alignment and domain information
>gnl|CDD|133030 cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 214
KOG3738|consensus 559 99.97
cd02510299 pp-GalNAc-T pp-GalNAc-T initiates the formation of 99.97
KOG3736|consensus 578 99.96
KOG3737|consensus 603 99.95
PRK10073 328 putative glycosyl transferase; Provisional 99.93
PRK10018279 putative glycosyl transferase; Provisional 99.92
cd04184202 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like prot 99.91
TIGR03469 384 HonB hopene-associated glycosyltransferase HpnB. T 99.91
PF00535169 Glycos_transf_2: Glycosyl transferase family 2; In 99.91
cd02520196 Glucosylceramide_synthase Glucosylceramide synthas 99.9
cd06427241 CESA_like_2 CESA_like_2 is a member of the cellulo 99.9
PLN02726243 dolichyl-phosphate beta-D-mannosyltransferase 99.9
TIGR03111 439 glyc2_xrt_Gpos1 putative glycosyltransferase TIGR0 99.9
cd04195201 GT2_AmsE_like GT2_AmsE_like is involved in exopoly 99.9
cd06437232 CESA_CaSu_A2 Cellulose synthase catalytic subunit 99.89
cd06439251 CESA_like_1 CESA_like_1 is a member of the cellulo 99.89
cd04196214 GT_2_like_d Subfamily of Glycosyltransferase Famil 99.89
cd06913219 beta3GnTL1_like Beta 1, 3-N-acetylglucosaminyltran 99.89
PRK10063248 putative glycosyl transferase; Provisional 99.88
PRK11204 420 N-glycosyltransferase; Provisional 99.88
cd06421234 CESA_CelA_like CESA_CelA_like are involved in the 99.88
cd06433202 GT_2_WfgS_like WfgS and WfeV are involved in O-ant 99.88
PRK14583 444 hmsR N-glycosyltransferase; Provisional 99.88
TIGR03472 373 HpnI hopanoid biosynthesis associated glycosyl tra 99.88
cd06442224 DPM1_like DPM1_like represents putative enzymes si 99.87
cd02525249 Succinoglycan_BP_ExoA ExoA is involved in the bios 99.87
cd04187181 DPM1_like_bac Bacterial DPM1_like enzymes are rela 99.87
PRK10714 325 undecaprenyl phosphate 4-deoxy-4-formamido-L-arabi 99.87
cd06423180 CESA_like CESA_like is the cellulose synthase supe 99.87
cd04179185 DPM_DPG-synthase_like DPM_DPG-synthase_like is a m 99.86
cd04185202 GT_2_like_b Subfamily of Glycosyltransferase Famil 99.86
PTZ00260333 dolichyl-phosphate beta-glucosyltransferase; Provi 99.86
cd04192229 GT_2_like_e Subfamily of Glycosyltransferase Famil 99.86
cd04188211 DPG_synthase DPG_synthase is involved in protein N 99.86
KOG2978|consensus238 99.85
cd02522221 GT_2_like_a GT_2_like_a represents a glycosyltrans 99.85
cd06435236 CESA_NdvC_like NdvC_like proteins in this family a 99.85
COG1216 305 Predicted glycosyltransferases [General function p 99.84
PF13641228 Glyco_tranf_2_3: Glycosyltransferase like family 2 99.84
cd06420182 GT2_Chondriotin_Pol_N N-terminal domain of Chondro 99.84
cd06434235 GT2_HAS Hyaluronan synthases catalyze polymerizati 99.83
cd06438183 EpsO_like EpsO protein participates in the methano 99.83
PRK13915306 putative glucosyl-3-phosphoglycerate synthase; Pro 99.83
cd04186166 GT_2_like_c Subfamily of Glycosyltransferase Famil 99.83
cd02511229 Beta4Glucosyltransferase UDP-glucose LOS-beta-1,4 99.82
cd06436191 GlcNAc-1-P_transferase N-acetyl-glucosamine transf 99.82
cd02526237 GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl tr 99.82
COG0463291 WcaA Glycosyltransferases involved in cell wall bi 99.8
PRK11498 852 bcsA cellulose synthase catalytic subunit; Provisi 99.8
TIGR03030 713 CelA cellulose synthase catalytic subunit (UDP-for 99.8
PF10111281 Glyco_tranf_2_2: Glycosyltransferase like family 2 99.79
COG1215 439 Glycosyltransferases, probably involved in cell wa 99.78
TIGR01556281 rhamnosyltran L-rhamnosyltransferase. Rhamnolipids 99.77
cd04190244 Chitin_synth_C C-terminal domain of Chitin Synthas 99.67
cd04191254 Glucan_BSP_ModH Glucan_BSP_ModH catalyzes the elon 99.66
PRK14716 504 bacteriophage N4 adsorption protein B; Provisional 99.66
cd00761156 Glyco_tranf_GTA_type Glycosyltransferase family A 99.6
KOG2977|consensus323 99.58
PRK11234 727 nfrB bacteriophage N4 adsorption protein B; Provis 99.58
PRK05454 691 glucosyltransferase MdoH; Provisional 99.52
PRK15489 703 nfrB bacteriophage N4 adsorption protein B; Provis 99.43
cd02514 334 GT13_GLCNAC-TI GT13_GLCNAC-TI is involved in an es 99.32
KOG2547|consensus 431 98.94
PF13712217 Glyco_tranf_2_5: Glycosyltransferase like family; 98.79
PF1370497 Glyco_tranf_2_4: Glycosyl transferase family 2 98.32
PF03452269 Anp1: Anp1; InterPro: IPR005109 The members of thi 98.22
PF03071 434 GNT-I: GNT-I family; InterPro: IPR004139 The biosy 98.06
COG4092 346 Predicted glycosyltransferase involved in capsule 97.92
KOG3588|consensus494 97.9
PF03142 527 Chitin_synth_2: Chitin synthase; InterPro: IPR0048 97.8
PF13506175 Glyco_transf_21: Glycosyl transferase family 21 97.71
PF09488 381 Osmo_MPGsynth: Mannosyl-3-phosphoglycerate synthas 97.56
PF06306347 CgtA: Beta-1,4-N-acetylgalactosaminyltransferase ( 97.4
COG2943 736 MdoH Membrane glycosyltransferase [Cell envelope b 97.38
PRK14503 393 mannosyl-3-phosphoglycerate synthase; Provisional 97.35
TIGR02460 381 osmo_MPGsynth mannosyl-3-phosphoglycerate synthase 97.35
PF05679499 CHGN: Chondroitin N-acetylgalactosaminyltransferas 97.34
PF11316234 Rhamno_transf: Putative rhamnosyl transferase ; In 97.3
cd00218223 GlcAT-I Beta1,3-glucuronyltransferase I (GlcAT-I) 97.1
PLN02458346 transferase, transferring glycosyl groups 96.86
PF13733136 Glyco_transf_7N: N-terminal region of glycosyl tra 96.83
PF09258247 Glyco_transf_64: Glycosyl transferase family 64 do 96.8
PRK14502 694 bifunctional mannosyl-3-phosphoglycerate synthase/ 96.71
PF03214 348 RGP: Reversibly glycosylated polypeptide; InterPro 96.61
cd04182186 GT_2_like_f GT_2_like_f is a subfamily of the glyc 96.55
KOG1476|consensus330 96.47
PLN02893 734 Cellulose synthase-like protein 96.38
PRK00317193 mobA molybdopterin-guanine dinucleotide biosynthes 96.38
PF12804160 NTP_transf_3: MobA-like NTP transferase domain; PD 96.25
TIGR03310188 matur_ygfJ molybdenum hydroxylase accessory protei 96.2
cd00899219 b4GalT Beta-4-Galactosyltransferase is involved in 96.15
PF04666297 Glyco_transf_54: N-Acetylglucosaminyltransferase-I 96.13
KOG1413|consensus 411 96.06
PF13632193 Glyco_trans_2_3: Glycosyl transferase family group 96.04
TIGR03202190 pucB xanthine dehydrogenase accessory protein pucB 95.98
PF11735241 CAP59_mtransfer: Cryptococcal mannosyltransferase 95.94
KOG3916|consensus372 95.78
PF11397 343 GlcNAc: Glycosyltransferase (GlcNAc); InterPro: IP 95.72
cd02540229 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU 95.7
cd02503181 MobA MobA catalyzes the formation of molybdopterin 95.43
COG1209286 RfbA dTDP-glucose pyrophosphorylase [Cell envelope 95.41
PLN02917293 CMP-KDO synthetase 95.4
PRK00155227 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl 95.3
cd04181217 NTP_transferase NTP_transferases catalyze the tran 95.18
PF01697285 Glyco_transf_92: Glycosyltransferase family 92; In 94.77
cd06915223 NTP_transferase_WcbM_like WcbM_like is a subfamily 94.69
COG1213239 Predicted sugar nucleotidyltransferases [Cell enve 94.65
PRK13368238 3-deoxy-manno-octulosonate cytidylyltransferase; P 94.6
PF00483248 NTP_transferase: Nucleotidyl transferase This Pros 94.54
cd06422221 NTP_transferase_like_1 NTP_transferase_like_1 is a 94.49
cd02518233 GT2_SpsF SpsF is a glycosyltrnasferase implicated 94.47
PRK05450245 3-deoxy-manno-octulosonate cytidylyltransferase; P 94.45
cd06431280 GT8_LARGE_C LARGE catalytic domain has closest hom 94.32
cd00505246 Glyco_transf_8 Members of glycosyltransferase fami 94.31
cd02513223 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N- 94.28
TIGR02665186 molyb_mobA molybdopterin-guanine dinucleotide bios 94.21
cd06425233 M1P_guanylylT_B_like_N N-terminal domain of the M1 94.18
cd06428257 M1P_guanylylT_A_like_N N-terminal domain of M1P_gu 94.15
PLN03180 346 reversibly glycosylated polypeptide; Provisional 94.11
PRK09382 378 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosp 94.11
PRK15480292 glucose-1-phosphate thymidylyltransferase RfbA; Pr 94.08
TIGR03552195 F420_cofC 2-phospho-L-lactate guanylyltransferase 94.04
cd02516218 CDP-ME_synthetase CDP-ME synthetase is involved in 93.95
PRK14353 446 glmU bifunctional N-acetylglucosamine-1-phosphate 93.9
PRK13385230 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 93.77
PRK02726200 molybdopterin-guanine dinucleotide biosynthesis pr 93.58
cd04189236 G1P_TT_long G1P_TT_long represents the long form o 93.36
PF13896317 Glyco_transf_49: Glycosyl-transferase for dystrogl 93.13
cd02509274 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransf 93.02
PRK14355 459 glmU bifunctional N-acetylglucosamine-1-phosphate 92.81
TIGR00453217 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl 92.73
COG2068199 Uncharacterized MobA-related protein [General func 92.23
PRK14360 450 glmU bifunctional N-acetylglucosamine-1-phosphate 92.22
cd04183231 GT2_BcE_like GT2_BcbE_like is likely involved in t 92.22
PF03360207 Glyco_transf_43: Glycosyltransferase family 43; In 92.14
PLN02189 1040 cellulose synthase 91.99
TIGR01207286 rmlA glucose-1-phosphate thymidylyltransferase, sh 91.75
TIGR03584222 PseF pseudaminic acid CMP-transferase. The sequenc 91.74
COG1211230 IspD 4-diphosphocytidyl-2-methyl-D-erithritol synt 91.68
cd04194248 GT8_A4GalT_like A4GalT_like proteins catalyze the 91.62
COG1208 358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas 91.5
PF01501250 Glyco_transf_8: Glycosyl transferase family 8; Int 91.19
PRK14352 482 glmU bifunctional N-acetylglucosamine-1-phosphate 91.11
cd02517239 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes th 91.02
TIGR01173 451 glmU UDP-N-acetylglucosamine diphosphorylase/gluco 91.02
cd02508200 ADP_Glucose_PP ADP-glucose pyrophosphorylase is in 90.92
cd06426220 NTP_transferase_like_2 NTP_trnasferase_like_2 is a 90.56
cd02538240 G1P_TT_short G1P_TT_short is the short form of glu 90.54
PRK14358 481 glmU bifunctional N-acetylglucosamine-1-phosphate 90.34
cd02524253 G1P_cytidylyltransferase G1P_cytidylyltransferase 90.25
PRK14357 448 glmU bifunctional N-acetylglucosamine-1-phosphate 90.19
PRK14489 366 putative bifunctional molybdopterin-guanine dinucl 90.17
PRK14356 456 glmU bifunctional N-acetylglucosamine-1-phosphate 89.46
TIGR00454183 conserved hypothetical protein TIGR00454. At this 89.34
KOG2571|consensus 862 89.27
PF09837122 DUF2064: Uncharacterized protein conserved in bact 89.09
PLN02190 756 cellulose synthase-like protein 89.01
PF05060 356 MGAT2: N-acetylglucosaminyltransferase II (MGAT2); 88.85
PRK15171 334 lipopolysaccharide 1,3-galactosyltransferase; Prov 88.83
PLN02638 1079 cellulose synthase A (UDP-forming), catalytic subu 88.6
COG0746192 MobA Molybdopterin-guanine dinucleotide biosynthes 88.55
KOG1022|consensus691 88.49
PF02348217 CTP_transf_3: Cytidylyltransferase; InterPro: IPR0 88.48
TIGR01105297 galF UTP-glucose-1-phosphate uridylyltransferase, 88.48
cd02523229 PC_cytidylyltransferase Phosphocholine cytidylyltr 88.45
PRK14354 458 glmU bifunctional N-acetylglucosamine-1-phosphate 87.9
cd02541267 UGPase_prokaryotic Prokaryotic UGPase catalyses th 87.9
cd04198214 eIF-2B_gamma_N The N-terminal domain of gamma subu 87.48
PLN02728252 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 87.25
TIGR00466238 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransfe 87.14
PRK00576178 molybdopterin-guanine dinucleotide biosynthesis pr 87.13
TIGR01099260 galU UTP-glucose-1-phosphate uridylyltransferase. 86.68
PRK09451 456 glmU bifunctional N-acetylglucosamine-1-phosphate 86.07
TIGR02623254 G1P_cyt_trans glucose-1-phosphate cytidylyltransfe 85.79
COG1207 460 GlmU N-acetylglucosamine-1-phosphate uridyltransfe 85.73
cd06432248 GT8_HUGT1_C_like The C-terminal domain of HUGT1-li 84.97
PLN02195 977 cellulose synthase A 83.84
TIGR01208 353 rmlA_long glucose-1-phosphate thymidylylransferase 83.29
PF02485244 Branch: Core-2/I-Branching enzyme; InterPro: IPR00 82.77
COG1210291 GalU UDP-glucose pyrophosphorylase [Cell envelope 82.7
>KOG3738|consensus Back     alignment and domain information
Probab=99.97  E-value=1.4e-31  Score=217.81  Aligned_cols=167  Identities=49%  Similarity=0.813  Sum_probs=153.2

Q ss_pred             ccCCcCCCCCCceEEEEEEeCCCchHHHHHHHHHHhcCCCCCccEEEEEECCCCCCCChHHHHHHHHhhcCCCcEEEEEc
Q psy1766           5 CANQTFPSTLPSTSVIICFYNEHPATLYRSVQTLLSRTGQSLLHEIILVNDFSEYPSNLHGEVETFVKGLNNGRVHLYRT   84 (214)
Q Consensus         5 ~~~~~~~~~~p~vSVIIp~~n~~~~~l~~~l~sl~~q~~~~~~~eiivVdd~s~~~d~t~~~~~~~~~~~~~~~v~~i~~   84 (214)
                      |....|...||..||||..+||+...|.+++.|++++++.+...|||+|||+|.| .+....+.++      ++++++++
T Consensus       114 C~~~~y~~dlp~TsviITfHNEARS~LLRTv~SvlnrsP~~li~EiILVDD~S~D-ped~~~L~ri------~kvr~LRN  186 (559)
T KOG3738|consen  114 CRDVDYKVDLPPTSVIITFHNEARSTLLRTVVSVLNRSPEHLIHEIILVDDFSQD-PEDGKLLKRI------PKVRVLRN  186 (559)
T ss_pred             cccceeecCCCCceEEEEeccHHHHHHHHHHHHHHcCChHHhhheeEEecCCCCC-hHHHHHHhhh------heeeeecc
Confidence            8888999999999999999999989999999999999999988999999999996 3344444443      79999999


Q ss_pred             CCCcchHHHHHhhhhhcCCCEEEEEcCCCccCcCchHHHHHHHhcCCCEEEEeeeeeecCCcceeec-CCceeeeeEecc
Q psy1766          85 SKREGLIRARMFGAKYATGKVLVFLDSHIEVNTHWLEPLLVPIAERTNTVTVPIIDIINADTFQYTS-SALVRGGFNWGL  163 (214)
Q Consensus        85 ~~~~G~~~a~n~g~~~a~gd~i~~lD~D~~~~~~~l~~l~~~~~~~~~~vv~~~~~~~~~~~~~~~~-~~~~~g~~~~~~  163 (214)
                      +++.|.-..|+.|+..|++.++.|||+.+.+..+||+.|++.+.++...||+|++|+|+-++|.|.+ +...+|||+|++
T Consensus       187 ~~ReGLirSRvrGAdvA~a~vltFLDSHcEvN~~WLePLL~Rvaed~trvVsPiiDvIn~dnf~Y~~asadLrGGFDWsL  266 (559)
T KOG3738|consen  187 NEREGLIRSRVRGADVAQATVLTFLDSHCEVNEGWLEPLLERVAEDTTRVVSPIIDVINLDNFSYVGASADLRGGFDWSL  266 (559)
T ss_pred             cchhhhhhhhccccccccceEEEEEecceeecchhhHHHHHHHhhcccceeecccccccccccccccchhhhcCCcceEE
Confidence            9999999999999999999999999999999999999999999999999999999999999999985 567899999999


Q ss_pred             cceeecCCccccCCC
Q psy1766         164 HFKWENLPKVKTSSN  178 (214)
Q Consensus       164 ~~~~~~~~~~~~~~~  178 (214)
                      +|+|..++.+....+
T Consensus       267 hF~We~~~~eqr~sr  281 (559)
T KOG3738|consen  267 HFKWEQMQLEQRESR  281 (559)
T ss_pred             EEEehhcCHHHHhhc
Confidence            999999998776655



>cd02510 pp-GalNAc-T pp-GalNAc-T initiates the formation of mucin-type O-linked glycans Back     alignment and domain information
>KOG3736|consensus Back     alignment and domain information
>KOG3737|consensus Back     alignment and domain information
>PRK10073 putative glycosyl transferase; Provisional Back     alignment and domain information
>PRK10018 putative glycosyl transferase; Provisional Back     alignment and domain information
>cd04184 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis Back     alignment and domain information
>TIGR03469 HonB hopene-associated glycosyltransferase HpnB Back     alignment and domain information
>PF00535 Glycos_transf_2: Glycosyl transferase family 2; InterPro: IPR001173 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>cd02520 Glucosylceramide_synthase Glucosylceramide synthase catalyzes the first glycosylation step of glycosphingolipid synthesis Back     alignment and domain information
>cd06427 CESA_like_2 CESA_like_2 is a member of the cellulose synthase superfamily Back     alignment and domain information
>PLN02726 dolichyl-phosphate beta-D-mannosyltransferase Back     alignment and domain information
>TIGR03111 glyc2_xrt_Gpos1 putative glycosyltransferase TIGR03111 Back     alignment and domain information
>cd04195 GT2_AmsE_like GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis Back     alignment and domain information
>cd06437 CESA_CaSu_A2 Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex Back     alignment and domain information
>cd06439 CESA_like_1 CESA_like_1 is a member of the cellulose synthase (CESA) superfamily Back     alignment and domain information
>cd04196 GT_2_like_d Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd06913 beta3GnTL1_like Beta 1, 3-N-acetylglucosaminyltransferase is essential for the formation of poly-N-acetyllactosamine Back     alignment and domain information
>PRK10063 putative glycosyl transferase; Provisional Back     alignment and domain information
>PRK11204 N-glycosyltransferase; Provisional Back     alignment and domain information
>cd06421 CESA_CelA_like CESA_CelA_like are involved in the elongation of the glucan chain of cellulose Back     alignment and domain information
>cd06433 GT_2_WfgS_like WfgS and WfeV are involved in O-antigen biosynthesis Back     alignment and domain information
>PRK14583 hmsR N-glycosyltransferase; Provisional Back     alignment and domain information
>TIGR03472 HpnI hopanoid biosynthesis associated glycosyl transferase protein HpnI Back     alignment and domain information
>cd06442 DPM1_like DPM1_like represents putative enzymes similar to eukaryotic DPM1 Back     alignment and domain information
>cd02525 Succinoglycan_BP_ExoA ExoA is involved in the biosynthesis of succinoglycan Back     alignment and domain information
>cd04187 DPM1_like_bac Bacterial DPM1_like enzymes are related to eukaryotic DPM1 Back     alignment and domain information
>PRK10714 undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose transferase; Provisional Back     alignment and domain information
>cd06423 CESA_like CESA_like is the cellulose synthase superfamily Back     alignment and domain information
>cd04179 DPM_DPG-synthase_like DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily Back     alignment and domain information
>cd04185 GT_2_like_b Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>PTZ00260 dolichyl-phosphate beta-glucosyltransferase; Provisional Back     alignment and domain information
>cd04192 GT_2_like_e Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd04188 DPG_synthase DPG_synthase is involved in protein N-linked glycosylation Back     alignment and domain information
>KOG2978|consensus Back     alignment and domain information
>cd02522 GT_2_like_a GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function Back     alignment and domain information
>cd06435 CESA_NdvC_like NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase Back     alignment and domain information
>COG1216 Predicted glycosyltransferases [General function prediction only] Back     alignment and domain information
>PF13641 Glyco_tranf_2_3: Glycosyltransferase like family 2; PDB: 4FIY_B 4FIX_A Back     alignment and domain information
>cd06420 GT2_Chondriotin_Pol_N N-terminal domain of Chondroitin polymerase functions as a GalNAc transferase Back     alignment and domain information
>cd06434 GT2_HAS Hyaluronan synthases catalyze polymerization of hyaluronan Back     alignment and domain information
>cd06438 EpsO_like EpsO protein participates in the methanolan synthesis Back     alignment and domain information
>PRK13915 putative glucosyl-3-phosphoglycerate synthase; Provisional Back     alignment and domain information
>cd04186 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd02511 Beta4Glucosyltransferase UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide Back     alignment and domain information
>cd06436 GlcNAc-1-P_transferase N-acetyl-glucosamine transferase is involved in the synthesis of Poly-beta-1,6-N-acetyl-D-glucosamine Back     alignment and domain information
>cd02526 GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl transferase Back     alignment and domain information
>COG0463 WcaA Glycosyltransferases involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11498 bcsA cellulose synthase catalytic subunit; Provisional Back     alignment and domain information
>TIGR03030 CelA cellulose synthase catalytic subunit (UDP-forming) Back     alignment and domain information
>PF10111 Glyco_tranf_2_2: Glycosyltransferase like family 2; InterPro: IPR019290 This conserved domain is found in a set of prokaryotic proteins including putative glucosyltransferases, which are involved in bacterial capsule biosynthesis [, ] Back     alignment and domain information
>COG1215 Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01556 rhamnosyltran L-rhamnosyltransferase Back     alignment and domain information
>cd04190 Chitin_synth_C C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin Back     alignment and domain information
>cd04191 Glucan_BSP_ModH Glucan_BSP_ModH catalyzes the elongation of beta-1,2 polyglucose chains of glucan Back     alignment and domain information
>PRK14716 bacteriophage N4 adsorption protein B; Provisional Back     alignment and domain information
>cd00761 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold Back     alignment and domain information
>KOG2977|consensus Back     alignment and domain information
>PRK11234 nfrB bacteriophage N4 adsorption protein B; Provisional Back     alignment and domain information
>PRK05454 glucosyltransferase MdoH; Provisional Back     alignment and domain information
>PRK15489 nfrB bacteriophage N4 adsorption protein B; Provisional Back     alignment and domain information
>cd02514 GT13_GLCNAC-TI GT13_GLCNAC-TI is involved in an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides Back     alignment and domain information
>KOG2547|consensus Back     alignment and domain information
>PF13712 Glyco_tranf_2_5: Glycosyltransferase like family; PDB: 2QGI_A 2NXV_B Back     alignment and domain information
>PF13704 Glyco_tranf_2_4: Glycosyl transferase family 2 Back     alignment and domain information
>PF03452 Anp1: Anp1; InterPro: IPR005109 The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function Back     alignment and domain information
>PF03071 GNT-I: GNT-I family; InterPro: IPR004139 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>COG4092 Predicted glycosyltransferase involved in capsule biosynthesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3588|consensus Back     alignment and domain information
>PF03142 Chitin_synth_2: Chitin synthase; InterPro: IPR004835 Chitin synthase (2 Back     alignment and domain information
>PF13506 Glyco_transf_21: Glycosyl transferase family 21 Back     alignment and domain information
>PF09488 Osmo_MPGsynth: Mannosyl-3-phosphoglycerate synthase (osmo_MPGsynth); InterPro: IPR012812 This family consists of examples of mannosyl-3-phosphoglycerate synthase (MPGS), which together with mannosyl-3-phosphoglycerate phosphatase (MPGP), comprises a two-step pathway for mannosylglycerate biosynthesis Back     alignment and domain information
>PF06306 CgtA: Beta-1,4-N-acetylgalactosaminyltransferase (CgtA); InterPro: IPR010446 This family consists of several beta-1,4-N-acetylgalactosaminyltransferase proteins from Campylobacter jejuni [] Back     alignment and domain information
>COG2943 MdoH Membrane glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14503 mannosyl-3-phosphoglycerate synthase; Provisional Back     alignment and domain information
>TIGR02460 osmo_MPGsynth mannosyl-3-phosphoglycerate synthase Back     alignment and domain information
>PF05679 CHGN: Chondroitin N-acetylgalactosaminyltransferase; InterPro: IPR008428 This family represents Chondroitin N-acetylgalactosaminyltransferase Back     alignment and domain information
>PF11316 Rhamno_transf: Putative rhamnosyl transferase ; InterPro: IPR021466 This bacterial family of proteins has no known function Back     alignment and domain information
>cd00218 GlcAT-I Beta1,3-glucuronyltransferase I (GlcAT-I) is involved in the initial steps of proteoglycan synthesis Back     alignment and domain information
>PLN02458 transferase, transferring glycosyl groups Back     alignment and domain information
>PF13733 Glyco_transf_7N: N-terminal region of glycosyl transferase group 7; PDB: 2AGD_B 3EE5_A 2AE7_B 2AEC_A 2FYA_A 2AES_B 2AH9_A 2FYB_A 2FY7_A 3LW6_A Back     alignment and domain information
>PF09258 Glyco_transf_64: Glycosyl transferase family 64 domain; InterPro: IPR015338 Members of this entry catalyse the transfer reaction of N-acetylglucosamine and N-acetylgalactosamine from the respective UDP-sugars to the non-reducing end of [glucuronic acid]beta 1-3[galactose]beta 1-O-naphthalenemethanol, an acceptor substrate analogue of the natural common linker of various glycosylaminoglycans Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>PF03214 RGP: Reversibly glycosylated polypeptide; InterPro: IPR004901 Alpha-1,4-glucan-protein synthase catalyses the reaction: protein + UDP-D-glucose = alpha-D-glucosyl-protein + UDP The enzyme has a possible role in the synthesis of cell wall polysaccharides in plants [] Back     alignment and domain information
>cd04182 GT_2_like_f GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function Back     alignment and domain information
>KOG1476|consensus Back     alignment and domain information
>PLN02893 Cellulose synthase-like protein Back     alignment and domain information
>PRK00317 mobA molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed Back     alignment and domain information
>PF12804 NTP_transf_3: MobA-like NTP transferase domain; PDB: 3FWW_A 2XME_D 2XMH_C 2DPW_A 2WAW_A 2OI5_B 1HV9_B 1FWY_A 2OI6_A 2OI7_B Back     alignment and domain information
>TIGR03310 matur_ygfJ molybdenum hydroxylase accessory protein, YgfJ family Back     alignment and domain information
>cd00899 b4GalT Beta-4-Galactosyltransferase is involved in the formation of the poly-N-acetyllactosamine core structures present in glycoproteins and glycosphingolipids Back     alignment and domain information
>PF04666 Glyco_transf_54: N-Acetylglucosaminyltransferase-IV (GnT-IV) conserved region; InterPro: IPR006759 The complex-type of oligosaccharides are synthesised through elongation by glycosyltransferases after trimming of the precursor oligosaccharides transferred to proteins in the endoplasmic reticulum Back     alignment and domain information
>KOG1413|consensus Back     alignment and domain information
>PF13632 Glyco_trans_2_3: Glycosyl transferase family group 2 Back     alignment and domain information
>TIGR03202 pucB xanthine dehydrogenase accessory protein pucB Back     alignment and domain information
>PF11735 CAP59_mtransfer: Cryptococcal mannosyltransferase 1 ; InterPro: IPR021047 The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1 [, ] Back     alignment and domain information
>KOG3916|consensus Back     alignment and domain information
>PF11397 GlcNAc: Glycosyltransferase (GlcNAc); InterPro: IPR021067 GlcNAc is an enzyme that carries out the first glycosylation step of hydroxylated Skp1; it is found in the cytoplasm and results in a pentasaccharide-linked 'HyPro-143[, ] Back     alignment and domain information
>cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU Back     alignment and domain information
>cd02503 MobA MobA catalyzes the formation of molybdopterin guanine dinucleotide Back     alignment and domain information
>COG1209 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02917 CMP-KDO synthetase Back     alignment and domain information
>PRK00155 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Reviewed Back     alignment and domain information
>cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars Back     alignment and domain information
>PF01697 Glyco_transf_92: Glycosyltransferase family 92; InterPro: IPR008166 This entry represents a region approximately 300 residues long that is of unknown function Back     alignment and domain information
>cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases Back     alignment and domain information
>COG1213 Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13368 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>PF00483 NTP_transferase: Nucleotidyl transferase This Prosite entry is only a sub-family of the Pfam entry Back     alignment and domain information
>cd06422 NTP_transferase_like_1 NTP_transferase_like_1 is a member of the nucleotidyl transferase family Back     alignment and domain information
>cd02518 GT2_SpsF SpsF is a glycosyltrnasferase implicated in the synthesis of the spore coat Back     alignment and domain information
>PRK05450 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>cd06431 GT8_LARGE_C LARGE catalytic domain has closest homology to GT8 glycosyltransferase involved in lipooligosaccharide synthesis Back     alignment and domain information
>cd00505 Glyco_transf_8 Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis Back     alignment and domain information
>cd02513 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-acetylneuraminic acid by adding CMP moiety Back     alignment and domain information
>TIGR02665 molyb_mobA molybdopterin-guanine dinucleotide biosynthesis protein A, proteobacterial Back     alignment and domain information
>cd06425 M1P_guanylylT_B_like_N N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins Back     alignment and domain information
>cd06428 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase Back     alignment and domain information
>PLN03180 reversibly glycosylated polypeptide; Provisional Back     alignment and domain information
>PRK09382 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase protein; Provisional Back     alignment and domain information
>PRK15480 glucose-1-phosphate thymidylyltransferase RfbA; Provisional Back     alignment and domain information
>TIGR03552 F420_cofC 2-phospho-L-lactate guanylyltransferase CofC Back     alignment and domain information
>cd02516 CDP-ME_synthetase CDP-ME synthetase is involved in mevalonate-independent isoprenoid production Back     alignment and domain information
>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK13385 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Provisional Back     alignment and domain information
>PRK02726 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>PF13896 Glyco_transf_49: Glycosyl-transferase for dystroglycan Back     alignment and domain information
>cd02509 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose Back     alignment and domain information
>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR00453 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Back     alignment and domain information
>COG2068 Uncharacterized MobA-related protein [General function prediction only] Back     alignment and domain information
>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd04183 GT2_BcE_like GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule Back     alignment and domain information
>PF03360 Glyco_transf_43: Glycosyltransferase family 43; InterPro: IPR005027 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information
>TIGR01207 rmlA glucose-1-phosphate thymidylyltransferase, short form Back     alignment and domain information
>TIGR03584 PseF pseudaminic acid CMP-transferase Back     alignment and domain information
>COG1211 IspD 4-diphosphocytidyl-2-methyl-D-erithritol synthase [Lipid metabolism] Back     alignment and domain information
>cd04194 GT8_A4GalT_like A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01501 Glyco_transf_8: Glycosyl transferase family 8; InterPro: IPR002495 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd02517 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>cd02508 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch Back     alignment and domain information
>cd06426 NTP_transferase_like_2 NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family Back     alignment and domain information
>cd02538 G1P_TT_short G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd02524 G1P_cytidylyltransferase G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose Back     alignment and domain information
>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional Back     alignment and domain information
>PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR00454 conserved hypothetical protein TIGR00454 Back     alignment and domain information
>KOG2571|consensus Back     alignment and domain information
>PF09837 DUF2064: Uncharacterized protein conserved in bacteria (DUF2064); InterPro: IPR018641 This entry contains proteins that have no known function Back     alignment and domain information
>PLN02190 cellulose synthase-like protein Back     alignment and domain information
>PF05060 MGAT2: N-acetylglucosaminyltransferase II (MGAT2); InterPro: IPR007754 N-acetylglucosaminyltransferase II (2 Back     alignment and domain information
>PRK15171 lipopolysaccharide 1,3-galactosyltransferase; Provisional Back     alignment and domain information
>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit Back     alignment and domain information
>COG0746 MobA Molybdopterin-guanine dinucleotide biosynthesis protein A [Coenzyme metabolism] Back     alignment and domain information
>KOG1022|consensus Back     alignment and domain information
>PF02348 CTP_transf_3: Cytidylyltransferase; InterPro: IPR003329 Synonym(s): CMP-N-acetylneuraminic acid synthetase Acylneuraminate cytidylyltransferase (2 Back     alignment and domain information
>TIGR01105 galF UTP-glucose-1-phosphate uridylyltransferase, non-catalytic GalF subunit Back     alignment and domain information
>cd02523 PC_cytidylyltransferase Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline Back     alignment and domain information
>PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd02541 UGPase_prokaryotic Prokaryotic UGPase catalyses the synthesis of UDP-glucose Back     alignment and domain information
>cd04198 eIF-2B_gamma_N The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>PLN02728 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Back     alignment and domain information
>TIGR00466 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase Back     alignment and domain information
>PRK00576 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>TIGR01099 galU UTP-glucose-1-phosphate uridylyltransferase Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR02623 G1P_cyt_trans glucose-1-phosphate cytidylyltransferase Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd06432 GT8_HUGT1_C_like The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family Back     alignment and domain information
>PLN02195 cellulose synthase A Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>PF02485 Branch: Core-2/I-Branching enzyme; InterPro: IPR003406 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>COG1210 GalU UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
2ffu_A 501 Crystal Structure Of Human Ppgalnact-2 Complexed Wi 5e-38
1xhb_A 472 The Crystal Structure Of Udp-Galnac: Polypeptide Al 9e-37
2d7i_A 570 Crsytal Structure Of Pp-Galnac-T10 With Udp, Galnac 4e-35
>pdb|2FFU|A Chain A, Crystal Structure Of Human Ppgalnact-2 Complexed With Udp And Ea2 Length = 501 Back     alignment and structure

Iteration: 1

Score = 154 bits (388), Expect = 5e-38, Method: Compositional matrix adjust. Identities = 86/209 (41%), Positives = 125/209 (59%), Gaps = 15/209 (7%) Query: 5 CANQTFPSTLPSTSVIICFYNEHPATLYRSVQTLLSRTGQSLLHEIILVNDFSEYPSN-- 62 C + + LP+TSV+I F+NE + L R+V ++L ++ L+ EIILV+D+S P + Sbjct: 56 CQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGA 115 Query: 63 LHGEVETFVKGLNNGRVHLYRTSKREGLIRARMFGAKYATGKVLVFLDSHIEVNTHWLEP 122 L G++E +V + R +REGL+R+R+ GA A KVL FLDSH E N HWLEP Sbjct: 116 LLGKIE---------KVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEP 166 Query: 123 LLVPIAERTNTVTVPIIDIINADTFQYT-SSALVRGGFNWGLHFKWENL-PKVKTSSNPS 180 LL +AE V PIID+IN D FQY +SA ++GGF+W L FKW+ + P+ + S + Sbjct: 167 LLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGN 226 Query: 181 YLPLQYTSSALVRGGFNWGLHFKWENLPK 209 P+ + ++ GG F +E L K Sbjct: 227 --PVAPIKTPMIAGGLFVMDKFYFEELGK 253
>pdb|1XHB|A Chain A, The Crystal Structure Of Udp-Galnac: Polypeptide Alpha-N- Acetylgalactosaminyltransferase-T1 Length = 472 Back     alignment and structure
>pdb|2D7I|A Chain A, Crsytal Structure Of Pp-Galnac-T10 With Udp, Galnac And Mn2+ Length = 570 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
1xhb_A 472 Polypeptide N-acetylgalactosaminyltransferase 1; g 4e-60
2d7i_A 570 Polypeptide N-acetylgalactosaminyltransferase 10; 2e-58
2ffu_A 501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 2e-56
3l7i_A 729 Teichoic acid biosynthesis protein F; GT-B fold, m 3e-10
2z86_A 625 Chondroitin synthase; GT-A, glycosyltransferase A, 2e-06
2z86_A625 Chondroitin synthase; GT-A, glycosyltransferase A, 2e-05
1qg8_A255 Protein (spore coat polysaccharide biosynthesis P 3e-06
3bcv_A240 Putative glycosyltransferase protein; protein stru 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
2nxv_A249 ATP synthase subunits region ORF 6; majastridin, A 6e-04
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Length = 472 Back     alignment and structure
 Score =  194 bits (493), Expect = 4e-60
 Identities = 75/169 (44%), Positives = 110/169 (65%), Gaps = 3/169 (1%)

Query: 5   CANQTFPSTLPSTSVIICFYNEHPATLYRSVQTLLSRTGQSLLHEIILVNDFSEYPSNLH 64
           C  + +P  LP+TSV+I F+NE  +TL R+V ++++R+ + ++ EI+LV+D SE    L 
Sbjct: 19  CKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERD-FLK 77

Query: 65  GEVETFVKGLNNGRVHLYRTSKREGLIRARMFGAKYATGKVLVFLDSHIEVNTHWLEPLL 124
             +E++VK L    VH+ R  +R GLIRAR+ GA  + G+V+ FLD+H E    WLEPLL
Sbjct: 78  RPLESYVKKLK-VPVHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLL 136

Query: 125 VPIAERTNTVTVPIIDIINADTFQYT-SSALVRGGFNWGLHFKWENLPK 172
             I     TV  PIID+I+ DTF+Y   S +  GGFNW L+F+W  +P+
Sbjct: 137 ARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQ 185


>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Length = 570 Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Length = 501 Back     alignment and structure
>3l7i_A Teichoic acid biosynthesis protein F; GT-B fold, monotopic membrane protein, structural protein; 2.70A {Staphylococcus epidermidis} PDB: 3l7j_A 3l7k_A* 3l7l_A* 3l7m_A* Length = 729 Back     alignment and structure
>2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Length = 625 Back     alignment and structure
>2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Length = 625 Back     alignment and structure
>1qg8_A Protein (spore coat polysaccharide biosynthesis P SPSA); glycosyltransferase, transferase; 1.50A {Bacillus subtilis} SCOP: c.68.1.1 PDB: 1h7q_A* 1h7l_A 1qgq_A* 1qgs_A* Length = 255 Back     alignment and structure
>3bcv_A Putative glycosyltransferase protein; protein structure initiative II, PSI-II NYSGXRC, structural genomics; 2.35A {Bacteroides fragilis} Length = 240 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2nxv_A ATP synthase subunits region ORF 6; majastridin, ATPase operon, glycosyl transferase, rossmann F sulphur SAD, transferase; 1.10A {Rhodobacter blasticus} PDB: 2qgi_A* Length = 249 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query214
1xhb_A 472 Polypeptide N-acetylgalactosaminyltransferase 1; g 100.0
2d7i_A 570 Polypeptide N-acetylgalactosaminyltransferase 10; 99.98
2ffu_A 501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 99.97
3bcv_A240 Putative glycosyltransferase protein; protein stru 99.94
1qg8_A255 Protein (spore coat polysaccharide biosynthesis P 99.94
2z86_A625 Chondroitin synthase; GT-A, glycosyltransferase A, 99.91
3l7i_A 729 Teichoic acid biosynthesis protein F; GT-B fold, m 99.9
3ckj_A329 Putative uncharacterized protein; mycobacteria, un 99.88
2z86_A 625 Chondroitin synthase; GT-A, glycosyltransferase A, 99.87
4fix_A 657 UDP-galactofuranosyl transferase GLFT2; CAZY GT-2 99.87
3f1y_A387 Mannosyl-3-phosphoglycerate synthase; GT-A type gl 99.86
4hg6_A 802 Cellulose synthase subunit A; membrane translocati 99.82
2nxv_A249 ATP synthase subunits region ORF 6; majastridin, A 99.73
2wvl_A 391 Mannosyl-3-phosphoglycerate synthase; GT-A fold, t 99.69
2bo4_A 397 Mannosylglycerate synthase; catalysis, glycosyltra 99.66
2fy7_A287 Beta-1,4-galactosyltransferase 1; M339H mutant, AP 99.55
2zu9_A 394 Mannosyl-3-phosphoglycerate synthase; GT-A fold, g 99.51
1fo8_A 343 Alpha-1,3-mannosyl-glycoprotein beta-1,2-N- acetyl 99.39
2d0j_A246 Galactosylgalactosylxylosylprotein 3-beta- glucuro 97.35
1v84_A253 Galactosylgalactosylxylosylprotein 3-beta- glucuro 97.19
3cu0_A281 Galactosylgalactosylxylosylprotein 3-beta- glucuro 97.14
3lw6_A287 FI08434P, beta-4-galactosyltransferase 7; protein- 97.0
1omz_A293 Alpha-1,4-N-acetylhexosaminyltransferase EXTL2; ro 96.9
3oam_A252 3-deoxy-manno-octulosonate cytidylyltransferase; c 96.32
3k8d_A264 3-deoxy-manno-octulosonate cytidylyltransferase; K 96.22
1qwj_A229 Cytidine monophospho-N-acetylneuraminic acid synth 95.93
2c0n_A203 A197; thermophil protein, thermophilic virus, STIV 95.91
3tqd_A256 3-deoxy-manno-octulosonate cytidylyltransferase; c 95.87
3tzt_A276 Glycosyl transferase family 8; structural genomics 95.64
1ezi_A228 CMP-N-acetylneuraminic acid synthetase; homodimer, 95.57
1h7e_A245 3-deoxy-manno-octulosonate cytidylyltransferase; n 95.33
2wee_A197 MOBA-related protein; unknown function; 1.65A {Myc 95.05
3st8_A 501 Bifunctional protein GLMU; acetyltransferase, pyro 94.96
2y6p_A234 3-deoxy-manno-octulosonate cytidylyltransferase; l 94.91
1i52_A236 4-diphosphocytidyl-2-C-methylerythritol synthase; 94.8
2waw_A199 MOBA relate protein; unknown function; HET: PGE; 1 94.55
2yc3_A228 2-C-methyl-D-erythritol 4-phosphate cytidylyltran 94.49
4ecm_A269 Glucose-1-phosphate thymidylyltransferase; HET: DA 94.39
1vgw_A231 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; 94.19
4fcu_A253 3-deoxy-manno-octulosonate cytidylyltransferase; s 94.16
4fce_A 459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 93.74
3ngw_A208 Molybdopterin-guanine dinucleotide biosynthesis P 93.69
3juk_A281 UDP-glucose pyrophosphorylase (GALU); transfer; HE 93.22
3q80_A231 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; 93.21
1w55_A 371 ISPD/ISPF bifunctional enzyme; biosynthetic pathwa 93.16
3f1c_A246 Putative 2-C-methyl-D-erythritol 4-phosphate cytid 93.09
1fxo_A293 Glucose-1-phosphate thymidylyltransferase; rhamnos 92.87
1vic_A262 3-deoxy-manno-octulosonate cytidylyltransferase; s 92.85
2qh5_A308 PMI, ALGA, mannose-6-phosphate isomerase; structur 92.79
1e5k_A201 Molybdopterin-guanine dinucleotide biosynthesis pr 92.77
3d5n_A197 Q97W15_sulso; NESG, SSR125, structural genomics, P 92.64
3rsb_A196 Adenosylcobinamide-phosphate guanylyltransferase; 92.54
2ux8_A297 Glucose-1-phosphate uridylyltransferase; UGPG, GAL 92.09
2vsh_A236 TARI, 2-C-methyl-D-erythritol 4-phosphate cytidyly 92.06
1lvw_A295 Glucose-1-phosphate thymidylyltransferase; protein 91.8
1g9r_A 311 Glycosyl transferase; alpha-beta structure; HET: U 91.72
2xwl_A223 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; 91.58
2e8b_A201 Probable molybdopterin-guanine dinucleotide biosy 91.43
1hm9_A 468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 91.22
3pnn_A303 Conserved domain protein; structural genomics, PSI 91.15
2v0h_A 456 Bifunctional protein GLMU; cell WALL, magnesium, c 90.92
2pa4_A323 UTP-glucose-1-phosphate uridylyltransferase; phosp 90.26
2e3d_A302 UTP--glucose-1-phosphate uridylyltransferase; UDP- 90.21
1mc3_A296 Glucose-1-phosphate thymidylyltransferase; glucose 90.13
2xme_A232 CTP-inositol-1-phosphate cytidylyltransferase; CDP 88.25
2i5e_A211 Hypothetical protein MM_2497; APC86122, methanosar 84.87
1ll2_A 333 Glycogenin-1; protein-substrate complex, beta-alph 84.77
1vpa_A234 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; 83.46
3cgx_A242 Putative nucleotide-diphospho-sugar transferase; Y 83.43
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Back     alignment and structure
Probab=100.00  E-value=3.6e-32  Score=235.19  Aligned_cols=197  Identities=40%  Similarity=0.714  Sum_probs=166.6

Q ss_pred             CccccCCcCCCCCCceEEEEEEeCCCchHHHHHHHHHHhcCCCCCccEEEEEECCCCCCC-ChHHHHHHHHhhcCCC-cE
Q psy1766           2 SIICANQTFPSTLPSTSVIICFYNEHPATLYRSVQTLLSRTGQSLLHEIILVNDFSEYPS-NLHGEVETFVKGLNNG-RV   79 (214)
Q Consensus         2 ~~~~~~~~~~~~~p~vSVIIp~~n~~~~~l~~~l~sl~~q~~~~~~~eiivVdd~s~~~d-~t~~~~~~~~~~~~~~-~v   79 (214)
                      ...|++..|+..+|+||||||+||++++.|.+||+|+++|+++...+|||||||||+  | .+.++++++.+++  + ++
T Consensus        16 ~~~c~~~~~~~~~p~vSVIIp~yN~~~~~l~~~l~Sl~~q~~~~~~~EIIvVDd~S~--d~~t~~~l~~~~~~~--~~~v   91 (472)
T 1xhb_A           16 LEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASE--RDFLKRPLESYVKKL--KVPV   91 (472)
T ss_dssp             CGGGGTCCCCSCCCCEEEEEEESSCCHHHHHHHHHHHHHSSCGGGEEEEEEEECSCC--CGGGTHHHHHHHHSS--SSCE
T ss_pred             ChhhccCcCCcCCCCeEEEEEeCCCCHHHHHHHHHHHHhcCcHhHceEEEEEECCCC--cHHHHHHHHHHHHHC--CCcE
Confidence            467999999999999999999999977899999999999999875579999999999  6 5999999998876  5 89


Q ss_pred             EEEEcCCCcchHHHHHhhhhhcCCCEEEEEcCCCccCcCchHHHHHHHhcCCCEEEEeeeeeecCCcceeec-CCceeee
Q psy1766          80 HLYRTSKREGLIRARMFGAKYATGKVLVFLDSHIEVNTHWLEPLLVPIAERTNTVTVPIIDIINADTFQYTS-SALVRGG  158 (214)
Q Consensus        80 ~~i~~~~~~G~~~a~n~g~~~a~gd~i~~lD~D~~~~~~~l~~l~~~~~~~~~~vv~~~~~~~~~~~~~~~~-~~~~~g~  158 (214)
                      ++++.++|.|.+.|+|.|++.|+|+||+|+|+|+.+.|+||+.+++.+.+++..+++|.++.++.+++.+.. .....|+
T Consensus        92 ~vi~~~~n~G~~~a~N~g~~~A~gd~i~flD~D~~~~p~~L~~ll~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~  171 (472)
T 1xhb_A           92 HVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGG  171 (472)
T ss_dssp             EEEECSSCCCHHHHHHHHHHHCCSSEEEEEESSEEECTTCHHHHHHHHHHCTTEEEEEEEEEECSSSCCEECCCTTEEEE
T ss_pred             EEEECCCCCChHHHHHHHHHhccCCeEEEECCCeEeCccHHHHHHHHHHhCCCEEEEeeeeeEcCCCceeccCCCcccce
Confidence            999999999999999999999999999999999999999999999999999999999999999988887753 4566889


Q ss_pred             eEecccceeecCCccccCCC------CCCCCCCCCccc-------hhcccccccccc
Q psy1766         159 FNWGLHFKWENLPKVKTSSN------PSYLPLQYTSSA-------LVRGGFNWGLHF  202 (214)
Q Consensus       159 ~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~-------~~~ggf~~~~~~  202 (214)
                      ++|.+.+.|..++.......      ....|...++++       ..+||||..+..
T Consensus       172 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~irr~~~~~iGgfde~~~~  228 (472)
T 1xhb_A          172 FNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDI  228 (472)
T ss_dssp             ECTTCCEEEEECCHHHHHHTTTCTTSCEECSBCCSSSEEEEHHHHHHTTSCCTTSCT
T ss_pred             eeccceeecccCCHHHHhcccCCCCCcccCccccceeEEEEHHHHHHcCCCCCcccc
Confidence            99999999987765322111      111133444443       389999998865



>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Back     alignment and structure
>3bcv_A Putative glycosyltransferase protein; protein structure initiative II, PSI-II NYSGXRC, structural genomics; 2.35A {Bacteroides fragilis} Back     alignment and structure
>1qg8_A Protein (spore coat polysaccharide biosynthesis P SPSA); glycosyltransferase, transferase; 1.50A {Bacillus subtilis} SCOP: c.68.1.1 PDB: 1h7q_A* 1h7l_A 1qgq_A* 1qgs_A* Back     alignment and structure
>2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Back     alignment and structure
>3l7i_A Teichoic acid biosynthesis protein F; GT-B fold, monotopic membrane protein, structural protein; 2.70A {Staphylococcus epidermidis} PDB: 3l7j_A 3l7k_A* 3l7l_A* 3l7m_A* Back     alignment and structure
>3ckj_A Putative uncharacterized protein; mycobacteria, unknown function; HET: CIT; 1.80A {Mycobacterium paratuberculosis} PDB: 3ckn_A* 3cko_A* 3ckq_A* 3ckv_A* 3e26_A 3e25_A Back     alignment and structure
>2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Back     alignment and structure
>4fix_A UDP-galactofuranosyl transferase GLFT2; CAZY GT-2 family, glycosyltrans carbohydrate binding, membrane; 2.45A {Mycobacterium tuberculosis} PDB: 4fiy_A* Back     alignment and structure
>3f1y_A Mannosyl-3-phosphoglycerate synthase; GT-A type glycosyltransferase, GT-81, mannosyl-3-phosphoglyc synthase, GDP-mannose, transferas; 2.20A {Rubrobacter xylanophilus} PDB: 3kia_A* 3o3p_A* Back     alignment and structure
>4hg6_A Cellulose synthase subunit A; membrane translocation, cellulose synthesis, UDP-GLC binding membrane, transferase; HET: BGC UDP LDA; 3.25A {Rhodobacter sphaeroides} Back     alignment and structure
>2nxv_A ATP synthase subunits region ORF 6; majastridin, ATPase operon, glycosyl transferase, rossmann F sulphur SAD, transferase; 1.10A {Rhodobacter blasticus} PDB: 2qgi_A* Back     alignment and structure
>2wvl_A Mannosyl-3-phosphoglycerate synthase; GT-A fold, transferase, glycosyltransferase, retaining mecha glucosyl transferase; HET: GDD; 2.81A {Thermus thermophilus} PDB: 2wvk_A* 2wvm_A* Back     alignment and structure
>2bo4_A Mannosylglycerate synthase; catalysis, glycosyltransferase, mannose, transferase, stereoselectivity; HET: FLC; 1.95A {Rhodothermus marinus} SCOP: c.68.1.18 PDB: 2bo6_A 2bo7_A* 2bo8_A* 2xw2_A 2y4j_A 2xw3_A* 2xw4_A* 2xw5_A* 2y4k_A* 2y4l_A* 2y4m_A* Back     alignment and structure
>2fy7_A Beta-1,4-galactosyltransferase 1; M339H mutant, APO enzyme; HET: PGE; 1.70A {Homo sapiens} PDB: 2aec_A* 2aes_A* 2ae7_A* 2ah9_A* 2agd_A* 2fya_A* 2fyb_A* 3ee5_A* 2fyc_B* 1tw1_A* 1tw5_A* 1tvy_A* 1nmm_B* 1o0r_A* 1yro_B* 1nf5_B* 1nhe_B* 1nkh_B* 1nqi_B* 1nwg_B* ... Back     alignment and structure
>2zu9_A Mannosyl-3-phosphoglycerate synthase; GT-A fold, glycosyltransferase, GT55, GDP, cytoplasm, magnesium, transferase; HET: GDP; 2.00A {Pyrococcus horikoshii} PDB: 2zu7_A* 2zu8_A* Back     alignment and structure
>1fo8_A Alpha-1,3-mannosyl-glycoprotein beta-1,2-N- acetylglucosaminyltransferase; methylmercury derivative, N- acetylglucosaminyltransferase I; 1.40A {Oryctolagus cuniculus} SCOP: c.68.1.10 PDB: 1fo9_A 1foa_A* 2apc_A* 2am3_A* 2am4_A* 2am5_A* Back     alignment and structure
>2d0j_A Galactosylgalactosylxylosylprotein 3-beta- glucuronosyltransferase 2; rossmann-like fold, glucuronyltransferase; 2.00A {Homo sapiens} Back     alignment and structure
>1v84_A Galactosylgalactosylxylosylprotein 3-beta- glucuronosyltransferase 1; glycoprotein, glycocyltransferase, HNK-1 epitop; HET: GAL NDG NAG TLA UDP; 1.82A {Homo sapiens} SCOP: c.68.1.7 PDB: 1v83_A* 1v82_A* Back     alignment and structure
>3cu0_A Galactosylgalactosylxylosylprotein 3-beta- glucuronosyltransferase 3; glcat-I, glycosyltransferase, heparan sulfate biosynthesis, glycoprotein; HET: GAL UDP; 1.90A {Homo sapiens} SCOP: c.68.1.7 PDB: 1kws_A* 1fgg_A* Back     alignment and structure
>3lw6_A FI08434P, beta-4-galactosyltransferase 7; protein-Mn-UDP complex, glycosyltransferase; HET: UDP; 1.81A {Drosophila melanogaster} Back     alignment and structure
>1omz_A Alpha-1,4-N-acetylhexosaminyltransferase EXTL2; rossmann fold, DXD motif; HET: UD2; 2.10A {Mus musculus} SCOP: c.68.1.15 PDB: 1omx_A* 1on6_A* 1on8_A* Back     alignment and structure
>3oam_A 3-deoxy-manno-octulosonate cytidylyltransferase; center for structural genomics of infectious diseases; 1.75A {Vibrio cholerae o1 biovar el tor} SCOP: c.68.1.13 Back     alignment and structure
>3k8d_A 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB synthetase KDO complex, lipopolysaccharide biosynthesis magnesium, nucleotidyltransferase; HET: KDO CTP; 1.90A {Escherichia coli} SCOP: c.68.1.13 PDB: 3k8e_C 1vh1_A 3jtj_A* Back     alignment and structure
>1qwj_A Cytidine monophospho-N-acetylneuraminic acid synthetase; CMP-5-N-acetylneuraminic acid synthetase, CMP-NEU5AC, sialic acid, glycosylation; HET: NCC; 2.80A {Mus musculus} SCOP: c.68.1.13 Back     alignment and structure
>2c0n_A A197; thermophil protein, thermophilic virus, STIV, sulfolobus turreted ICOS virus; 1.86A {Sulfolobus turreted icosahedral virus} Back     alignment and structure
>3tqd_A 3-deoxy-manno-octulosonate cytidylyltransferase; cell envelope; 1.80A {Coxiella burnetii} SCOP: c.68.1.0 Back     alignment and structure
>3tzt_A Glycosyl transferase family 8; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, putative glycosyl transferase; HET: MSE CIT; 2.10A {Anaerococcus prevotii} SCOP: c.68.1.0 Back     alignment and structure
>1ezi_A CMP-N-acetylneuraminic acid synthetase; homodimer, alpha-beta-alpha, transferase; 2.00A {Neisseria meningitidis} SCOP: c.68.1.13 PDB: 1eyr_A Back     alignment and structure
>1h7e_A 3-deoxy-manno-octulosonate cytidylyltransferase; nucleotidyltransferase, CMP-KDO synthetase, nucleoside monophosphate glycosides; 1.83A {Escherichia coli} SCOP: c.68.1.13 PDB: 1gqc_A* 1gq9_A 1h6j_A 1h7f_A* 1h7g_A* 1h7h_A* 1h7t_A* Back     alignment and structure
>2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A 2yes_A Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Back     alignment and structure
>2y6p_A 3-deoxy-manno-octulosonate cytidylyltransferase; lipid A; HET: CTP; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1i52_A 4-diphosphocytidyl-2-C-methylerythritol synthase; cytidylyltransferase, deoxyxylulose-5-phosphate pathway (DXP isoprenoid biosynthesys, MEP; HET: CTP; 1.50A {Escherichia coli} SCOP: c.68.1.13 PDB: 1ini_A* 1inj_A 1vgt_A 1vgu_A 3n9w_A 1h3m_A Back     alignment and structure
>2waw_A MOBA relate protein; unknown function; HET: PGE; 1.60A {Mycobacterium SP} Back     alignment and structure
>2yc3_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran chloroplastic; transferase, non-mevalonate-pathway, herbicide, allosteric P; HET: MW5; 1.40A {Arabidopsis thaliana} PDB: 2yc5_A* 1w77_A* 2ycm_A* Back     alignment and structure
>4ecm_A Glucose-1-phosphate thymidylyltransferase; HET: DAU; 2.30A {Bacillus anthracis} PDB: 3hl3_A* Back     alignment and structure
>1vgw_A 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; structural genomics, transferase; 2.35A {Neisseria gonorrhoeae} SCOP: c.68.1.13 PDB: 1vgz_A Back     alignment and structure
>4fcu_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.90A {Acinetobacter baumannii} PDB: 3pol_A Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Back     alignment and structure
>3ngw_A Molybdopterin-guanine dinucleotide biosynthesis P (MOBA); alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.31A {Archaeoglobus fulgidus} Back     alignment and structure
>3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A* Back     alignment and structure
>3q80_A 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; TB structural genomics consortium, TBSGC, rossman fold; HET: CDM; 2.00A {Mycobacterium tuberculosis} SCOP: c.68.1.0 PDB: 3q7u_A* 3okr_A 2xwn_A* Back     alignment and structure
>1w55_A ISPD/ISPF bifunctional enzyme; biosynthetic pathway, isoprenoids, nonmevalonate, transferase; HET: C GPP; 2.3A {Campylobacter jejuni} SCOP: c.68.1.13 d.79.5.1 PDB: 1w57_A* Back     alignment and structure
>3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} SCOP: c.68.1.0 Back     alignment and structure
>1fxo_A Glucose-1-phosphate thymidylyltransferase; rhamnose, nucleotidyltransferase, pyrophosphorylase, allostery; HET: TMP; 1.66A {Pseudomonas aeruginosa} SCOP: c.68.1.6 PDB: 1fzw_A 1g0r_A* 1g1l_A* 1g23_A* 1g2v_A* 1g3l_A* 1h5r_A* 1h5s_C* 1h5t_A* 1h5s_D* 1h5s_A* 1h5r_B* 1h5s_B* 1h5t_B* 1iim_A* 1iin_A* 3pkp_A* 3pkq_A* 1mp5_A* 1mp3_A* ... Back     alignment and structure
>1vic_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics; 1.80A {Haemophilus influenzae} SCOP: c.68.1.13 PDB: 1vh3_A 3duv_A* Back     alignment and structure
>2qh5_A PMI, ALGA, mannose-6-phosphate isomerase; structural genomics, PSI, protein structure initi nysgrc; 2.30A {Helicobacter pylori} Back     alignment and structure
>1e5k_A Molybdopterin-guanine dinucleotide biosynthesis protein A; molybdopterin nucleotidyl-transferase,; HET: CIT; 1.35A {Escherichia coli} SCOP: c.68.1.8 PDB: 1h4e_A* 1hjl_A* 1hjj_A* 1h4c_A* 1h4d_A* 1fr9_A 1frw_A* Back     alignment and structure
>3d5n_A Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.80A {Sulfolobus solfataricus} Back     alignment and structure
>3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ux8_A Glucose-1-phosphate uridylyltransferase; UGPG, GALU pyrophosphorylase, nucleotidyltransferase; HET: G1P; 2.65A {Sphingomonas elodea} Back     alignment and structure
>2vsh_A TARI, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; nucleotidyltransferase; HET: 1PE PG4 P6G; 2.00A {Streptococcus pneumoniae} PDB: 2vsi_A* Back     alignment and structure
>1lvw_A Glucose-1-phosphate thymidylyltransferase; protein nucleotide complex, nucleotide binding fold; HET: TYD; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.68.1.6 Back     alignment and structure
>1g9r_A Glycosyl transferase; alpha-beta structure; HET: UPF; 2.00A {Neisseria meningitidis} SCOP: c.68.1.4 PDB: 1ga8_A* 1ss9_A* Back     alignment and structure
>2xwl_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; transferase, MEP pathway; HET: CTP; 1.49A {Mycobacterium smegmatis} PDB: 2xwm_A* Back     alignment and structure
>2e8b_A Probable molybdopterin-guanine dinucleotide biosy protein A; putative protein, molybdenum cofactor, structural G NPPSFA; 1.61A {Aquifex aeolicus} Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Back     alignment and structure
>3pnn_A Conserved domain protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE GOL; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Back     alignment and structure
>2pa4_A UTP-glucose-1-phosphate uridylyltransferase; phosphorylase, nucleotidyltransferase, metabolism; HET: GUD; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2e3d_A UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose, carbohydrate, pyrophosphorylase; 1.95A {Escherichia coli} Back     alignment and structure
>1mc3_A Glucose-1-phosphate thymidylyltransferase; glucose-1-phosphate thymidylytransferase, RFFH; HET: TTP; 2.60A {Escherichia coli} SCOP: c.68.1.6 Back     alignment and structure
>2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A* Back     alignment and structure
>2i5e_A Hypothetical protein MM_2497; APC86122, methanosarcina mazei GO1, hypothetic protein, STRU genomics, PSI-2, protein structure initiative; 2.10A {Methanosarcina mazei} SCOP: c.68.1.21 Back     alignment and structure
>1ll2_A Glycogenin-1; protein-substrate complex, beta-alpha-beta rossman-like NUCL binding fold, DXD motif, non-proline CIS peptide bond, TRAN; HET: UPG; 1.90A {Oryctolagus cuniculus} SCOP: c.68.1.14 PDB: 1ll3_A 1ll0_A 1zcv_A 1zcu_A 1zdf_A* 1zcy_A 1zdg_A* Back     alignment and structure
>1vpa_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; TM1393, JCSG, joint center for structural GENO PSI, protein structure initiative; HET: CTP; 2.67A {Thermotoga maritima} SCOP: c.68.1.13 Back     alignment and structure
>3cgx_A Putative nucleotide-diphospho-sugar transferase; YP_389115.1, joint center for structural genomics; 1.90A {Desulfovibrio desulfuricans subsp} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 214
d1xhba2 328 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosa 3e-26
d2bo4a1 381 c.68.1.18 (A:2-382) Mannosylglycerate synthase, MG 3e-18
d1omza_265 c.68.1.15 (A:) Alpha-1,4-N-acetylhexosaminyltransf 1e-07
d1qg8a_255 c.68.1.1 (A:) Spore coat polysaccharide biosynthes 0.002
>d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 328 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain
domain: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain
species: Mouse (Mus musculus) [TaxId: 10090]
 Score =  101 bits (251), Expect = 3e-26
 Identities = 75/169 (44%), Positives = 110/169 (65%), Gaps = 3/169 (1%)

Query: 5   CANQTFPSTLPSTSVIICFYNEHPATLYRSVQTLLSRTGQSLLHEIILVNDFSEYPSNLH 64
           C  + +P  LP+TSV+I F+NE  +TL R+V ++++R+ + ++ EI+LV+D SE    L 
Sbjct: 12  CKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDF-LK 70

Query: 65  GEVETFVKGLNNGRVHLYRTSKREGLIRARMFGAKYATGKVLVFLDSHIEVNTHWLEPLL 124
             +E++VK L    VH+ R  +R GLIRAR+ GA  + G+V+ FLD+H E    WLEPLL
Sbjct: 71  RPLESYVKKLKV-PVHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLL 129

Query: 125 VPIAERTNTVTVPIIDIINADTFQYT-SSALVRGGFNWGLHFKWENLPK 172
             I     TV  PIID+I+ DTF+Y   S +  GGFNW L+F+W  +P+
Sbjct: 130 ARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQ 178


>d2bo4a1 c.68.1.18 (A:2-382) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]} Length = 381 Back     information, alignment and structure
>d1omza_ c.68.1.15 (A:) Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-GalNAcT EXTL2) {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1qg8a_ c.68.1.1 (A:) Spore coat polysaccharide biosynthesis protein SpsA {Bacillus subtilis [TaxId: 1423]} Length = 255 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query214
d1xhba2328 Polypeptide N-acetylgalactosaminyltransferase 1, N 100.0
d1qg8a_255 Spore coat polysaccharide biosynthesis protein Sps 99.93
d1omza_265 Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-Ga 99.9
d2bo4a1 381 Mannosylglycerate synthase, MGS {Rhodothermus mari 99.42
d1fo8a_ 343 N-acetylglucosaminyltransferase I {Rabbit (Oryctol 98.45
d1pzta_271 beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos 97.57
d1v82a_252 Beta-1,3-glucuronyltransferase 1, GlcAT-P {Human ( 97.25
d3cu0a1261 1,3-Glucuronyltransferase I (glcAT-I) {Human (Homo 96.58
d1qwja_228 CMP acylneuraminate synthetase {Mouse (Mus musculu 94.46
d1fxoa_292 RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} 94.4
d1mc3a_291 RffH {Escherichia coli [TaxId: 562]} 94.32
d1lvwa_295 RmlA (RfbA) {Archaeon Methanobacterium thermoautot 93.46
d1w77a1226 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 92.44
d1h7ea_245 CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn 91.69
d1w55a1205 IspD/IspF bifunctional enzyme, CDP-me synthase dom 91.54
d1i52a_225 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 90.36
d1e5ka_188 Molybdenum cofactor biosynthesis protein MobA {Esc 89.13
d1ga8a_282 Galactosyltransferase LgtC {Neisseria meningitidis 89.02
d1vica_255 CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn 84.17
d2dpwa1231 Uncharacterized protein TTHA0179 {Thermus thermoph 82.32
d1eyra_225 CMP acylneuraminate synthetase {Neisseria meningit 81.85
d1g97a2250 N-acetylglucosamine 1-phosphate uridyltransferase 80.56
>d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain
domain: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=4.2e-36  Score=246.30  Aligned_cols=200  Identities=39%  Similarity=0.686  Sum_probs=166.2

Q ss_pred             CCccccCCcCCCCCCceEEEEEEeCCCchHHHHHHHHHHhcCCCCCccEEEEEECCCCCCCCh-HHHHHHHHhhcCCCcE
Q psy1766           1 MSIICANQTFPSTLPSTSVIICFYNEHPATLYRSVQTLLSRTGQSLLHEIILVNDFSEYPSNL-HGEVETFVKGLNNGRV   79 (214)
Q Consensus         1 ~~~~~~~~~~~~~~p~vSVIIp~~n~~~~~l~~~l~sl~~q~~~~~~~eiivVdd~s~~~d~t-~~~~~~~~~~~~~~~v   79 (214)
                      |.+.|+..+|+++||.||||||+||+....|.+||+|+++|+++...+|||||||||+  |++ .+.++++.++. ..++
T Consensus         8 r~~~~~~~~~~~~~P~vSIIIp~yNe~~~~l~~~l~Si~~qt~~~~~~EIIvVDdgS~--d~~~~~~l~~~~~~~-~~~i   84 (328)
T d1xhba2           8 RLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASE--RDFLKRPLESYVKKL-KVPV   84 (328)
T ss_dssp             SCGGGGTCCCCSCCCCEEEEEEESSCCHHHHHHHHHHHHHSSCGGGEEEEEEEECSCC--CGGGTHHHHHHHHSS-SSCE
T ss_pred             CChhhhhccCCCCCCCEEEEEeccCCcHHHHHHHHHHHHhcCCCCCCeEEEEEECCCC--hhhHHHHHHHHHHhc-CCCe
Confidence            4578999999999999999999999873579999999999998875579999999999  554 56778877765 5689


Q ss_pred             EEEEcCCCcchHHHHHhhhhhcCCCEEEEEcCCCccCcCchHHHHHHHhcCCCEEEEeeeeeecCCcceeec-CCceeee
Q psy1766          80 HLYRTSKREGLIRARMFGAKYATGKVLVFLDSHIEVNTHWLEPLLVPIAERTNTVTVPIIDIINADTFQYTS-SALVRGG  158 (214)
Q Consensus        80 ~~i~~~~~~G~~~a~n~g~~~a~gd~i~~lD~D~~~~~~~l~~l~~~~~~~~~~vv~~~~~~~~~~~~~~~~-~~~~~g~  158 (214)
                      +++++++|.|.+.|+|.|++.|+|+||+|+|+|+.+.|+||+.++..+.+++..+++|.++.++..++.+.. .....++
T Consensus        85 ~vi~~~~n~G~~~a~N~Gi~~a~gd~i~flD~D~~~~p~~l~~l~~~~~~~~~~~v~~~~~~i~~~~~~~~~~~~~~~~~  164 (328)
T d1xhba2          85 HVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGG  164 (328)
T ss_dssp             EEEECSSCCCHHHHHHHHHHHCCSSEEEEEESSEEECTTCHHHHHHHHHHCTTEEEEEEEEEECSSSCCEECCCTTEEEE
T ss_pred             EEEEecccccchHHHHHHHHhhhcceeeecCcccccChhHHHHHHHHHhcCCCeEEecceeeeccCceeeccCCcccccc
Confidence            999999999999999999999999999999999999999999999999999999999999999998888764 4566788


Q ss_pred             eEecccceeecCCccccCCCCC------CCCCCCCccc-------hhccccccccccc
Q psy1766         159 FNWGLHFKWENLPKVKTSSNPS------YLPLQYTSSA-------LVRGGFNWGLHFK  203 (214)
Q Consensus       159 ~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~-------~~~ggf~~~~~~~  203 (214)
                      +.|.+.+.|..++.........      ..+...++++       ..+||||..+.++
T Consensus       165 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~irr~~f~~vGgfDe~~~~~  222 (328)
T d1xhba2         165 FNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIW  222 (328)
T ss_dssp             ECTTCCEEEEECCHHHHHHTTTCTTSCEECSBCCSSSEEEEHHHHHHTTSCCTTSCTT
T ss_pred             ccccccccccccchhhhhccccccccccccceecceeeeeeHHHHHHhCCCCCCCcCc
Confidence            9999988888777643221111      1133444444       3899999988654



>d1qg8a_ c.68.1.1 (A:) Spore coat polysaccharide biosynthesis protein SpsA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1omza_ c.68.1.15 (A:) Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-GalNAcT EXTL2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bo4a1 c.68.1.18 (A:2-382) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]} Back     information, alignment and structure
>d1fo8a_ c.68.1.10 (A:) N-acetylglucosaminyltransferase I {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1pzta_ c.68.1.2 (A:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v82a_ c.68.1.7 (A:) Beta-1,3-glucuronyltransferase 1, GlcAT-P {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cu0a1 c.68.1.7 (A:75-335) 1,3-Glucuronyltransferase I (glcAT-I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qwja_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1w77a1 c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d1h7ea_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KpsU [TaxId: 562]} Back     information, alignment and structure
>d1w55a1 c.68.1.13 (A:3-207) IspD/IspF bifunctional enzyme, CDP-me synthase domain {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1i52a_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5ka_ c.68.1.8 (A:) Molybdenum cofactor biosynthesis protein MobA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ga8a_ c.68.1.4 (A:) Galactosyltransferase LgtC {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1vica_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2dpwa1 c.68.1.19 (A:1-231) Uncharacterized protein TTHA0179 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1eyra_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure