Psyllid ID: psy1766
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 214 | ||||||
| 322799307 | 338 | hypothetical protein SINV_03796 [Solenop | 0.780 | 0.494 | 0.636 | 2e-58 | |
| 156544564 | 637 | PREDICTED: polypeptide N-acetylgalactosa | 0.780 | 0.262 | 0.642 | 1e-57 | |
| 340727930 | 643 | PREDICTED: polypeptide N-acetylgalactosa | 0.780 | 0.259 | 0.619 | 2e-56 | |
| 332021082 | 580 | Polypeptide N-acetylgalactosaminyltransf | 0.780 | 0.287 | 0.613 | 3e-56 | |
| 350400046 | 643 | PREDICTED: polypeptide N-acetylgalactosa | 0.780 | 0.259 | 0.601 | 7e-56 | |
| 383862333 | 637 | PREDICTED: polypeptide N-acetylgalactosa | 0.780 | 0.262 | 0.601 | 1e-55 | |
| 307186272 | 667 | Polypeptide N-acetylgalactosaminyltransf | 0.780 | 0.250 | 0.619 | 4e-55 | |
| 307198758 | 606 | Polypeptide N-acetylgalactosaminyltransf | 0.775 | 0.273 | 0.597 | 4e-54 | |
| 242020636 | 623 | UDP-GalNAc:polypeptide N-acetylgalactosa | 0.831 | 0.285 | 0.575 | 3e-53 | |
| 321469963 | 498 | hypothetical protein DAPPUDRAFT_224457 [ | 0.836 | 0.359 | 0.569 | 4e-53 |
| >gi|322799307|gb|EFZ20695.1| hypothetical protein SINV_03796 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
Score = 231 bits (588), Expect = 2e-58, Method: Compositional matrix adjust.
Identities = 107/168 (63%), Positives = 133/168 (79%), Gaps = 1/168 (0%)
Query: 4 ICANQTFPSTLPSTSVIICFYNEHPATLYRSVQTLLSRTGQSLLHEIILVNDFSEYPSNL 63
+C Q +P+ LP+ S+IICFYNEH TL RS+ T+L RT +LLHEIILVND+S+ S L
Sbjct: 157 LCGAQKYPANLPNASIIICFYNEHYTTLLRSLHTVLERTPMALLHEIILVNDYSD-SSAL 215
Query: 64 HGEVETFVKGLNNGRVHLYRTSKREGLIRARMFGAKYATGKVLVFLDSHIEVNTHWLEPL 123
H +++ +++ + RV L++T KREGLIRAR+FGA+ ATGKVL+FLDSHIEVN W+EPL
Sbjct: 216 HEKIKVYIRNNFDDRVRLFKTEKREGLIRARVFGARKATGKVLIFLDSHIEVNEMWIEPL 275
Query: 124 LVPIAERTNTVTVPIIDIINADTFQYTSSALVRGGFNWGLHFKWENLP 171
L IA N V +P+IDIINADTFQYT S LVRGGFNWGLHFKW+NLP
Sbjct: 276 LSRIAYSRNIVPMPVIDIINADTFQYTGSPLVRGGFNWGLHFKWDNLP 323
|
Source: Solenopsis invicta Species: Solenopsis invicta Genus: Solenopsis Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|156544564|ref|XP_001602677.1| PREDICTED: polypeptide N-acetylgalactosaminyltransferase 35A-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|340727930|ref|XP_003402286.1| PREDICTED: polypeptide N-acetylgalactosaminyltransferase 35A-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|332021082|gb|EGI61469.1| Polypeptide N-acetylgalactosaminyltransferase 35A [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|350400046|ref|XP_003485719.1| PREDICTED: polypeptide N-acetylgalactosaminyltransferase 35A-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|383862333|ref|XP_003706638.1| PREDICTED: polypeptide N-acetylgalactosaminyltransferase 35A-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|307186272|gb|EFN71935.1| Polypeptide N-acetylgalactosaminyltransferase 35A [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|307198758|gb|EFN79561.1| Polypeptide N-acetylgalactosaminyltransferase 35A [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|242020636|ref|XP_002430758.1| UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase, putative [Pediculus humanus corporis] gi|212515955|gb|EEB18020.1| UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|321469963|gb|EFX80941.1| hypothetical protein DAPPUDRAFT_224457 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 214 | ||||||
| UNIPROTKB|F1P800 | 608 | GALNT11 "Uncharacterized prote | 0.915 | 0.322 | 0.505 | 6e-48 | |
| UNIPROTKB|E1BDW8 | 606 | GALNT11 "Uncharacterized prote | 0.775 | 0.273 | 0.544 | 3e-46 | |
| UNIPROTKB|B7Z5G5 | 527 | GALNT11 "cDNA FLJ58212, highly | 0.775 | 0.314 | 0.550 | 3e-46 | |
| UNIPROTKB|Q8NCW6 | 608 | GALNT11 "Polypeptide N-acetylg | 0.775 | 0.273 | 0.550 | 3e-46 | |
| FB|FBgn0001970 | 632 | Pgant35A "Polypeptide N-acetyl | 0.775 | 0.262 | 0.551 | 1e-45 | |
| UNIPROTKB|E1BYU3 | 608 | GALNT11 "Uncharacterized prote | 0.775 | 0.273 | 0.580 | 1e-45 | |
| MGI|MGI:2444392 | 608 | Galnt11 "UDP-N-acetyl-alpha-D- | 0.887 | 0.312 | 0.494 | 1e-45 | |
| RGD|735097 | 608 | Galnt11 "UDP-N-acetyl-alpha-D- | 0.775 | 0.273 | 0.544 | 1e-45 | |
| UNIPROTKB|F1SSN4 | 608 | GALNT11 "Uncharacterized prote | 0.775 | 0.273 | 0.538 | 2.1e-45 | |
| ZFIN|ZDB-GENE-060929-998 | 590 | galnt11 "UDP-N-acetyl-alpha-D- | 0.803 | 0.291 | 0.526 | 5.6e-45 |
| UNIPROTKB|F1P800 GALNT11 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Score = 501 (181.4 bits), Expect = 6.0e-48, P = 6.0e-48
Identities = 100/198 (50%), Positives = 132/198 (66%)
Query: 5 CANQTFPSTLPSTSVIICFYNEHPATLYRSVQTLLSRTGQSLLHEIILVNDFSEYPSNLH 64
C +++FP+ LP+ SV+ICFYNE + L R+V ++L RT LLHEIILV+D S++ +L
Sbjct: 141 CRDKSFPADLPAASVVICFYNEALSALLRTVHSVLDRTPAQLLHEIILVDDDSDF-DDLK 199
Query: 65 GEVETFVKGLNNGRVHLYRTSKREGLIRARMFGAKYATGKVLVFLDSHIEVNTHWLEPLL 124
GE+E +V+ G++ + R KREGLIR RM GA +ATG+VLVFLDSH EVN WL+PLL
Sbjct: 200 GELEEYVQKYLPGKIKVIRNIKREGLIRGRMIGAAHATGEVLVFLDSHCEVNVMWLQPLL 259
Query: 125 VPIAERTNTVTVPIIDIINADTFQYTSSALVRGGFNWGLHFKWENLPKVKTSSNPSYLPL 184
I E TV P+IDII+ADT Y+SS +VRGGFNWGLHFKW+ +P + P
Sbjct: 260 AAIQEDQQTVVCPVIDIISADTLAYSSSPVVRGGFNWGLHFKWDLVP-LSELGGPEGATA 318
Query: 185 QYTSSALVRGGFNWGLHF 202
S + G F H+
Sbjct: 319 PIKSPTMAGGLFAMNRHY 336
|
|
| UNIPROTKB|E1BDW8 GALNT11 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B7Z5G5 GALNT11 "cDNA FLJ58212, highly similar to PolypeptideN-acetylgalactosaminyltransferase 11 (EC 2.4.1.41)" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8NCW6 GALNT11 "Polypeptide N-acetylgalactosaminyltransferase 11" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0001970 Pgant35A "Polypeptide N-acetylgalactosaminyltransferase 35A" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BYU3 GALNT11 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2444392 Galnt11 "UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 11" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|735097 Galnt11 "UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 11 (GalNAc-T11)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SSN4 GALNT11 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060929-998 galnt11 "UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 11 (GalNAc-T11)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 214 | |||
| cd02510 | 299 | cd02510, pp-GalNAc-T, pp-GalNAc-T initiates the fo | 3e-71 | |
| pfam00535 | 168 | pfam00535, Glycos_transf_2, Glycosyl transferase f | 6e-25 | |
| cd00761 | 156 | cd00761, Glyco_tranf_GTA_type, Glycosyltransferase | 3e-12 | |
| COG0463 | 291 | COG0463, WcaA, Glycosyltransferases involved in ce | 3e-10 | |
| TIGR03965 | 467 | TIGR03965, mycofact_glyco, mycofactocin system gly | 3e-10 | |
| COG1215 | 439 | COG1215, COG1215, Glycosyltransferases, probably i | 1e-09 | |
| COG1216 | 305 | COG1216, COG1216, Predicted glycosyltransferases [ | 7e-06 | |
| cd04179 | 185 | cd04179, DPM_DPG-synthase_like, DPM_DPG-synthase_l | 4e-05 | |
| cd06434 | 235 | cd06434, GT2_HAS, Hyaluronan synthases catalyze po | 2e-04 | |
| cd04192 | 229 | cd04192, GT_2_like_e, Subfamily of Glycosyltransfe | 2e-04 | |
| cd04186 | 166 | cd04186, GT_2_like_c, Subfamily of Glycosyltransfe | 5e-04 | |
| cd04188 | 211 | cd04188, DPG_synthase, DPG_synthase is involved in | 8e-04 | |
| cd04187 | 181 | cd04187, DPM1_like_bac, Bacterial DPM1_like enzyme | 0.003 |
| >gnl|CDD|133004 cd02510, pp-GalNAc-T, pp-GalNAc-T initiates the formation of mucin-type O-linked glycans | Back alignment and domain information |
|---|
Score = 218 bits (558), Expect = 3e-71
Identities = 93/179 (51%), Positives = 117/179 (65%), Gaps = 6/179 (3%)
Query: 18 SVIICFYNEHPATLYRSVQTLLSRTGQSLLHEIILVNDFSEYPSNLHGEVETFVKGLNNG 77
SVII F+NE +TL R+V ++++RT LL EIILV+DFS+ P L +E + K
Sbjct: 1 SVIIIFHNEALSTLLRTVHSVINRTPPELLKEIILVDDFSDKP-ELKLLLEEYYKKYL-P 58
Query: 78 RVHLYRTSKREGLIRARMFGAKYATGKVLVFLDSHIEVNTHWLEPLLVPIAERTNTVTVP 137
+V + R KREGLIRAR+ GA+ ATG VLVFLDSH EVN WLEPLL IAE TV P
Sbjct: 59 KVKVLRLKKREGLIRARIAGARAATGDVLVFLDSHCEVNVGWLEPLLARIAENRKTVVCP 118
Query: 138 IIDIINADTFQY-TSSALVRGGFNWGLHFKWENLPKVKTSSNPSYLPLQYTSSALVRGG 195
IID+I+ADTF+Y SS RGGF+W LHFKW LP+ + P++ S + GG
Sbjct: 119 IIDVIDADTFEYRGSSGDARGGFDWSLHFKWLPLPEEERRRESPTAPIR---SPTMAGG 174
|
UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferases (pp-GalNAc-T) initiate the formation of mucin-type, O-linked glycans by catalyzing the transfer of alpha-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to hydroxyl groups of Ser or Thr residues of core proteins to form the Tn antigen (GalNAc-a-1-O-Ser/Thr). These enzymes are type II membrane proteins with a GT-A type catalytic domain and a lectin domain located on the lumen side of the Golgi apparatus. In human, there are 15 isozymes of pp-GalNAc-Ts, representing the largest of all glycosyltransferase families. Each isozyme has unique but partially redundant substrate specificity for glycosylation sites on acceptor proteins. Length = 299 |
| >gnl|CDD|215980 pfam00535, Glycos_transf_2, Glycosyl transferase family 2 | Back alignment and domain information |
|---|
| >gnl|CDD|132997 cd00761, Glyco_tranf_GTA_type, Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold | Back alignment and domain information |
|---|
| >gnl|CDD|223539 COG0463, WcaA, Glycosyltransferases involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|234419 TIGR03965, mycofact_glyco, mycofactocin system glycosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224137 COG1216, COG1216, Predicted glycosyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|133022 cd04179, DPM_DPG-synthase_like, DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|133056 cd06434, GT2_HAS, Hyaluronan synthases catalyze polymerization of hyaluronan | Back alignment and domain information |
|---|
| >gnl|CDD|133035 cd04192, GT_2_like_e, Subfamily of Glycosyltransferase Family GT2 of unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|133029 cd04186, GT_2_like_c, Subfamily of Glycosyltransferase Family GT2 of unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|133031 cd04188, DPG_synthase, DPG_synthase is involved in protein N-linked glycosylation | Back alignment and domain information |
|---|
| >gnl|CDD|133030 cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| KOG3738|consensus | 559 | 99.97 | ||
| cd02510 | 299 | pp-GalNAc-T pp-GalNAc-T initiates the formation of | 99.97 | |
| KOG3736|consensus | 578 | 99.96 | ||
| KOG3737|consensus | 603 | 99.95 | ||
| PRK10073 | 328 | putative glycosyl transferase; Provisional | 99.93 | |
| PRK10018 | 279 | putative glycosyl transferase; Provisional | 99.92 | |
| cd04184 | 202 | GT2_RfbC_Mx_like Myxococcus xanthus RfbC like prot | 99.91 | |
| TIGR03469 | 384 | HonB hopene-associated glycosyltransferase HpnB. T | 99.91 | |
| PF00535 | 169 | Glycos_transf_2: Glycosyl transferase family 2; In | 99.91 | |
| cd02520 | 196 | Glucosylceramide_synthase Glucosylceramide synthas | 99.9 | |
| cd06427 | 241 | CESA_like_2 CESA_like_2 is a member of the cellulo | 99.9 | |
| PLN02726 | 243 | dolichyl-phosphate beta-D-mannosyltransferase | 99.9 | |
| TIGR03111 | 439 | glyc2_xrt_Gpos1 putative glycosyltransferase TIGR0 | 99.9 | |
| cd04195 | 201 | GT2_AmsE_like GT2_AmsE_like is involved in exopoly | 99.9 | |
| cd06437 | 232 | CESA_CaSu_A2 Cellulose synthase catalytic subunit | 99.89 | |
| cd06439 | 251 | CESA_like_1 CESA_like_1 is a member of the cellulo | 99.89 | |
| cd04196 | 214 | GT_2_like_d Subfamily of Glycosyltransferase Famil | 99.89 | |
| cd06913 | 219 | beta3GnTL1_like Beta 1, 3-N-acetylglucosaminyltran | 99.89 | |
| PRK10063 | 248 | putative glycosyl transferase; Provisional | 99.88 | |
| PRK11204 | 420 | N-glycosyltransferase; Provisional | 99.88 | |
| cd06421 | 234 | CESA_CelA_like CESA_CelA_like are involved in the | 99.88 | |
| cd06433 | 202 | GT_2_WfgS_like WfgS and WfeV are involved in O-ant | 99.88 | |
| PRK14583 | 444 | hmsR N-glycosyltransferase; Provisional | 99.88 | |
| TIGR03472 | 373 | HpnI hopanoid biosynthesis associated glycosyl tra | 99.88 | |
| cd06442 | 224 | DPM1_like DPM1_like represents putative enzymes si | 99.87 | |
| cd02525 | 249 | Succinoglycan_BP_ExoA ExoA is involved in the bios | 99.87 | |
| cd04187 | 181 | DPM1_like_bac Bacterial DPM1_like enzymes are rela | 99.87 | |
| PRK10714 | 325 | undecaprenyl phosphate 4-deoxy-4-formamido-L-arabi | 99.87 | |
| cd06423 | 180 | CESA_like CESA_like is the cellulose synthase supe | 99.87 | |
| cd04179 | 185 | DPM_DPG-synthase_like DPM_DPG-synthase_like is a m | 99.86 | |
| cd04185 | 202 | GT_2_like_b Subfamily of Glycosyltransferase Famil | 99.86 | |
| PTZ00260 | 333 | dolichyl-phosphate beta-glucosyltransferase; Provi | 99.86 | |
| cd04192 | 229 | GT_2_like_e Subfamily of Glycosyltransferase Famil | 99.86 | |
| cd04188 | 211 | DPG_synthase DPG_synthase is involved in protein N | 99.86 | |
| KOG2978|consensus | 238 | 99.85 | ||
| cd02522 | 221 | GT_2_like_a GT_2_like_a represents a glycosyltrans | 99.85 | |
| cd06435 | 236 | CESA_NdvC_like NdvC_like proteins in this family a | 99.85 | |
| COG1216 | 305 | Predicted glycosyltransferases [General function p | 99.84 | |
| PF13641 | 228 | Glyco_tranf_2_3: Glycosyltransferase like family 2 | 99.84 | |
| cd06420 | 182 | GT2_Chondriotin_Pol_N N-terminal domain of Chondro | 99.84 | |
| cd06434 | 235 | GT2_HAS Hyaluronan synthases catalyze polymerizati | 99.83 | |
| cd06438 | 183 | EpsO_like EpsO protein participates in the methano | 99.83 | |
| PRK13915 | 306 | putative glucosyl-3-phosphoglycerate synthase; Pro | 99.83 | |
| cd04186 | 166 | GT_2_like_c Subfamily of Glycosyltransferase Famil | 99.83 | |
| cd02511 | 229 | Beta4Glucosyltransferase UDP-glucose LOS-beta-1,4 | 99.82 | |
| cd06436 | 191 | GlcNAc-1-P_transferase N-acetyl-glucosamine transf | 99.82 | |
| cd02526 | 237 | GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl tr | 99.82 | |
| COG0463 | 291 | WcaA Glycosyltransferases involved in cell wall bi | 99.8 | |
| PRK11498 | 852 | bcsA cellulose synthase catalytic subunit; Provisi | 99.8 | |
| TIGR03030 | 713 | CelA cellulose synthase catalytic subunit (UDP-for | 99.8 | |
| PF10111 | 281 | Glyco_tranf_2_2: Glycosyltransferase like family 2 | 99.79 | |
| COG1215 | 439 | Glycosyltransferases, probably involved in cell wa | 99.78 | |
| TIGR01556 | 281 | rhamnosyltran L-rhamnosyltransferase. Rhamnolipids | 99.77 | |
| cd04190 | 244 | Chitin_synth_C C-terminal domain of Chitin Synthas | 99.67 | |
| cd04191 | 254 | Glucan_BSP_ModH Glucan_BSP_ModH catalyzes the elon | 99.66 | |
| PRK14716 | 504 | bacteriophage N4 adsorption protein B; Provisional | 99.66 | |
| cd00761 | 156 | Glyco_tranf_GTA_type Glycosyltransferase family A | 99.6 | |
| KOG2977|consensus | 323 | 99.58 | ||
| PRK11234 | 727 | nfrB bacteriophage N4 adsorption protein B; Provis | 99.58 | |
| PRK05454 | 691 | glucosyltransferase MdoH; Provisional | 99.52 | |
| PRK15489 | 703 | nfrB bacteriophage N4 adsorption protein B; Provis | 99.43 | |
| cd02514 | 334 | GT13_GLCNAC-TI GT13_GLCNAC-TI is involved in an es | 99.32 | |
| KOG2547|consensus | 431 | 98.94 | ||
| PF13712 | 217 | Glyco_tranf_2_5: Glycosyltransferase like family; | 98.79 | |
| PF13704 | 97 | Glyco_tranf_2_4: Glycosyl transferase family 2 | 98.32 | |
| PF03452 | 269 | Anp1: Anp1; InterPro: IPR005109 The members of thi | 98.22 | |
| PF03071 | 434 | GNT-I: GNT-I family; InterPro: IPR004139 The biosy | 98.06 | |
| COG4092 | 346 | Predicted glycosyltransferase involved in capsule | 97.92 | |
| KOG3588|consensus | 494 | 97.9 | ||
| PF03142 | 527 | Chitin_synth_2: Chitin synthase; InterPro: IPR0048 | 97.8 | |
| PF13506 | 175 | Glyco_transf_21: Glycosyl transferase family 21 | 97.71 | |
| PF09488 | 381 | Osmo_MPGsynth: Mannosyl-3-phosphoglycerate synthas | 97.56 | |
| PF06306 | 347 | CgtA: Beta-1,4-N-acetylgalactosaminyltransferase ( | 97.4 | |
| COG2943 | 736 | MdoH Membrane glycosyltransferase [Cell envelope b | 97.38 | |
| PRK14503 | 393 | mannosyl-3-phosphoglycerate synthase; Provisional | 97.35 | |
| TIGR02460 | 381 | osmo_MPGsynth mannosyl-3-phosphoglycerate synthase | 97.35 | |
| PF05679 | 499 | CHGN: Chondroitin N-acetylgalactosaminyltransferas | 97.34 | |
| PF11316 | 234 | Rhamno_transf: Putative rhamnosyl transferase ; In | 97.3 | |
| cd00218 | 223 | GlcAT-I Beta1,3-glucuronyltransferase I (GlcAT-I) | 97.1 | |
| PLN02458 | 346 | transferase, transferring glycosyl groups | 96.86 | |
| PF13733 | 136 | Glyco_transf_7N: N-terminal region of glycosyl tra | 96.83 | |
| PF09258 | 247 | Glyco_transf_64: Glycosyl transferase family 64 do | 96.8 | |
| PRK14502 | 694 | bifunctional mannosyl-3-phosphoglycerate synthase/ | 96.71 | |
| PF03214 | 348 | RGP: Reversibly glycosylated polypeptide; InterPro | 96.61 | |
| cd04182 | 186 | GT_2_like_f GT_2_like_f is a subfamily of the glyc | 96.55 | |
| KOG1476|consensus | 330 | 96.47 | ||
| PLN02893 | 734 | Cellulose synthase-like protein | 96.38 | |
| PRK00317 | 193 | mobA molybdopterin-guanine dinucleotide biosynthes | 96.38 | |
| PF12804 | 160 | NTP_transf_3: MobA-like NTP transferase domain; PD | 96.25 | |
| TIGR03310 | 188 | matur_ygfJ molybdenum hydroxylase accessory protei | 96.2 | |
| cd00899 | 219 | b4GalT Beta-4-Galactosyltransferase is involved in | 96.15 | |
| PF04666 | 297 | Glyco_transf_54: N-Acetylglucosaminyltransferase-I | 96.13 | |
| KOG1413|consensus | 411 | 96.06 | ||
| PF13632 | 193 | Glyco_trans_2_3: Glycosyl transferase family group | 96.04 | |
| TIGR03202 | 190 | pucB xanthine dehydrogenase accessory protein pucB | 95.98 | |
| PF11735 | 241 | CAP59_mtransfer: Cryptococcal mannosyltransferase | 95.94 | |
| KOG3916|consensus | 372 | 95.78 | ||
| PF11397 | 343 | GlcNAc: Glycosyltransferase (GlcNAc); InterPro: IP | 95.72 | |
| cd02540 | 229 | GT2_GlmU_N_bac N-terminal domain of bacterial GlmU | 95.7 | |
| cd02503 | 181 | MobA MobA catalyzes the formation of molybdopterin | 95.43 | |
| COG1209 | 286 | RfbA dTDP-glucose pyrophosphorylase [Cell envelope | 95.41 | |
| PLN02917 | 293 | CMP-KDO synthetase | 95.4 | |
| PRK00155 | 227 | ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl | 95.3 | |
| cd04181 | 217 | NTP_transferase NTP_transferases catalyze the tran | 95.18 | |
| PF01697 | 285 | Glyco_transf_92: Glycosyltransferase family 92; In | 94.77 | |
| cd06915 | 223 | NTP_transferase_WcbM_like WcbM_like is a subfamily | 94.69 | |
| COG1213 | 239 | Predicted sugar nucleotidyltransferases [Cell enve | 94.65 | |
| PRK13368 | 238 | 3-deoxy-manno-octulosonate cytidylyltransferase; P | 94.6 | |
| PF00483 | 248 | NTP_transferase: Nucleotidyl transferase This Pros | 94.54 | |
| cd06422 | 221 | NTP_transferase_like_1 NTP_transferase_like_1 is a | 94.49 | |
| cd02518 | 233 | GT2_SpsF SpsF is a glycosyltrnasferase implicated | 94.47 | |
| PRK05450 | 245 | 3-deoxy-manno-octulosonate cytidylyltransferase; P | 94.45 | |
| cd06431 | 280 | GT8_LARGE_C LARGE catalytic domain has closest hom | 94.32 | |
| cd00505 | 246 | Glyco_transf_8 Members of glycosyltransferase fami | 94.31 | |
| cd02513 | 223 | CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N- | 94.28 | |
| TIGR02665 | 186 | molyb_mobA molybdopterin-guanine dinucleotide bios | 94.21 | |
| cd06425 | 233 | M1P_guanylylT_B_like_N N-terminal domain of the M1 | 94.18 | |
| cd06428 | 257 | M1P_guanylylT_A_like_N N-terminal domain of M1P_gu | 94.15 | |
| PLN03180 | 346 | reversibly glycosylated polypeptide; Provisional | 94.11 | |
| PRK09382 | 378 | ispDF bifunctional 2-C-methyl-D-erythritol 4-phosp | 94.11 | |
| PRK15480 | 292 | glucose-1-phosphate thymidylyltransferase RfbA; Pr | 94.08 | |
| TIGR03552 | 195 | F420_cofC 2-phospho-L-lactate guanylyltransferase | 94.04 | |
| cd02516 | 218 | CDP-ME_synthetase CDP-ME synthetase is involved in | 93.95 | |
| PRK14353 | 446 | glmU bifunctional N-acetylglucosamine-1-phosphate | 93.9 | |
| PRK13385 | 230 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans | 93.77 | |
| PRK02726 | 200 | molybdopterin-guanine dinucleotide biosynthesis pr | 93.58 | |
| cd04189 | 236 | G1P_TT_long G1P_TT_long represents the long form o | 93.36 | |
| PF13896 | 317 | Glyco_transf_49: Glycosyl-transferase for dystrogl | 93.13 | |
| cd02509 | 274 | GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransf | 93.02 | |
| PRK14355 | 459 | glmU bifunctional N-acetylglucosamine-1-phosphate | 92.81 | |
| TIGR00453 | 217 | ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl | 92.73 | |
| COG2068 | 199 | Uncharacterized MobA-related protein [General func | 92.23 | |
| PRK14360 | 450 | glmU bifunctional N-acetylglucosamine-1-phosphate | 92.22 | |
| cd04183 | 231 | GT2_BcE_like GT2_BcbE_like is likely involved in t | 92.22 | |
| PF03360 | 207 | Glyco_transf_43: Glycosyltransferase family 43; In | 92.14 | |
| PLN02189 | 1040 | cellulose synthase | 91.99 | |
| TIGR01207 | 286 | rmlA glucose-1-phosphate thymidylyltransferase, sh | 91.75 | |
| TIGR03584 | 222 | PseF pseudaminic acid CMP-transferase. The sequenc | 91.74 | |
| COG1211 | 230 | IspD 4-diphosphocytidyl-2-methyl-D-erithritol synt | 91.68 | |
| cd04194 | 248 | GT8_A4GalT_like A4GalT_like proteins catalyze the | 91.62 | |
| COG1208 | 358 | GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas | 91.5 | |
| PF01501 | 250 | Glyco_transf_8: Glycosyl transferase family 8; Int | 91.19 | |
| PRK14352 | 482 | glmU bifunctional N-acetylglucosamine-1-phosphate | 91.11 | |
| cd02517 | 239 | CMP-KDO-Synthetase CMP-KDO synthetase catalyzes th | 91.02 | |
| TIGR01173 | 451 | glmU UDP-N-acetylglucosamine diphosphorylase/gluco | 91.02 | |
| cd02508 | 200 | ADP_Glucose_PP ADP-glucose pyrophosphorylase is in | 90.92 | |
| cd06426 | 220 | NTP_transferase_like_2 NTP_trnasferase_like_2 is a | 90.56 | |
| cd02538 | 240 | G1P_TT_short G1P_TT_short is the short form of glu | 90.54 | |
| PRK14358 | 481 | glmU bifunctional N-acetylglucosamine-1-phosphate | 90.34 | |
| cd02524 | 253 | G1P_cytidylyltransferase G1P_cytidylyltransferase | 90.25 | |
| PRK14357 | 448 | glmU bifunctional N-acetylglucosamine-1-phosphate | 90.19 | |
| PRK14489 | 366 | putative bifunctional molybdopterin-guanine dinucl | 90.17 | |
| PRK14356 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 89.46 | |
| TIGR00454 | 183 | conserved hypothetical protein TIGR00454. At this | 89.34 | |
| KOG2571|consensus | 862 | 89.27 | ||
| PF09837 | 122 | DUF2064: Uncharacterized protein conserved in bact | 89.09 | |
| PLN02190 | 756 | cellulose synthase-like protein | 89.01 | |
| PF05060 | 356 | MGAT2: N-acetylglucosaminyltransferase II (MGAT2); | 88.85 | |
| PRK15171 | 334 | lipopolysaccharide 1,3-galactosyltransferase; Prov | 88.83 | |
| PLN02638 | 1079 | cellulose synthase A (UDP-forming), catalytic subu | 88.6 | |
| COG0746 | 192 | MobA Molybdopterin-guanine dinucleotide biosynthes | 88.55 | |
| KOG1022|consensus | 691 | 88.49 | ||
| PF02348 | 217 | CTP_transf_3: Cytidylyltransferase; InterPro: IPR0 | 88.48 | |
| TIGR01105 | 297 | galF UTP-glucose-1-phosphate uridylyltransferase, | 88.48 | |
| cd02523 | 229 | PC_cytidylyltransferase Phosphocholine cytidylyltr | 88.45 | |
| PRK14354 | 458 | glmU bifunctional N-acetylglucosamine-1-phosphate | 87.9 | |
| cd02541 | 267 | UGPase_prokaryotic Prokaryotic UGPase catalyses th | 87.9 | |
| cd04198 | 214 | eIF-2B_gamma_N The N-terminal domain of gamma subu | 87.48 | |
| PLN02728 | 252 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans | 87.25 | |
| TIGR00466 | 238 | kdsB 3-deoxy-D-manno-octulosonate cytidylyltransfe | 87.14 | |
| PRK00576 | 178 | molybdopterin-guanine dinucleotide biosynthesis pr | 87.13 | |
| TIGR01099 | 260 | galU UTP-glucose-1-phosphate uridylyltransferase. | 86.68 | |
| PRK09451 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 86.07 | |
| TIGR02623 | 254 | G1P_cyt_trans glucose-1-phosphate cytidylyltransfe | 85.79 | |
| COG1207 | 460 | GlmU N-acetylglucosamine-1-phosphate uridyltransfe | 85.73 | |
| cd06432 | 248 | GT8_HUGT1_C_like The C-terminal domain of HUGT1-li | 84.97 | |
| PLN02195 | 977 | cellulose synthase A | 83.84 | |
| TIGR01208 | 353 | rmlA_long glucose-1-phosphate thymidylylransferase | 83.29 | |
| PF02485 | 244 | Branch: Core-2/I-Branching enzyme; InterPro: IPR00 | 82.77 | |
| COG1210 | 291 | GalU UDP-glucose pyrophosphorylase [Cell envelope | 82.7 |
| >KOG3738|consensus | Back alignment and domain information |
|---|
Probab=99.97 E-value=1.4e-31 Score=217.81 Aligned_cols=167 Identities=49% Similarity=0.813 Sum_probs=153.2
Q ss_pred ccCCcCCCCCCceEEEEEEeCCCchHHHHHHHHHHhcCCCCCccEEEEEECCCCCCCChHHHHHHHHhhcCCCcEEEEEc
Q psy1766 5 CANQTFPSTLPSTSVIICFYNEHPATLYRSVQTLLSRTGQSLLHEIILVNDFSEYPSNLHGEVETFVKGLNNGRVHLYRT 84 (214)
Q Consensus 5 ~~~~~~~~~~p~vSVIIp~~n~~~~~l~~~l~sl~~q~~~~~~~eiivVdd~s~~~d~t~~~~~~~~~~~~~~~v~~i~~ 84 (214)
|....|...||..||||..+||+...|.+++.|++++++.+...|||+|||+|.| .+....+.++ ++++++++
T Consensus 114 C~~~~y~~dlp~TsviITfHNEARS~LLRTv~SvlnrsP~~li~EiILVDD~S~D-ped~~~L~ri------~kvr~LRN 186 (559)
T KOG3738|consen 114 CRDVDYKVDLPPTSVIITFHNEARSTLLRTVVSVLNRSPEHLIHEIILVDDFSQD-PEDGKLLKRI------PKVRVLRN 186 (559)
T ss_pred cccceeecCCCCceEEEEeccHHHHHHHHHHHHHHcCChHHhhheeEEecCCCCC-hHHHHHHhhh------heeeeecc
Confidence 8888999999999999999999989999999999999999988999999999996 3344444443 79999999
Q ss_pred CCCcchHHHHHhhhhhcCCCEEEEEcCCCccCcCchHHHHHHHhcCCCEEEEeeeeeecCCcceeec-CCceeeeeEecc
Q psy1766 85 SKREGLIRARMFGAKYATGKVLVFLDSHIEVNTHWLEPLLVPIAERTNTVTVPIIDIINADTFQYTS-SALVRGGFNWGL 163 (214)
Q Consensus 85 ~~~~G~~~a~n~g~~~a~gd~i~~lD~D~~~~~~~l~~l~~~~~~~~~~vv~~~~~~~~~~~~~~~~-~~~~~g~~~~~~ 163 (214)
+++.|.-..|+.|+..|++.++.|||+.+.+..+||+.|++.+.++...||+|++|+|+-++|.|.+ +...+|||+|++
T Consensus 187 ~~ReGLirSRvrGAdvA~a~vltFLDSHcEvN~~WLePLL~Rvaed~trvVsPiiDvIn~dnf~Y~~asadLrGGFDWsL 266 (559)
T KOG3738|consen 187 NEREGLIRSRVRGADVAQATVLTFLDSHCEVNEGWLEPLLERVAEDTTRVVSPIIDVINLDNFSYVGASADLRGGFDWSL 266 (559)
T ss_pred cchhhhhhhhccccccccceEEEEEecceeecchhhHHHHHHHhhcccceeecccccccccccccccchhhhcCCcceEE
Confidence 9999999999999999999999999999999999999999999999999999999999999999985 567899999999
Q ss_pred cceeecCCccccCCC
Q psy1766 164 HFKWENLPKVKTSSN 178 (214)
Q Consensus 164 ~~~~~~~~~~~~~~~ 178 (214)
+|+|..++.+....+
T Consensus 267 hF~We~~~~eqr~sr 281 (559)
T KOG3738|consen 267 HFKWEQMQLEQRESR 281 (559)
T ss_pred EEEehhcCHHHHhhc
Confidence 999999998776655
|
|
| >cd02510 pp-GalNAc-T pp-GalNAc-T initiates the formation of mucin-type O-linked glycans | Back alignment and domain information |
|---|
| >KOG3736|consensus | Back alignment and domain information |
|---|
| >KOG3737|consensus | Back alignment and domain information |
|---|
| >PRK10073 putative glycosyl transferase; Provisional | Back alignment and domain information |
|---|
| >PRK10018 putative glycosyl transferase; Provisional | Back alignment and domain information |
|---|
| >cd04184 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis | Back alignment and domain information |
|---|
| >TIGR03469 HonB hopene-associated glycosyltransferase HpnB | Back alignment and domain information |
|---|
| >PF00535 Glycos_transf_2: Glycosyl transferase family 2; InterPro: IPR001173 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >cd02520 Glucosylceramide_synthase Glucosylceramide synthase catalyzes the first glycosylation step of glycosphingolipid synthesis | Back alignment and domain information |
|---|
| >cd06427 CESA_like_2 CESA_like_2 is a member of the cellulose synthase superfamily | Back alignment and domain information |
|---|
| >PLN02726 dolichyl-phosphate beta-D-mannosyltransferase | Back alignment and domain information |
|---|
| >TIGR03111 glyc2_xrt_Gpos1 putative glycosyltransferase TIGR03111 | Back alignment and domain information |
|---|
| >cd04195 GT2_AmsE_like GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis | Back alignment and domain information |
|---|
| >cd06437 CESA_CaSu_A2 Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex | Back alignment and domain information |
|---|
| >cd06439 CESA_like_1 CESA_like_1 is a member of the cellulose synthase (CESA) superfamily | Back alignment and domain information |
|---|
| >cd04196 GT_2_like_d Subfamily of Glycosyltransferase Family GT2 of unknown function | Back alignment and domain information |
|---|
| >cd06913 beta3GnTL1_like Beta 1, 3-N-acetylglucosaminyltransferase is essential for the formation of poly-N-acetyllactosamine | Back alignment and domain information |
|---|
| >PRK10063 putative glycosyl transferase; Provisional | Back alignment and domain information |
|---|
| >PRK11204 N-glycosyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd06421 CESA_CelA_like CESA_CelA_like are involved in the elongation of the glucan chain of cellulose | Back alignment and domain information |
|---|
| >cd06433 GT_2_WfgS_like WfgS and WfeV are involved in O-antigen biosynthesis | Back alignment and domain information |
|---|
| >PRK14583 hmsR N-glycosyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03472 HpnI hopanoid biosynthesis associated glycosyl transferase protein HpnI | Back alignment and domain information |
|---|
| >cd06442 DPM1_like DPM1_like represents putative enzymes similar to eukaryotic DPM1 | Back alignment and domain information |
|---|
| >cd02525 Succinoglycan_BP_ExoA ExoA is involved in the biosynthesis of succinoglycan | Back alignment and domain information |
|---|
| >cd04187 DPM1_like_bac Bacterial DPM1_like enzymes are related to eukaryotic DPM1 | Back alignment and domain information |
|---|
| >PRK10714 undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose transferase; Provisional | Back alignment and domain information |
|---|
| >cd06423 CESA_like CESA_like is the cellulose synthase superfamily | Back alignment and domain information |
|---|
| >cd04179 DPM_DPG-synthase_like DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily | Back alignment and domain information |
|---|
| >cd04185 GT_2_like_b Subfamily of Glycosyltransferase Family GT2 of unknown function | Back alignment and domain information |
|---|
| >PTZ00260 dolichyl-phosphate beta-glucosyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04192 GT_2_like_e Subfamily of Glycosyltransferase Family GT2 of unknown function | Back alignment and domain information |
|---|
| >cd04188 DPG_synthase DPG_synthase is involved in protein N-linked glycosylation | Back alignment and domain information |
|---|
| >KOG2978|consensus | Back alignment and domain information |
|---|
| >cd02522 GT_2_like_a GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function | Back alignment and domain information |
|---|
| >cd06435 CESA_NdvC_like NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase | Back alignment and domain information |
|---|
| >COG1216 Predicted glycosyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PF13641 Glyco_tranf_2_3: Glycosyltransferase like family 2; PDB: 4FIY_B 4FIX_A | Back alignment and domain information |
|---|
| >cd06420 GT2_Chondriotin_Pol_N N-terminal domain of Chondroitin polymerase functions as a GalNAc transferase | Back alignment and domain information |
|---|
| >cd06434 GT2_HAS Hyaluronan synthases catalyze polymerization of hyaluronan | Back alignment and domain information |
|---|
| >cd06438 EpsO_like EpsO protein participates in the methanolan synthesis | Back alignment and domain information |
|---|
| >PRK13915 putative glucosyl-3-phosphoglycerate synthase; Provisional | Back alignment and domain information |
|---|
| >cd04186 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 of unknown function | Back alignment and domain information |
|---|
| >cd02511 Beta4Glucosyltransferase UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide | Back alignment and domain information |
|---|
| >cd06436 GlcNAc-1-P_transferase N-acetyl-glucosamine transferase is involved in the synthesis of Poly-beta-1,6-N-acetyl-D-glucosamine | Back alignment and domain information |
|---|
| >cd02526 GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl transferase | Back alignment and domain information |
|---|
| >COG0463 WcaA Glycosyltransferases involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK11498 bcsA cellulose synthase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03030 CelA cellulose synthase catalytic subunit (UDP-forming) | Back alignment and domain information |
|---|
| >PF10111 Glyco_tranf_2_2: Glycosyltransferase like family 2; InterPro: IPR019290 This conserved domain is found in a set of prokaryotic proteins including putative glucosyltransferases, which are involved in bacterial capsule biosynthesis [, ] | Back alignment and domain information |
|---|
| >COG1215 Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR01556 rhamnosyltran L-rhamnosyltransferase | Back alignment and domain information |
|---|
| >cd04190 Chitin_synth_C C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin | Back alignment and domain information |
|---|
| >cd04191 Glucan_BSP_ModH Glucan_BSP_ModH catalyzes the elongation of beta-1,2 polyglucose chains of glucan | Back alignment and domain information |
|---|
| >PRK14716 bacteriophage N4 adsorption protein B; Provisional | Back alignment and domain information |
|---|
| >cd00761 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold | Back alignment and domain information |
|---|
| >KOG2977|consensus | Back alignment and domain information |
|---|
| >PRK11234 nfrB bacteriophage N4 adsorption protein B; Provisional | Back alignment and domain information |
|---|
| >PRK05454 glucosyltransferase MdoH; Provisional | Back alignment and domain information |
|---|
| >PRK15489 nfrB bacteriophage N4 adsorption protein B; Provisional | Back alignment and domain information |
|---|
| >cd02514 GT13_GLCNAC-TI GT13_GLCNAC-TI is involved in an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides | Back alignment and domain information |
|---|
| >KOG2547|consensus | Back alignment and domain information |
|---|
| >PF13712 Glyco_tranf_2_5: Glycosyltransferase like family; PDB: 2QGI_A 2NXV_B | Back alignment and domain information |
|---|
| >PF13704 Glyco_tranf_2_4: Glycosyl transferase family 2 | Back alignment and domain information |
|---|
| >PF03452 Anp1: Anp1; InterPro: IPR005109 The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function | Back alignment and domain information |
|---|
| >PF03071 GNT-I: GNT-I family; InterPro: IPR004139 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >COG4092 Predicted glycosyltransferase involved in capsule biosynthesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG3588|consensus | Back alignment and domain information |
|---|
| >PF03142 Chitin_synth_2: Chitin synthase; InterPro: IPR004835 Chitin synthase (2 | Back alignment and domain information |
|---|
| >PF13506 Glyco_transf_21: Glycosyl transferase family 21 | Back alignment and domain information |
|---|
| >PF09488 Osmo_MPGsynth: Mannosyl-3-phosphoglycerate synthase (osmo_MPGsynth); InterPro: IPR012812 This family consists of examples of mannosyl-3-phosphoglycerate synthase (MPGS), which together with mannosyl-3-phosphoglycerate phosphatase (MPGP), comprises a two-step pathway for mannosylglycerate biosynthesis | Back alignment and domain information |
|---|
| >PF06306 CgtA: Beta-1,4-N-acetylgalactosaminyltransferase (CgtA); InterPro: IPR010446 This family consists of several beta-1,4-N-acetylgalactosaminyltransferase proteins from Campylobacter jejuni [] | Back alignment and domain information |
|---|
| >COG2943 MdoH Membrane glycosyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK14503 mannosyl-3-phosphoglycerate synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR02460 osmo_MPGsynth mannosyl-3-phosphoglycerate synthase | Back alignment and domain information |
|---|
| >PF05679 CHGN: Chondroitin N-acetylgalactosaminyltransferase; InterPro: IPR008428 This family represents Chondroitin N-acetylgalactosaminyltransferase | Back alignment and domain information |
|---|
| >PF11316 Rhamno_transf: Putative rhamnosyl transferase ; InterPro: IPR021466 This bacterial family of proteins has no known function | Back alignment and domain information |
|---|
| >cd00218 GlcAT-I Beta1,3-glucuronyltransferase I (GlcAT-I) is involved in the initial steps of proteoglycan synthesis | Back alignment and domain information |
|---|
| >PLN02458 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >PF13733 Glyco_transf_7N: N-terminal region of glycosyl transferase group 7; PDB: 2AGD_B 3EE5_A 2AE7_B 2AEC_A 2FYA_A 2AES_B 2AH9_A 2FYB_A 2FY7_A 3LW6_A | Back alignment and domain information |
|---|
| >PF09258 Glyco_transf_64: Glycosyl transferase family 64 domain; InterPro: IPR015338 Members of this entry catalyse the transfer reaction of N-acetylglucosamine and N-acetylgalactosamine from the respective UDP-sugars to the non-reducing end of [glucuronic acid]beta 1-3[galactose]beta 1-O-naphthalenemethanol, an acceptor substrate analogue of the natural common linker of various glycosylaminoglycans | Back alignment and domain information |
|---|
| >PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF03214 RGP: Reversibly glycosylated polypeptide; InterPro: IPR004901 Alpha-1,4-glucan-protein synthase catalyses the reaction: |
Back alignment and domain information |
|---|
| >cd04182 GT_2_like_f GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function | Back alignment and domain information |
|---|
| >KOG1476|consensus | Back alignment and domain information |
|---|
| >PLN02893 Cellulose synthase-like protein | Back alignment and domain information |
|---|
| >PRK00317 mobA molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed | Back alignment and domain information |
|---|
| >PF12804 NTP_transf_3: MobA-like NTP transferase domain; PDB: 3FWW_A 2XME_D 2XMH_C 2DPW_A 2WAW_A 2OI5_B 1HV9_B 1FWY_A 2OI6_A 2OI7_B | Back alignment and domain information |
|---|
| >TIGR03310 matur_ygfJ molybdenum hydroxylase accessory protein, YgfJ family | Back alignment and domain information |
|---|
| >cd00899 b4GalT Beta-4-Galactosyltransferase is involved in the formation of the poly-N-acetyllactosamine core structures present in glycoproteins and glycosphingolipids | Back alignment and domain information |
|---|
| >PF04666 Glyco_transf_54: N-Acetylglucosaminyltransferase-IV (GnT-IV) conserved region; InterPro: IPR006759 The complex-type of oligosaccharides are synthesised through elongation by glycosyltransferases after trimming of the precursor oligosaccharides transferred to proteins in the endoplasmic reticulum | Back alignment and domain information |
|---|
| >KOG1413|consensus | Back alignment and domain information |
|---|
| >PF13632 Glyco_trans_2_3: Glycosyl transferase family group 2 | Back alignment and domain information |
|---|
| >TIGR03202 pucB xanthine dehydrogenase accessory protein pucB | Back alignment and domain information |
|---|
| >PF11735 CAP59_mtransfer: Cryptococcal mannosyltransferase 1 ; InterPro: IPR021047 The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1 [, ] | Back alignment and domain information |
|---|
| >KOG3916|consensus | Back alignment and domain information |
|---|
| >PF11397 GlcNAc: Glycosyltransferase (GlcNAc); InterPro: IPR021067 GlcNAc is an enzyme that carries out the first glycosylation step of hydroxylated Skp1; it is found in the cytoplasm and results in a pentasaccharide-linked 'HyPro-143[, ] | Back alignment and domain information |
|---|
| >cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU | Back alignment and domain information |
|---|
| >cd02503 MobA MobA catalyzes the formation of molybdopterin guanine dinucleotide | Back alignment and domain information |
|---|
| >COG1209 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PLN02917 CMP-KDO synthetase | Back alignment and domain information |
|---|
| >PRK00155 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Reviewed | Back alignment and domain information |
|---|
| >cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars | Back alignment and domain information |
|---|
| >PF01697 Glyco_transf_92: Glycosyltransferase family 92; InterPro: IPR008166 This entry represents a region approximately 300 residues long that is of unknown function | Back alignment and domain information |
|---|
| >cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases | Back alignment and domain information |
|---|
| >COG1213 Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK13368 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF00483 NTP_transferase: Nucleotidyl transferase This Prosite entry is only a sub-family of the Pfam entry | Back alignment and domain information |
|---|
| >cd06422 NTP_transferase_like_1 NTP_transferase_like_1 is a member of the nucleotidyl transferase family | Back alignment and domain information |
|---|
| >cd02518 GT2_SpsF SpsF is a glycosyltrnasferase implicated in the synthesis of the spore coat | Back alignment and domain information |
|---|
| >PRK05450 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd06431 GT8_LARGE_C LARGE catalytic domain has closest homology to GT8 glycosyltransferase involved in lipooligosaccharide synthesis | Back alignment and domain information |
|---|
| >cd00505 Glyco_transf_8 Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis | Back alignment and domain information |
|---|
| >cd02513 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-acetylneuraminic acid by adding CMP moiety | Back alignment and domain information |
|---|
| >TIGR02665 molyb_mobA molybdopterin-guanine dinucleotide biosynthesis protein A, proteobacterial | Back alignment and domain information |
|---|
| >cd06425 M1P_guanylylT_B_like_N N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins | Back alignment and domain information |
|---|
| >cd06428 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >PLN03180 reversibly glycosylated polypeptide; Provisional | Back alignment and domain information |
|---|
| >PRK09382 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase protein; Provisional | Back alignment and domain information |
|---|
| >PRK15480 glucose-1-phosphate thymidylyltransferase RfbA; Provisional | Back alignment and domain information |
|---|
| >TIGR03552 F420_cofC 2-phospho-L-lactate guanylyltransferase CofC | Back alignment and domain information |
|---|
| >cd02516 CDP-ME_synthetase CDP-ME synthetase is involved in mevalonate-independent isoprenoid production | Back alignment and domain information |
|---|
| >PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13385 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK02726 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional | Back alignment and domain information |
|---|
| >cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase | Back alignment and domain information |
|---|
| >PF13896 Glyco_transf_49: Glycosyl-transferase for dystroglycan | Back alignment and domain information |
|---|
| >cd02509 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose | Back alignment and domain information |
|---|
| >PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00453 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >COG2068 Uncharacterized MobA-related protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04183 GT2_BcE_like GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule | Back alignment and domain information |
|---|
| >PF03360 Glyco_transf_43: Glycosyltransferase family 43; InterPro: IPR005027 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >PLN02189 cellulose synthase | Back alignment and domain information |
|---|
| >TIGR01207 rmlA glucose-1-phosphate thymidylyltransferase, short form | Back alignment and domain information |
|---|
| >TIGR03584 PseF pseudaminic acid CMP-transferase | Back alignment and domain information |
|---|
| >COG1211 IspD 4-diphosphocytidyl-2-methyl-D-erithritol synthase [Lipid metabolism] | Back alignment and domain information |
|---|
| >cd04194 GT8_A4GalT_like A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface | Back alignment and domain information |
|---|
| >COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF01501 Glyco_transf_8: Glycosyl transferase family 8; InterPro: IPR002495 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd02517 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide | Back alignment and domain information |
|---|
| >TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >cd02508 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch | Back alignment and domain information |
|---|
| >cd06426 NTP_transferase_like_2 NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family | Back alignment and domain information |
|---|
| >cd02538 G1P_TT_short G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase | Back alignment and domain information |
|---|
| >PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd02524 G1P_cytidylyltransferase G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose | Back alignment and domain information |
|---|
| >PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional | Back alignment and domain information |
|---|
| >PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00454 conserved hypothetical protein TIGR00454 | Back alignment and domain information |
|---|
| >KOG2571|consensus | Back alignment and domain information |
|---|
| >PF09837 DUF2064: Uncharacterized protein conserved in bacteria (DUF2064); InterPro: IPR018641 This entry contains proteins that have no known function | Back alignment and domain information |
|---|
| >PLN02190 cellulose synthase-like protein | Back alignment and domain information |
|---|
| >PF05060 MGAT2: N-acetylglucosaminyltransferase II (MGAT2); InterPro: IPR007754 N-acetylglucosaminyltransferase II (2 | Back alignment and domain information |
|---|
| >PRK15171 lipopolysaccharide 1,3-galactosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02638 cellulose synthase A (UDP-forming), catalytic subunit | Back alignment and domain information |
|---|
| >COG0746 MobA Molybdopterin-guanine dinucleotide biosynthesis protein A [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG1022|consensus | Back alignment and domain information |
|---|
| >PF02348 CTP_transf_3: Cytidylyltransferase; InterPro: IPR003329 Synonym(s): CMP-N-acetylneuraminic acid synthetase Acylneuraminate cytidylyltransferase (2 | Back alignment and domain information |
|---|
| >TIGR01105 galF UTP-glucose-1-phosphate uridylyltransferase, non-catalytic GalF subunit | Back alignment and domain information |
|---|
| >cd02523 PC_cytidylyltransferase Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline | Back alignment and domain information |
|---|
| >PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd02541 UGPase_prokaryotic Prokaryotic UGPase catalyses the synthesis of UDP-glucose | Back alignment and domain information |
|---|
| >cd04198 eIF-2B_gamma_N The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 | Back alignment and domain information |
|---|
| >PLN02728 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >TIGR00466 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase | Back alignment and domain information |
|---|
| >PRK00576 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional | Back alignment and domain information |
|---|
| >TIGR01099 galU UTP-glucose-1-phosphate uridylyltransferase | Back alignment and domain information |
|---|
| >PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02623 G1P_cyt_trans glucose-1-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd06432 GT8_HUGT1_C_like The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family | Back alignment and domain information |
|---|
| >PLN02195 cellulose synthase A | Back alignment and domain information |
|---|
| >TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form | Back alignment and domain information |
|---|
| >PF02485 Branch: Core-2/I-Branching enzyme; InterPro: IPR003406 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >COG1210 GalU UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 214 | ||||
| 2ffu_A | 501 | Crystal Structure Of Human Ppgalnact-2 Complexed Wi | 5e-38 | ||
| 1xhb_A | 472 | The Crystal Structure Of Udp-Galnac: Polypeptide Al | 9e-37 | ||
| 2d7i_A | 570 | Crsytal Structure Of Pp-Galnac-T10 With Udp, Galnac | 4e-35 |
| >pdb|2FFU|A Chain A, Crystal Structure Of Human Ppgalnact-2 Complexed With Udp And Ea2 Length = 501 | Back alignment and structure |
|
| >pdb|1XHB|A Chain A, The Crystal Structure Of Udp-Galnac: Polypeptide Alpha-N- Acetylgalactosaminyltransferase-T1 Length = 472 | Back alignment and structure |
| >pdb|2D7I|A Chain A, Crsytal Structure Of Pp-Galnac-T10 With Udp, Galnac And Mn2+ Length = 570 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 214 | |||
| 1xhb_A | 472 | Polypeptide N-acetylgalactosaminyltransferase 1; g | 4e-60 | |
| 2d7i_A | 570 | Polypeptide N-acetylgalactosaminyltransferase 10; | 2e-58 | |
| 2ffu_A | 501 | Ppgalnact-2, polypeptide N-acetylgalactosaminyltra | 2e-56 | |
| 3l7i_A | 729 | Teichoic acid biosynthesis protein F; GT-B fold, m | 3e-10 | |
| 2z86_A | 625 | Chondroitin synthase; GT-A, glycosyltransferase A, | 2e-06 | |
| 2z86_A | 625 | Chondroitin synthase; GT-A, glycosyltransferase A, | 2e-05 | |
| 1qg8_A | 255 | Protein (spore coat polysaccharide biosynthesis P | 3e-06 | |
| 3bcv_A | 240 | Putative glycosyltransferase protein; protein stru | 3e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 | |
| 2nxv_A | 249 | ATP synthase subunits region ORF 6; majastridin, A | 6e-04 |
| >1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Length = 472 | Back alignment and structure |
|---|
Score = 194 bits (493), Expect = 4e-60
Identities = 75/169 (44%), Positives = 110/169 (65%), Gaps = 3/169 (1%)
Query: 5 CANQTFPSTLPSTSVIICFYNEHPATLYRSVQTLLSRTGQSLLHEIILVNDFSEYPSNLH 64
C + +P LP+TSV+I F+NE +TL R+V ++++R+ + ++ EI+LV+D SE L
Sbjct: 19 CKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERD-FLK 77
Query: 65 GEVETFVKGLNNGRVHLYRTSKREGLIRARMFGAKYATGKVLVFLDSHIEVNTHWLEPLL 124
+E++VK L VH+ R +R GLIRAR+ GA + G+V+ FLD+H E WLEPLL
Sbjct: 78 RPLESYVKKLK-VPVHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLL 136
Query: 125 VPIAERTNTVTVPIIDIINADTFQYT-SSALVRGGFNWGLHFKWENLPK 172
I TV PIID+I+ DTF+Y S + GGFNW L+F+W +P+
Sbjct: 137 ARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQ 185
|
| >2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Length = 570 | Back alignment and structure |
|---|
| >2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Length = 501 | Back alignment and structure |
|---|
| >3l7i_A Teichoic acid biosynthesis protein F; GT-B fold, monotopic membrane protein, structural protein; 2.70A {Staphylococcus epidermidis} PDB: 3l7j_A 3l7k_A* 3l7l_A* 3l7m_A* Length = 729 | Back alignment and structure |
|---|
| >2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Length = 625 | Back alignment and structure |
|---|
| >2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Length = 625 | Back alignment and structure |
|---|
| >1qg8_A Protein (spore coat polysaccharide biosynthesis P SPSA); glycosyltransferase, transferase; 1.50A {Bacillus subtilis} SCOP: c.68.1.1 PDB: 1h7q_A* 1h7l_A 1qgq_A* 1qgs_A* Length = 255 | Back alignment and structure |
|---|
| >3bcv_A Putative glycosyltransferase protein; protein structure initiative II, PSI-II NYSGXRC, structural genomics; 2.35A {Bacteroides fragilis} Length = 240 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2nxv_A ATP synthase subunits region ORF 6; majastridin, ATPase operon, glycosyl transferase, rossmann F sulphur SAD, transferase; 1.10A {Rhodobacter blasticus} PDB: 2qgi_A* Length = 249 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| 1xhb_A | 472 | Polypeptide N-acetylgalactosaminyltransferase 1; g | 100.0 | |
| 2d7i_A | 570 | Polypeptide N-acetylgalactosaminyltransferase 10; | 99.98 | |
| 2ffu_A | 501 | Ppgalnact-2, polypeptide N-acetylgalactosaminyltra | 99.97 | |
| 3bcv_A | 240 | Putative glycosyltransferase protein; protein stru | 99.94 | |
| 1qg8_A | 255 | Protein (spore coat polysaccharide biosynthesis P | 99.94 | |
| 2z86_A | 625 | Chondroitin synthase; GT-A, glycosyltransferase A, | 99.91 | |
| 3l7i_A | 729 | Teichoic acid biosynthesis protein F; GT-B fold, m | 99.9 | |
| 3ckj_A | 329 | Putative uncharacterized protein; mycobacteria, un | 99.88 | |
| 2z86_A | 625 | Chondroitin synthase; GT-A, glycosyltransferase A, | 99.87 | |
| 4fix_A | 657 | UDP-galactofuranosyl transferase GLFT2; CAZY GT-2 | 99.87 | |
| 3f1y_A | 387 | Mannosyl-3-phosphoglycerate synthase; GT-A type gl | 99.86 | |
| 4hg6_A | 802 | Cellulose synthase subunit A; membrane translocati | 99.82 | |
| 2nxv_A | 249 | ATP synthase subunits region ORF 6; majastridin, A | 99.73 | |
| 2wvl_A | 391 | Mannosyl-3-phosphoglycerate synthase; GT-A fold, t | 99.69 | |
| 2bo4_A | 397 | Mannosylglycerate synthase; catalysis, glycosyltra | 99.66 | |
| 2fy7_A | 287 | Beta-1,4-galactosyltransferase 1; M339H mutant, AP | 99.55 | |
| 2zu9_A | 394 | Mannosyl-3-phosphoglycerate synthase; GT-A fold, g | 99.51 | |
| 1fo8_A | 343 | Alpha-1,3-mannosyl-glycoprotein beta-1,2-N- acetyl | 99.39 | |
| 2d0j_A | 246 | Galactosylgalactosylxylosylprotein 3-beta- glucuro | 97.35 | |
| 1v84_A | 253 | Galactosylgalactosylxylosylprotein 3-beta- glucuro | 97.19 | |
| 3cu0_A | 281 | Galactosylgalactosylxylosylprotein 3-beta- glucuro | 97.14 | |
| 3lw6_A | 287 | FI08434P, beta-4-galactosyltransferase 7; protein- | 97.0 | |
| 1omz_A | 293 | Alpha-1,4-N-acetylhexosaminyltransferase EXTL2; ro | 96.9 | |
| 3oam_A | 252 | 3-deoxy-manno-octulosonate cytidylyltransferase; c | 96.32 | |
| 3k8d_A | 264 | 3-deoxy-manno-octulosonate cytidylyltransferase; K | 96.22 | |
| 1qwj_A | 229 | Cytidine monophospho-N-acetylneuraminic acid synth | 95.93 | |
| 2c0n_A | 203 | A197; thermophil protein, thermophilic virus, STIV | 95.91 | |
| 3tqd_A | 256 | 3-deoxy-manno-octulosonate cytidylyltransferase; c | 95.87 | |
| 3tzt_A | 276 | Glycosyl transferase family 8; structural genomics | 95.64 | |
| 1ezi_A | 228 | CMP-N-acetylneuraminic acid synthetase; homodimer, | 95.57 | |
| 1h7e_A | 245 | 3-deoxy-manno-octulosonate cytidylyltransferase; n | 95.33 | |
| 2wee_A | 197 | MOBA-related protein; unknown function; 1.65A {Myc | 95.05 | |
| 3st8_A | 501 | Bifunctional protein GLMU; acetyltransferase, pyro | 94.96 | |
| 2y6p_A | 234 | 3-deoxy-manno-octulosonate cytidylyltransferase; l | 94.91 | |
| 1i52_A | 236 | 4-diphosphocytidyl-2-C-methylerythritol synthase; | 94.8 | |
| 2waw_A | 199 | MOBA relate protein; unknown function; HET: PGE; 1 | 94.55 | |
| 2yc3_A | 228 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltran | 94.49 | |
| 4ecm_A | 269 | Glucose-1-phosphate thymidylyltransferase; HET: DA | 94.39 | |
| 1vgw_A | 231 | 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; | 94.19 | |
| 4fcu_A | 253 | 3-deoxy-manno-octulosonate cytidylyltransferase; s | 94.16 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 93.74 | |
| 3ngw_A | 208 | Molybdopterin-guanine dinucleotide biosynthesis P | 93.69 | |
| 3juk_A | 281 | UDP-glucose pyrophosphorylase (GALU); transfer; HE | 93.22 | |
| 3q80_A | 231 | 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; | 93.21 | |
| 1w55_A | 371 | ISPD/ISPF bifunctional enzyme; biosynthetic pathwa | 93.16 | |
| 3f1c_A | 246 | Putative 2-C-methyl-D-erythritol 4-phosphate cytid | 93.09 | |
| 1fxo_A | 293 | Glucose-1-phosphate thymidylyltransferase; rhamnos | 92.87 | |
| 1vic_A | 262 | 3-deoxy-manno-octulosonate cytidylyltransferase; s | 92.85 | |
| 2qh5_A | 308 | PMI, ALGA, mannose-6-phosphate isomerase; structur | 92.79 | |
| 1e5k_A | 201 | Molybdopterin-guanine dinucleotide biosynthesis pr | 92.77 | |
| 3d5n_A | 197 | Q97W15_sulso; NESG, SSR125, structural genomics, P | 92.64 | |
| 3rsb_A | 196 | Adenosylcobinamide-phosphate guanylyltransferase; | 92.54 | |
| 2ux8_A | 297 | Glucose-1-phosphate uridylyltransferase; UGPG, GAL | 92.09 | |
| 2vsh_A | 236 | TARI, 2-C-methyl-D-erythritol 4-phosphate cytidyly | 92.06 | |
| 1lvw_A | 295 | Glucose-1-phosphate thymidylyltransferase; protein | 91.8 | |
| 1g9r_A | 311 | Glycosyl transferase; alpha-beta structure; HET: U | 91.72 | |
| 2xwl_A | 223 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; | 91.58 | |
| 2e8b_A | 201 | Probable molybdopterin-guanine dinucleotide biosy | 91.43 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 91.22 | |
| 3pnn_A | 303 | Conserved domain protein; structural genomics, PSI | 91.15 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 90.92 | |
| 2pa4_A | 323 | UTP-glucose-1-phosphate uridylyltransferase; phosp | 90.26 | |
| 2e3d_A | 302 | UTP--glucose-1-phosphate uridylyltransferase; UDP- | 90.21 | |
| 1mc3_A | 296 | Glucose-1-phosphate thymidylyltransferase; glucose | 90.13 | |
| 2xme_A | 232 | CTP-inositol-1-phosphate cytidylyltransferase; CDP | 88.25 | |
| 2i5e_A | 211 | Hypothetical protein MM_2497; APC86122, methanosar | 84.87 | |
| 1ll2_A | 333 | Glycogenin-1; protein-substrate complex, beta-alph | 84.77 | |
| 1vpa_A | 234 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; | 83.46 | |
| 3cgx_A | 242 | Putative nucleotide-diphospho-sugar transferase; Y | 83.43 |
| >1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 | Back alignment and structure |
|---|
Probab=100.00 E-value=3.6e-32 Score=235.19 Aligned_cols=197 Identities=40% Similarity=0.714 Sum_probs=166.6
Q ss_pred CccccCCcCCCCCCceEEEEEEeCCCchHHHHHHHHHHhcCCCCCccEEEEEECCCCCCC-ChHHHHHHHHhhcCCC-cE
Q psy1766 2 SIICANQTFPSTLPSTSVIICFYNEHPATLYRSVQTLLSRTGQSLLHEIILVNDFSEYPS-NLHGEVETFVKGLNNG-RV 79 (214)
Q Consensus 2 ~~~~~~~~~~~~~p~vSVIIp~~n~~~~~l~~~l~sl~~q~~~~~~~eiivVdd~s~~~d-~t~~~~~~~~~~~~~~-~v 79 (214)
...|++..|+..+|+||||||+||++++.|.+||+|+++|+++...+|||||||||+ | .+.++++++.+++ + ++
T Consensus 16 ~~~c~~~~~~~~~p~vSVIIp~yN~~~~~l~~~l~Sl~~q~~~~~~~EIIvVDd~S~--d~~t~~~l~~~~~~~--~~~v 91 (472)
T 1xhb_A 16 LEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASE--RDFLKRPLESYVKKL--KVPV 91 (472)
T ss_dssp CGGGGTCCCCSCCCCEEEEEEESSCCHHHHHHHHHHHHHSSCGGGEEEEEEEECSCC--CGGGTHHHHHHHHSS--SSCE
T ss_pred ChhhccCcCCcCCCCeEEEEEeCCCCHHHHHHHHHHHHhcCcHhHceEEEEEECCCC--cHHHHHHHHHHHHHC--CCcE
Confidence 467999999999999999999999977899999999999999875579999999999 6 5999999998876 5 89
Q ss_pred EEEEcCCCcchHHHHHhhhhhcCCCEEEEEcCCCccCcCchHHHHHHHhcCCCEEEEeeeeeecCCcceeec-CCceeee
Q psy1766 80 HLYRTSKREGLIRARMFGAKYATGKVLVFLDSHIEVNTHWLEPLLVPIAERTNTVTVPIIDIINADTFQYTS-SALVRGG 158 (214)
Q Consensus 80 ~~i~~~~~~G~~~a~n~g~~~a~gd~i~~lD~D~~~~~~~l~~l~~~~~~~~~~vv~~~~~~~~~~~~~~~~-~~~~~g~ 158 (214)
++++.++|.|.+.|+|.|++.|+|+||+|+|+|+.+.|+||+.+++.+.+++..+++|.++.++.+++.+.. .....|+
T Consensus 92 ~vi~~~~n~G~~~a~N~g~~~A~gd~i~flD~D~~~~p~~L~~ll~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~ 171 (472)
T 1xhb_A 92 HVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGG 171 (472)
T ss_dssp EEEECSSCCCHHHHHHHHHHHCCSSEEEEEESSEEECTTCHHHHHHHHHHCTTEEEEEEEEEECSSSCCEECCCTTEEEE
T ss_pred EEEECCCCCChHHHHHHHHHhccCCeEEEECCCeEeCccHHHHHHHHHHhCCCEEEEeeeeeEcCCCceeccCCCcccce
Confidence 999999999999999999999999999999999999999999999999999999999999999988887753 4566889
Q ss_pred eEecccceeecCCccccCCC------CCCCCCCCCccc-------hhcccccccccc
Q psy1766 159 FNWGLHFKWENLPKVKTSSN------PSYLPLQYTSSA-------LVRGGFNWGLHF 202 (214)
Q Consensus 159 ~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~-------~~~ggf~~~~~~ 202 (214)
++|.+.+.|..++....... ....|...++++ ..+||||..+..
T Consensus 172 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~irr~~~~~iGgfde~~~~ 228 (472)
T 1xhb_A 172 FNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDI 228 (472)
T ss_dssp ECTTCCEEEEECCHHHHHHTTTCTTSCEECSBCCSSSEEEEHHHHHHTTSCCTTSCT
T ss_pred eeccceeecccCCHHHHhcccCCCCCcccCccccceeEEEEHHHHHHcCCCCCcccc
Confidence 99999999987765322111 111133444443 389999998865
|
| >2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* | Back alignment and structure |
|---|
| >2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* | Back alignment and structure |
|---|
| >3bcv_A Putative glycosyltransferase protein; protein structure initiative II, PSI-II NYSGXRC, structural genomics; 2.35A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1qg8_A Protein (spore coat polysaccharide biosynthesis P SPSA); glycosyltransferase, transferase; 1.50A {Bacillus subtilis} SCOP: c.68.1.1 PDB: 1h7q_A* 1h7l_A 1qgq_A* 1qgs_A* | Back alignment and structure |
|---|
| >2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* | Back alignment and structure |
|---|
| >3l7i_A Teichoic acid biosynthesis protein F; GT-B fold, monotopic membrane protein, structural protein; 2.70A {Staphylococcus epidermidis} PDB: 3l7j_A 3l7k_A* 3l7l_A* 3l7m_A* | Back alignment and structure |
|---|
| >3ckj_A Putative uncharacterized protein; mycobacteria, unknown function; HET: CIT; 1.80A {Mycobacterium paratuberculosis} PDB: 3ckn_A* 3cko_A* 3ckq_A* 3ckv_A* 3e26_A 3e25_A | Back alignment and structure |
|---|
| >2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* | Back alignment and structure |
|---|
| >4fix_A UDP-galactofuranosyl transferase GLFT2; CAZY GT-2 family, glycosyltrans carbohydrate binding, membrane; 2.45A {Mycobacterium tuberculosis} PDB: 4fiy_A* | Back alignment and structure |
|---|
| >3f1y_A Mannosyl-3-phosphoglycerate synthase; GT-A type glycosyltransferase, GT-81, mannosyl-3-phosphoglyc synthase, GDP-mannose, transferas; 2.20A {Rubrobacter xylanophilus} PDB: 3kia_A* 3o3p_A* | Back alignment and structure |
|---|
| >4hg6_A Cellulose synthase subunit A; membrane translocation, cellulose synthesis, UDP-GLC binding membrane, transferase; HET: BGC UDP LDA; 3.25A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >2nxv_A ATP synthase subunits region ORF 6; majastridin, ATPase operon, glycosyl transferase, rossmann F sulphur SAD, transferase; 1.10A {Rhodobacter blasticus} PDB: 2qgi_A* | Back alignment and structure |
|---|
| >2wvl_A Mannosyl-3-phosphoglycerate synthase; GT-A fold, transferase, glycosyltransferase, retaining mecha glucosyl transferase; HET: GDD; 2.81A {Thermus thermophilus} PDB: 2wvk_A* 2wvm_A* | Back alignment and structure |
|---|
| >2bo4_A Mannosylglycerate synthase; catalysis, glycosyltransferase, mannose, transferase, stereoselectivity; HET: FLC; 1.95A {Rhodothermus marinus} SCOP: c.68.1.18 PDB: 2bo6_A 2bo7_A* 2bo8_A* 2xw2_A 2y4j_A 2xw3_A* 2xw4_A* 2xw5_A* 2y4k_A* 2y4l_A* 2y4m_A* | Back alignment and structure |
|---|
| >2fy7_A Beta-1,4-galactosyltransferase 1; M339H mutant, APO enzyme; HET: PGE; 1.70A {Homo sapiens} PDB: 2aec_A* 2aes_A* 2ae7_A* 2ah9_A* 2agd_A* 2fya_A* 2fyb_A* 3ee5_A* 2fyc_B* 1tw1_A* 1tw5_A* 1tvy_A* 1nmm_B* 1o0r_A* 1yro_B* 1nf5_B* 1nhe_B* 1nkh_B* 1nqi_B* 1nwg_B* ... | Back alignment and structure |
|---|
| >2zu9_A Mannosyl-3-phosphoglycerate synthase; GT-A fold, glycosyltransferase, GT55, GDP, cytoplasm, magnesium, transferase; HET: GDP; 2.00A {Pyrococcus horikoshii} PDB: 2zu7_A* 2zu8_A* | Back alignment and structure |
|---|
| >1fo8_A Alpha-1,3-mannosyl-glycoprotein beta-1,2-N- acetylglucosaminyltransferase; methylmercury derivative, N- acetylglucosaminyltransferase I; 1.40A {Oryctolagus cuniculus} SCOP: c.68.1.10 PDB: 1fo9_A 1foa_A* 2apc_A* 2am3_A* 2am4_A* 2am5_A* | Back alignment and structure |
|---|
| >2d0j_A Galactosylgalactosylxylosylprotein 3-beta- glucuronosyltransferase 2; rossmann-like fold, glucuronyltransferase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1v84_A Galactosylgalactosylxylosylprotein 3-beta- glucuronosyltransferase 1; glycoprotein, glycocyltransferase, HNK-1 epitop; HET: GAL NDG NAG TLA UDP; 1.82A {Homo sapiens} SCOP: c.68.1.7 PDB: 1v83_A* 1v82_A* | Back alignment and structure |
|---|
| >3cu0_A Galactosylgalactosylxylosylprotein 3-beta- glucuronosyltransferase 3; glcat-I, glycosyltransferase, heparan sulfate biosynthesis, glycoprotein; HET: GAL UDP; 1.90A {Homo sapiens} SCOP: c.68.1.7 PDB: 1kws_A* 1fgg_A* | Back alignment and structure |
|---|
| >3lw6_A FI08434P, beta-4-galactosyltransferase 7; protein-Mn-UDP complex, glycosyltransferase; HET: UDP; 1.81A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1omz_A Alpha-1,4-N-acetylhexosaminyltransferase EXTL2; rossmann fold, DXD motif; HET: UD2; 2.10A {Mus musculus} SCOP: c.68.1.15 PDB: 1omx_A* 1on6_A* 1on8_A* | Back alignment and structure |
|---|
| >3oam_A 3-deoxy-manno-octulosonate cytidylyltransferase; center for structural genomics of infectious diseases; 1.75A {Vibrio cholerae o1 biovar el tor} SCOP: c.68.1.13 | Back alignment and structure |
|---|
| >3k8d_A 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB synthetase KDO complex, lipopolysaccharide biosynthesis magnesium, nucleotidyltransferase; HET: KDO CTP; 1.90A {Escherichia coli} SCOP: c.68.1.13 PDB: 3k8e_C 1vh1_A 3jtj_A* | Back alignment and structure |
|---|
| >1qwj_A Cytidine monophospho-N-acetylneuraminic acid synthetase; CMP-5-N-acetylneuraminic acid synthetase, CMP-NEU5AC, sialic acid, glycosylation; HET: NCC; 2.80A {Mus musculus} SCOP: c.68.1.13 | Back alignment and structure |
|---|
| >2c0n_A A197; thermophil protein, thermophilic virus, STIV, sulfolobus turreted ICOS virus; 1.86A {Sulfolobus turreted icosahedral virus} | Back alignment and structure |
|---|
| >3tqd_A 3-deoxy-manno-octulosonate cytidylyltransferase; cell envelope; 1.80A {Coxiella burnetii} SCOP: c.68.1.0 | Back alignment and structure |
|---|
| >3tzt_A Glycosyl transferase family 8; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, putative glycosyl transferase; HET: MSE CIT; 2.10A {Anaerococcus prevotii} SCOP: c.68.1.0 | Back alignment and structure |
|---|
| >1ezi_A CMP-N-acetylneuraminic acid synthetase; homodimer, alpha-beta-alpha, transferase; 2.00A {Neisseria meningitidis} SCOP: c.68.1.13 PDB: 1eyr_A | Back alignment and structure |
|---|
| >1h7e_A 3-deoxy-manno-octulosonate cytidylyltransferase; nucleotidyltransferase, CMP-KDO synthetase, nucleoside monophosphate glycosides; 1.83A {Escherichia coli} SCOP: c.68.1.13 PDB: 1gqc_A* 1gq9_A 1h6j_A 1h7f_A* 1h7g_A* 1h7h_A* 1h7t_A* | Back alignment and structure |
|---|
| >2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A 2yes_A | Back alignment and structure |
|---|
| >3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* | Back alignment and structure |
|---|
| >2y6p_A 3-deoxy-manno-octulosonate cytidylyltransferase; lipid A; HET: CTP; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1i52_A 4-diphosphocytidyl-2-C-methylerythritol synthase; cytidylyltransferase, deoxyxylulose-5-phosphate pathway (DXP isoprenoid biosynthesys, MEP; HET: CTP; 1.50A {Escherichia coli} SCOP: c.68.1.13 PDB: 1ini_A* 1inj_A 1vgt_A 1vgu_A 3n9w_A 1h3m_A | Back alignment and structure |
|---|
| >2waw_A MOBA relate protein; unknown function; HET: PGE; 1.60A {Mycobacterium SP} | Back alignment and structure |
|---|
| >2yc3_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran chloroplastic; transferase, non-mevalonate-pathway, herbicide, allosteric P; HET: MW5; 1.40A {Arabidopsis thaliana} PDB: 2yc5_A* 1w77_A* 2ycm_A* | Back alignment and structure |
|---|
| >4ecm_A Glucose-1-phosphate thymidylyltransferase; HET: DAU; 2.30A {Bacillus anthracis} PDB: 3hl3_A* | Back alignment and structure |
|---|
| >1vgw_A 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; structural genomics, transferase; 2.35A {Neisseria gonorrhoeae} SCOP: c.68.1.13 PDB: 1vgz_A | Back alignment and structure |
|---|
| >4fcu_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.90A {Acinetobacter baumannii} PDB: 3pol_A | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* | Back alignment and structure |
|---|
| >3ngw_A Molybdopterin-guanine dinucleotide biosynthesis P (MOBA); alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.31A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A* | Back alignment and structure |
|---|
| >3q80_A 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; TB structural genomics consortium, TBSGC, rossman fold; HET: CDM; 2.00A {Mycobacterium tuberculosis} SCOP: c.68.1.0 PDB: 3q7u_A* 3okr_A 2xwn_A* | Back alignment and structure |
|---|
| >1w55_A ISPD/ISPF bifunctional enzyme; biosynthetic pathway, isoprenoids, nonmevalonate, transferase; HET: C GPP; 2.3A {Campylobacter jejuni} SCOP: c.68.1.13 d.79.5.1 PDB: 1w57_A* | Back alignment and structure |
|---|
| >3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} SCOP: c.68.1.0 | Back alignment and structure |
|---|
| >1fxo_A Glucose-1-phosphate thymidylyltransferase; rhamnose, nucleotidyltransferase, pyrophosphorylase, allostery; HET: TMP; 1.66A {Pseudomonas aeruginosa} SCOP: c.68.1.6 PDB: 1fzw_A 1g0r_A* 1g1l_A* 1g23_A* 1g2v_A* 1g3l_A* 1h5r_A* 1h5s_C* 1h5t_A* 1h5s_D* 1h5s_A* 1h5r_B* 1h5s_B* 1h5t_B* 1iim_A* 1iin_A* 3pkp_A* 3pkq_A* 1mp5_A* 1mp3_A* ... | Back alignment and structure |
|---|
| >1vic_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics; 1.80A {Haemophilus influenzae} SCOP: c.68.1.13 PDB: 1vh3_A 3duv_A* | Back alignment and structure |
|---|
| >2qh5_A PMI, ALGA, mannose-6-phosphate isomerase; structural genomics, PSI, protein structure initi nysgrc; 2.30A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1e5k_A Molybdopterin-guanine dinucleotide biosynthesis protein A; molybdopterin nucleotidyl-transferase,; HET: CIT; 1.35A {Escherichia coli} SCOP: c.68.1.8 PDB: 1h4e_A* 1hjl_A* 1hjj_A* 1h4c_A* 1h4d_A* 1fr9_A 1frw_A* | Back alignment and structure |
|---|
| >3d5n_A Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.80A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2ux8_A Glucose-1-phosphate uridylyltransferase; UGPG, GALU pyrophosphorylase, nucleotidyltransferase; HET: G1P; 2.65A {Sphingomonas elodea} | Back alignment and structure |
|---|
| >2vsh_A TARI, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; nucleotidyltransferase; HET: 1PE PG4 P6G; 2.00A {Streptococcus pneumoniae} PDB: 2vsi_A* | Back alignment and structure |
|---|
| >1lvw_A Glucose-1-phosphate thymidylyltransferase; protein nucleotide complex, nucleotide binding fold; HET: TYD; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.68.1.6 | Back alignment and structure |
|---|
| >1g9r_A Glycosyl transferase; alpha-beta structure; HET: UPF; 2.00A {Neisseria meningitidis} SCOP: c.68.1.4 PDB: 1ga8_A* 1ss9_A* | Back alignment and structure |
|---|
| >2xwl_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; transferase, MEP pathway; HET: CTP; 1.49A {Mycobacterium smegmatis} PDB: 2xwm_A* | Back alignment and structure |
|---|
| >2e8b_A Probable molybdopterin-guanine dinucleotide biosy protein A; putative protein, molybdenum cofactor, structural G NPPSFA; 1.61A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* | Back alignment and structure |
|---|
| >3pnn_A Conserved domain protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE GOL; 1.90A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* | Back alignment and structure |
|---|
| >2pa4_A UTP-glucose-1-phosphate uridylyltransferase; phosphorylase, nucleotidyltransferase, metabolism; HET: GUD; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2e3d_A UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose, carbohydrate, pyrophosphorylase; 1.95A {Escherichia coli} | Back alignment and structure |
|---|
| >1mc3_A Glucose-1-phosphate thymidylyltransferase; glucose-1-phosphate thymidylytransferase, RFFH; HET: TTP; 2.60A {Escherichia coli} SCOP: c.68.1.6 | Back alignment and structure |
|---|
| >2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A* | Back alignment and structure |
|---|
| >2i5e_A Hypothetical protein MM_2497; APC86122, methanosarcina mazei GO1, hypothetic protein, STRU genomics, PSI-2, protein structure initiative; 2.10A {Methanosarcina mazei} SCOP: c.68.1.21 | Back alignment and structure |
|---|
| >1ll2_A Glycogenin-1; protein-substrate complex, beta-alpha-beta rossman-like NUCL binding fold, DXD motif, non-proline CIS peptide bond, TRAN; HET: UPG; 1.90A {Oryctolagus cuniculus} SCOP: c.68.1.14 PDB: 1ll3_A 1ll0_A 1zcv_A 1zcu_A 1zdf_A* 1zcy_A 1zdg_A* | Back alignment and structure |
|---|
| >1vpa_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; TM1393, JCSG, joint center for structural GENO PSI, protein structure initiative; HET: CTP; 2.67A {Thermotoga maritima} SCOP: c.68.1.13 | Back alignment and structure |
|---|
| >3cgx_A Putative nucleotide-diphospho-sugar transferase; YP_389115.1, joint center for structural genomics; 1.90A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 214 | ||||
| d1xhba2 | 328 | c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosa | 3e-26 | |
| d2bo4a1 | 381 | c.68.1.18 (A:2-382) Mannosylglycerate synthase, MG | 3e-18 | |
| d1omza_ | 265 | c.68.1.15 (A:) Alpha-1,4-N-acetylhexosaminyltransf | 1e-07 | |
| d1qg8a_ | 255 | c.68.1.1 (A:) Spore coat polysaccharide biosynthes | 0.002 |
| >d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 328 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Nucleotide-diphospho-sugar transferases superfamily: Nucleotide-diphospho-sugar transferases family: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain domain: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 101 bits (251), Expect = 3e-26
Identities = 75/169 (44%), Positives = 110/169 (65%), Gaps = 3/169 (1%)
Query: 5 CANQTFPSTLPSTSVIICFYNEHPATLYRSVQTLLSRTGQSLLHEIILVNDFSEYPSNLH 64
C + +P LP+TSV+I F+NE +TL R+V ++++R+ + ++ EI+LV+D SE L
Sbjct: 12 CKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDF-LK 70
Query: 65 GEVETFVKGLNNGRVHLYRTSKREGLIRARMFGAKYATGKVLVFLDSHIEVNTHWLEPLL 124
+E++VK L VH+ R +R GLIRAR+ GA + G+V+ FLD+H E WLEPLL
Sbjct: 71 RPLESYVKKLKV-PVHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLL 129
Query: 125 VPIAERTNTVTVPIIDIINADTFQYT-SSALVRGGFNWGLHFKWENLPK 172
I TV PIID+I+ DTF+Y S + GGFNW L+F+W +P+
Sbjct: 130 ARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQ 178
|
| >d2bo4a1 c.68.1.18 (A:2-382) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]} Length = 381 | Back information, alignment and structure |
|---|
| >d1omza_ c.68.1.15 (A:) Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-GalNAcT EXTL2) {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 | Back information, alignment and structure |
|---|
| >d1qg8a_ c.68.1.1 (A:) Spore coat polysaccharide biosynthesis protein SpsA {Bacillus subtilis [TaxId: 1423]} Length = 255 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| d1xhba2 | 328 | Polypeptide N-acetylgalactosaminyltransferase 1, N | 100.0 | |
| d1qg8a_ | 255 | Spore coat polysaccharide biosynthesis protein Sps | 99.93 | |
| d1omza_ | 265 | Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-Ga | 99.9 | |
| d2bo4a1 | 381 | Mannosylglycerate synthase, MGS {Rhodothermus mari | 99.42 | |
| d1fo8a_ | 343 | N-acetylglucosaminyltransferase I {Rabbit (Oryctol | 98.45 | |
| d1pzta_ | 271 | beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos | 97.57 | |
| d1v82a_ | 252 | Beta-1,3-glucuronyltransferase 1, GlcAT-P {Human ( | 97.25 | |
| d3cu0a1 | 261 | 1,3-Glucuronyltransferase I (glcAT-I) {Human (Homo | 96.58 | |
| d1qwja_ | 228 | CMP acylneuraminate synthetase {Mouse (Mus musculu | 94.46 | |
| d1fxoa_ | 292 | RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} | 94.4 | |
| d1mc3a_ | 291 | RffH {Escherichia coli [TaxId: 562]} | 94.32 | |
| d1lvwa_ | 295 | RmlA (RfbA) {Archaeon Methanobacterium thermoautot | 93.46 | |
| d1w77a1 | 226 | 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) | 92.44 | |
| d1h7ea_ | 245 | CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn | 91.69 | |
| d1w55a1 | 205 | IspD/IspF bifunctional enzyme, CDP-me synthase dom | 91.54 | |
| d1i52a_ | 225 | 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) | 90.36 | |
| d1e5ka_ | 188 | Molybdenum cofactor biosynthesis protein MobA {Esc | 89.13 | |
| d1ga8a_ | 282 | Galactosyltransferase LgtC {Neisseria meningitidis | 89.02 | |
| d1vica_ | 255 | CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn | 84.17 | |
| d2dpwa1 | 231 | Uncharacterized protein TTHA0179 {Thermus thermoph | 82.32 | |
| d1eyra_ | 225 | CMP acylneuraminate synthetase {Neisseria meningit | 81.85 | |
| d1g97a2 | 250 | N-acetylglucosamine 1-phosphate uridyltransferase | 80.56 |
| >d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Nucleotide-diphospho-sugar transferases superfamily: Nucleotide-diphospho-sugar transferases family: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain domain: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00 E-value=4.2e-36 Score=246.30 Aligned_cols=200 Identities=39% Similarity=0.686 Sum_probs=166.2
Q ss_pred CCccccCCcCCCCCCceEEEEEEeCCCchHHHHHHHHHHhcCCCCCccEEEEEECCCCCCCCh-HHHHHHHHhhcCCCcE
Q psy1766 1 MSIICANQTFPSTLPSTSVIICFYNEHPATLYRSVQTLLSRTGQSLLHEIILVNDFSEYPSNL-HGEVETFVKGLNNGRV 79 (214)
Q Consensus 1 ~~~~~~~~~~~~~~p~vSVIIp~~n~~~~~l~~~l~sl~~q~~~~~~~eiivVdd~s~~~d~t-~~~~~~~~~~~~~~~v 79 (214)
|.+.|+..+|+++||.||||||+||+....|.+||+|+++|+++...+|||||||||+ |++ .+.++++.++. ..++
T Consensus 8 r~~~~~~~~~~~~~P~vSIIIp~yNe~~~~l~~~l~Si~~qt~~~~~~EIIvVDdgS~--d~~~~~~l~~~~~~~-~~~i 84 (328)
T d1xhba2 8 RLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASE--RDFLKRPLESYVKKL-KVPV 84 (328)
T ss_dssp SCGGGGTCCCCSCCCCEEEEEEESSCCHHHHHHHHHHHHHSSCGGGEEEEEEEECSCC--CGGGTHHHHHHHHSS-SSCE
T ss_pred CChhhhhccCCCCCCCEEEEEeccCCcHHHHHHHHHHHHhcCCCCCCeEEEEEECCCC--hhhHHHHHHHHHHhc-CCCe
Confidence 4578999999999999999999999873579999999999998875579999999999 554 56778877765 5689
Q ss_pred EEEEcCCCcchHHHHHhhhhhcCCCEEEEEcCCCccCcCchHHHHHHHhcCCCEEEEeeeeeecCCcceeec-CCceeee
Q psy1766 80 HLYRTSKREGLIRARMFGAKYATGKVLVFLDSHIEVNTHWLEPLLVPIAERTNTVTVPIIDIINADTFQYTS-SALVRGG 158 (214)
Q Consensus 80 ~~i~~~~~~G~~~a~n~g~~~a~gd~i~~lD~D~~~~~~~l~~l~~~~~~~~~~vv~~~~~~~~~~~~~~~~-~~~~~g~ 158 (214)
+++++++|.|.+.|+|.|++.|+|+||+|+|+|+.+.|+||+.++..+.+++..+++|.++.++..++.+.. .....++
T Consensus 85 ~vi~~~~n~G~~~a~N~Gi~~a~gd~i~flD~D~~~~p~~l~~l~~~~~~~~~~~v~~~~~~i~~~~~~~~~~~~~~~~~ 164 (328)
T d1xhba2 85 HVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGG 164 (328)
T ss_dssp EEEECSSCCCHHHHHHHHHHHCCSSEEEEEESSEEECTTCHHHHHHHHHHCTTEEEEEEEEEECSSSCCEECCCTTEEEE
T ss_pred EEEEecccccchHHHHHHHHhhhcceeeecCcccccChhHHHHHHHHHhcCCCeEEecceeeeccCceeeccCCcccccc
Confidence 999999999999999999999999999999999999999999999999999999999999999998888764 4566788
Q ss_pred eEecccceeecCCccccCCCCC------CCCCCCCccc-------hhccccccccccc
Q psy1766 159 FNWGLHFKWENLPKVKTSSNPS------YLPLQYTSSA-------LVRGGFNWGLHFK 203 (214)
Q Consensus 159 ~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~-------~~~ggf~~~~~~~ 203 (214)
+.|.+.+.|..++......... ..+...++++ ..+||||..+.++
T Consensus 165 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~irr~~f~~vGgfDe~~~~~ 222 (328)
T d1xhba2 165 FNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIW 222 (328)
T ss_dssp ECTTCCEEEEECCHHHHHHTTTCTTSCEECSBCCSSSEEEEHHHHHHTTSCCTTSCTT
T ss_pred ccccccccccccchhhhhccccccccccccceecceeeeeeHHHHHHhCCCCCCCcCc
Confidence 9999988888777643221111 1133444444 3899999988654
|
| >d1qg8a_ c.68.1.1 (A:) Spore coat polysaccharide biosynthesis protein SpsA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1omza_ c.68.1.15 (A:) Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-GalNAcT EXTL2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bo4a1 c.68.1.18 (A:2-382) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]} | Back information, alignment and structure |
|---|
| >d1fo8a_ c.68.1.10 (A:) N-acetylglucosaminyltransferase I {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1pzta_ c.68.1.2 (A:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1v82a_ c.68.1.7 (A:) Beta-1,3-glucuronyltransferase 1, GlcAT-P {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3cu0a1 c.68.1.7 (A:75-335) 1,3-Glucuronyltransferase I (glcAT-I) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qwja_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1w77a1 c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1h7ea_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KpsU [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w55a1 c.68.1.13 (A:3-207) IspD/IspF bifunctional enzyme, CDP-me synthase domain {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1i52a_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e5ka_ c.68.1.8 (A:) Molybdenum cofactor biosynthesis protein MobA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ga8a_ c.68.1.4 (A:) Galactosyltransferase LgtC {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1vica_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2dpwa1 c.68.1.19 (A:1-231) Uncharacterized protein TTHA0179 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1eyra_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|