Psyllid ID: psy17697


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110
MGWSSRCSDLLIDIDQLGLTVESCFNTWLSVGKHHALAARVLKLKIGEKSNNIPHLPADAFRSTGLVNLHNLLLKDCNITDIDPDAFSGLGILIELDLTKNRIHTLHPGK
ccccccccccEEEcccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccEEcHHHHcccccccEEEccccccccccccc
cccccccccEEEEEcccccccccHcccEEEcccccccccEEEEccccccccccccccHHHHHHHccHHHHHHHHHcccccEEcHHHHHcccEEEEEEccccccEEccccc
mgwssrcsdLLIDIDQLGLTVESCFNTWLSVGKHHALAARVLKLKIgeksnniphlpadafrstglvnlhnlllkdcnitdidpdafsglgilieldltknrihtlhpgk
MGWSSRCSDLLIDIDQLGLTVESCFNTWLSVGKHHALAARVLKLKIGEKSNNIPHLPADAFRSTGLVNLHNLLLKDCNITDIDPDAFSGLGILIeldltknrihtlhpgk
MGWSSRCSDLLIDIDQLGLTVESCFNTWLSVGKHHALAARVLKLKIGEKSNNIPHLPADAFRSTGLVNLHNLLLKDCNITDIDPDAFSGLGILIELDLTKNRIHTLHPGK
******CSDLLIDIDQLGLTVESCFNTWLSVGKHHALAARVLKLKIGEKSNNIPHLPADAFRSTGLVNLHNLLLKDCNITDIDPDAFSGLGILIELDLTKNRIH******
*G*SSRCSDLLIDIDQLGLTVESCFNTWLSVGKHHALAARVLKLKIGEKSNNIPHLPADAFRSTGLVNLHNLLLKDCNITDIDPDAFSGLGILIELDLTKNRIH*LH***
MGWSSRCSDLLIDIDQLGLTVESCFNTWLSVGKHHALAARVLKLKIGEKSNNIPHLPADAFRSTGLVNLHNLLLKDCNITDIDPDAFSGLGILIELDLTKNRIHTLHPGK
****SRCSDLLIDIDQLGLTVESCFNTWLSVGKHHALAARVLKLKIGEKSNNIPHLPADAFRSTGLVNLHNLLLKDCNITDIDPDAFSGLGILIELDLTKNRIHTL****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGWSSRCSDLLIDIDQLGLTVESCFNTWLSVGKHHALAARVLKLKIGEKSNNIPHLPADAFRSTGLVNLHNLLLKDCNITDIDPDAFSGLGILIELDLTKNRIHTLHPGK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query110 2.2.26 [Sep-21-2011]
Q6DF55 661 Vasorin OS=Xenopus tropic yes N/A 0.509 0.084 0.431 0.0001
O70210 358 Chondroadherin OS=Rattus yes N/A 0.527 0.162 0.435 0.0003
O55226 358 Chondroadherin OS=Mus mus yes N/A 0.536 0.164 0.426 0.0003
>sp|Q6DF55|VASN_XENTR Vasorin OS=Xenopus tropicalis GN=vasn PE=2 SV=1 Back     alignment and function desciption
 Score = 45.1 bits (105), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 51  NNIPHLPADAFRSTGLVNLHNLLLKDCNITDIDPDAFSGLGILIELDLTKNRIHTLHP 108
           N +  LP   FR+  L NL NL L    +T+I  D F GL  L  L L  NRI ++HP
Sbjct: 84  NQLSSLPGGVFRN--LANLSNLDLTSNQLTEISADTFQGLSRLERLYLNGNRIRSIHP 139




May act as an inhibitor of TGF-beta signaling.
Xenopus tropicalis (taxid: 8364)
>sp|O70210|CHAD_RAT Chondroadherin OS=Rattus norvegicus GN=Chad PE=2 SV=1 Back     alignment and function description
>sp|O55226|CHAD_MOUSE Chondroadherin OS=Mus musculus GN=Chad PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query110
193647905 799 PREDICTED: hypothetical protein LOC10016 0.790 0.108 0.456 2e-12
195398783 931 GJ15735 [Drosophila virilis] gi|19415042 0.527 0.062 0.534 6e-11
195059514 962 GH17649 [Drosophila grimshawi] gi|193896 0.527 0.060 0.517 8e-10
198471062 915 GA11471 [Drosophila pseudoobscura pseudo 0.536 0.064 0.508 9e-10
307174207 762 Leucine-rich repeat-containing protein 2 0.536 0.077 0.559 1e-09
24643232 931 kekkon5, isoform A [Drosophila melanogas 0.536 0.063 0.508 1e-09
28569548 917 kekkon5 precursor [Drosophila melanogast 0.536 0.064 0.508 1e-09
195133704 923 GI16086 [Drosophila mojavensis] gi|19390 0.527 0.062 0.517 2e-09
195479805 922 GE15841 [Drosophila yakuba] gi|194188559 0.536 0.063 0.491 2e-09
194892928 921 GG19223 [Drosophila erecta] gi|190649417 0.536 0.064 0.491 3e-09
>gi|193647905|ref|XP_001946145.1| PREDICTED: hypothetical protein LOC100167808 isoform 1 [Acyrthosiphon pisum] gi|328697287|ref|XP_003240297.1| PREDICTED: hypothetical protein LOC100167808 isoform 2 [Acyrthosiphon pisum] gi|328697289|ref|XP_003240298.1| PREDICTED: hypothetical protein LOC100167808 isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 76.6 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 42/92 (45%), Positives = 56/92 (60%), Gaps = 5/92 (5%)

Query: 18  GLTVESCFNTWL-SVGKHHALAARVLKLKIGEKSNNIPHLPADAFRSTGLVNLHNLLLKD 76
           G  +  C N+ L S+ K  +   +VL L     +N I  +  DAFR  GL+NLH L+ ++
Sbjct: 42  GQKMAECINSSLTSIPKTLSNEVQVLDLT----NNKILEINKDAFREVGLINLHKLIARN 97

Query: 77  CNITDIDPDAFSGLGILIELDLTKNRIHTLHP 108
           C+I  +D DAF GL ILIELDL+ N IH LHP
Sbjct: 98  CSIELVDKDAFRGLEILIELDLSNNNIHVLHP 129




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195398783|ref|XP_002058000.1| GJ15735 [Drosophila virilis] gi|194150424|gb|EDW66108.1| GJ15735 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195059514|ref|XP_001995652.1| GH17649 [Drosophila grimshawi] gi|193896438|gb|EDV95304.1| GH17649 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|198471062|ref|XP_001355488.2| GA11471 [Drosophila pseudoobscura pseudoobscura] gi|198145749|gb|EAL32547.2| GA11471 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|307174207|gb|EFN64852.1| Leucine-rich repeat-containing protein 24 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|24643232|ref|NP_573382.1| kekkon5, isoform A [Drosophila melanogaster] gi|24643234|ref|NP_728242.1| kekkon5, isoform B [Drosophila melanogaster] gi|24643236|ref|NP_728243.1| kekkon5, isoform C [Drosophila melanogaster] gi|386764700|ref|NP_001245746.1| kekkon5, isoform D [Drosophila melanogaster] gi|22832560|gb|AAF48953.2| kekkon5, isoform A [Drosophila melanogaster] gi|22832561|gb|AAN09488.1| kekkon5, isoform B [Drosophila melanogaster] gi|22832562|gb|AAN09489.1| kekkon5, isoform C [Drosophila melanogaster] gi|71834212|gb|AAZ41778.1| LP23752p [Drosophila melanogaster] gi|220952102|gb|ACL88594.1| kek5-PA [synthetic construct] gi|383293477|gb|AFH07458.1| kekkon5, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|28569548|gb|AAO43730.1| kekkon5 precursor [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195133704|ref|XP_002011279.1| GI16086 [Drosophila mojavensis] gi|193907254|gb|EDW06121.1| GI16086 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195479805|ref|XP_002101035.1| GE15841 [Drosophila yakuba] gi|194188559|gb|EDX02143.1| GE15841 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|194892928|ref|XP_001977768.1| GG19223 [Drosophila erecta] gi|190649417|gb|EDV46695.1| GG19223 [Drosophila erecta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query110
FB|FBgn0031016 931 kek5 "kekkon5" [Drosophila mel 0.536 0.063 0.508 4.7e-10
ZFIN|ZDB-GENE-040426-1130 363 chad "chondroadherin" [Danio r 0.718 0.217 0.367 1e-05
FB|FBgn0039862 836 kek6 "kek6" [Drosophila melano 0.509 0.066 0.375 5.5e-05
FB|FBgn0243486 741 rdo "reduced ocelli" [Drosophi 0.872 0.129 0.330 8.9e-05
RGD|2336 358 Chad "chondroadherin" [Rattus 0.509 0.156 0.45 9.7e-05
RGD|1308398 334 Lrrc26 "leucine rich repeat co 0.518 0.170 0.389 0.00011
MGI|MGI:1096866 358 Chad "chondroadherin" [Mus mus 0.509 0.156 0.45 0.00012
FB|FBgn0032484 649 kek4 "kekkon4" [Drosophila mel 0.8 0.135 0.351 0.00022
FB|FBgn0262473 1097 Tl "Toll" [Drosophila melanoga 0.618 0.061 0.371 0.00026
FB|FBgn0015399 880 kek1 "kekkon-1" [Drosophila me 0.754 0.094 0.310 0.00033
FB|FBgn0031016 kek5 "kekkon5" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 156 (60.0 bits), Expect = 4.7e-10, P = 4.7e-10
 Identities = 30/59 (50%), Positives = 39/59 (66%)

Query:    51 NNIPHLPADAFRSTGLVNLHNLLLKDCNITDIDPDAFSGLGILIELDLTKNRIHTLHPG 109
             N IP L  + F   GL N+H + L++C I ++  +AF GL ILIELDL+ NRI  LHPG
Sbjct:    83 NQIPELRREEFLLAGLPNVHKIFLRNCTIQEVHREAFKGLHILIELDLSGNRIRELHPG 141




GO:0005887 "integral to plasma membrane" evidence=ISM
GO:0042059 "negative regulation of epidermal growth factor receptor signaling pathway" evidence=IMP
GO:0005886 "plasma membrane" evidence=IDA
GO:0030510 "regulation of BMP signaling pathway" evidence=IDA
ZFIN|ZDB-GENE-040426-1130 chad "chondroadherin" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0039862 kek6 "kek6" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0243486 rdo "reduced ocelli" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|2336 Chad "chondroadherin" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1308398 Lrrc26 "leucine rich repeat containing 26" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1096866 Chad "chondroadherin" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0032484 kek4 "kekkon4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0262473 Tl "Toll" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0015399 kek1 "kekkon-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query110
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-05
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
 Score = 43.7 bits (104), Expect = 3e-07
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 68  NLHNLLLKDCNITDIDPDAFSGLGILIELDLTKNRIHTLHPG 109
           NL +L L +  +T I   AF GL  L  LDL+ N + ++ P 
Sbjct: 1   NLKSLDLSNNRLTVIPDGAFKGLPNLKVLDLSGNNLTSISPE 42


Length = 60

>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 110
KOG4237|consensus 498 99.38
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.22
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.43
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.4
KOG4237|consensus 498 98.35
KOG4194|consensus 873 98.31
KOG4194|consensus 873 98.21
KOG0444|consensus 1255 98.0
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.97
KOG0617|consensus 264 97.83
PLN03150 623 hypothetical protein; Provisional 97.75
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 97.72
PLN03150 623 hypothetical protein; Provisional 97.69
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.58
KOG1259|consensus 490 97.57
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 97.52
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.44
KOG0444|consensus 1255 97.22
KOG0618|consensus 1081 97.22
KOG0617|consensus 264 97.2
KOG0472|consensus 565 97.05
KOG4579|consensus177 96.84
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 96.81
KOG0472|consensus565 96.78
KOG1644|consensus 233 96.69
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 96.68
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 96.57
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 96.43
KOG0618|consensus 1081 96.37
KOG4579|consensus177 96.37
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 96.29
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 96.24
KOG1644|consensus 233 96.03
KOG0532|consensus 722 95.96
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.94
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 95.82
KOG0531|consensus 414 95.81
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.77
smart0037026 LRR Leucine-rich repeats, outliers. 95.77
smart0037026 LRR Leucine-rich repeats, outliers. 95.68
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.68
KOG1259|consensus 490 95.52
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.5
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.79
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.66
KOG0531|consensus 414 94.57
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 93.63
KOG1859|consensus 1096 93.39
KOG4658|consensus 889 93.28
KOG3207|consensus 505 93.05
PLN03210 1153 Resistant to P. syringae 6; Provisional 92.27
PLN03210 1153 Resistant to P. syringae 6; Provisional 92.27
cd00116 319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 92.19
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 92.05
KOG1859|consensus 1096 91.56
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 91.22
KOG0532|consensus 722 90.94
KOG4658|consensus 889 90.43
KOG2739|consensus 260 88.62
KOG3207|consensus 505 88.09
PRK15386 426 type III secretion protein GogB; Provisional 84.86
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 84.78
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 82.45
>KOG4237|consensus Back     alignment and domain information
Probab=99.38  E-value=1.1e-13  Score=104.52  Aligned_cols=94  Identities=31%  Similarity=0.413  Sum_probs=78.7

Q ss_pred             hhhcccccCCCCCCCcccccC---ceeEEE-E---------eeeEEEEeeCCCCccCCCCCcCccCccCcccccEEeccC
Q psy17697         10 LLIDIDQLGLTVESCFNTWLS---VGKHHA-L---------AARVLKLKIGEKSNNIPHLPADAFRSTGLVNLHNLLLKD   76 (110)
Q Consensus        10 ~~~~~~~~~~cp~~c~c~~~~---~~~~~~-l---------~l~~l~l~~~~~~n~l~~~~~~~f~~~~~~~L~~l~l~~   76 (110)
                      ...+...+..||.+|.|+..+   +.|... +         +++.|++    ..|.|+.||+++|.  .+..|+.++|+.
T Consensus        27 ~~~C~~~~~~CP~pC~Cs~~~g~~VdCr~~GL~eVP~~LP~~tveirL----dqN~I~~iP~~aF~--~l~~LRrLdLS~  100 (498)
T KOG4237|consen   27 VPTCAHSASACPAPCTCSDVEGGIVDCRGKGLTEVPANLPPETVEIRL----DQNQISSIPPGAFK--TLHRLRRLDLSK  100 (498)
T ss_pred             hhhhhhccccCCCCcccCCCCCceEEccCCCcccCcccCCCcceEEEe----ccCCcccCChhhcc--chhhhceecccc
Confidence            444555578899999999843   444333 2         8889999    99999999999999  899999999999


Q ss_pred             CCCcccCcccccCCcCCcEEeCCC-CCCccccCC
Q psy17697         77 CNITDIDPDAFSGLGILIELDLTK-NRIHTLHPG  109 (110)
Q Consensus        77 n~l~~i~~~~f~~l~~L~~l~Ls~-N~l~~l~~~  109 (110)
                      |+|++|.|++|.++.++..|.+-+ |+|+.+|.+
T Consensus       101 N~Is~I~p~AF~GL~~l~~Lvlyg~NkI~~l~k~  134 (498)
T KOG4237|consen  101 NNISFIAPDAFKGLASLLSLVLYGNNKITDLPKG  134 (498)
T ss_pred             cchhhcChHhhhhhHhhhHHHhhcCCchhhhhhh
Confidence            999999999999999987776655 999998764



>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query110
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-13
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-10
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-10
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-09
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-13
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-12
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 9e-12
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-10
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-10
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 9e-09
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 8e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-12
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 8e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-12
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-12
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-12
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-10
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 9e-10
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-08
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-07
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-11
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-11
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-11
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-11
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-11
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-10
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-10
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-09
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-07
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-07
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-07
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-11
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-09
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-08
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-07
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-05
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-11
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-10
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-10
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-06
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-06
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 5e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-08
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 5e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-07
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 1e-06
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 2e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-09
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-07
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-06
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-05
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-05
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-09
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-08
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-07
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-07
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-07
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-04
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-05
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-10
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-09
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 5e-09
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 9e-09
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-06
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-06
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-04
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-09
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 8e-08
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 6e-07
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 7e-07
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 8e-06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 3e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-09
2v9t_B 220 SLIT homolog 2 protein N-product; structural prote 4e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-07
2v9t_B 220 SLIT homolog 2 protein N-product; structural prote 5e-05
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 4e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-08
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-05
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 2e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-09
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 9e-09
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 6e-08
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 7e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-06
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 6e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-07
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 1e-06
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 7e-06
2v70_A 220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 1e-08
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 3e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-08
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 3e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-06
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-04
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-04
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-07
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-07
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-05
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-05
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-04
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-04
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-04
3m19_A 251 Variable lymphocyte receptor A diversity region; a 4e-05
3m19_A 251 Variable lymphocyte receptor A diversity region; a 2e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-04
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
 Score = 64.1 bits (156), Expect = 1e-13
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 50  SNNIPHLPADAFRSTGLVNLHNLLLKDCNITDIDPDAFSGLGILIELDLTKNRIHTLHPG 109
            NN+  L A+   +  L NLH+LLL   ++  I  +AF  +  L  LDL+ N +HTL   
Sbjct: 48  HNNLSRLRAEWTPT-RLTNLHSLLLSHNHLNFISSEAFVPVPNLRYLDLSSNHLHTLDEF 106


>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query110
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.5
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.45
2v9t_B 220 SLIT homolog 2 protein N-product; structural prote 99.39
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.38
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.37
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.35
2o6s_A 208 Variable lymphocyte receptor B; leucine-rich repea 99.34
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.31
2v70_A 220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.27
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.19
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.15
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.13
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 99.11
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.1
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.07
3e6j_A 229 Variable lymphocyte receptor diversity region; var 99.06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.05
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 99.03
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 99.03
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.03
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 99.01
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.93
3m19_A 251 Variable lymphocyte receptor A diversity region; a 98.91
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.88
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.88
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 98.87
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.86
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.85
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 98.85
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.85
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 98.85
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.84
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.81
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 98.8
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.8
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.78
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.77
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 98.77
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.76
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 98.74
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 98.7
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.69
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.67
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.63
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.61
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.61
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.6
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.58
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 98.57
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 98.57
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 98.57
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.55
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.53
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 98.52
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.51
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.51
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 98.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.49
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 98.47
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.47
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 98.47
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 98.46
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 98.45
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.44
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 98.42
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.42
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.41
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.41
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.4
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.4
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.39
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.39
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.38
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 98.38
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.35
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.3
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.29
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 98.29
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.29
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.28
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.26
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.26
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.24
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 98.2
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.2
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 98.18
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.18
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.13
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.11
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.1
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 98.07
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.04
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.03
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.03
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.02
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 98.02
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.02
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.01
1wwl_A 312 Monocyte differentiation antigen CD14; LPS, immune 97.99
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 97.99
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 97.97
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 97.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 97.96
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 97.94
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 97.94
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 97.94
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 97.93
4ezg_A197 Putative uncharacterized protein; internalin-A, le 97.9
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 97.9
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 97.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 97.86
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 97.85
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 97.82
1o6v_A 466 Internalin A; bacterial infection, extracellular r 97.79
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 97.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 97.73
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.67
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.66
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.65
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 97.64
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 97.64
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 97.63
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.56
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 97.55
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 97.54
1o6v_A 466 Internalin A; bacterial infection, extracellular r 97.52
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 97.44
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 97.43
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.34
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 97.31
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 97.11
4fdw_A 401 Leucine rich hypothetical protein; putative cell s 96.96
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.91
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.87
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 96.83
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 96.78
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.73
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.46
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 96.38
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.35
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.33
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 96.28
4gt6_A394 Cell surface protein; leucine rich repeats, putati 95.89
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 95.73
4gt6_A394 Cell surface protein; leucine rich repeats, putati 95.64
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 95.64
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 95.59
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 95.59
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 95.06
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 94.54
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 93.91
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 92.08
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 91.23
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 90.88
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 89.47
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 87.35
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 86.61
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 84.33
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
Probab=99.50  E-value=3.1e-14  Score=94.91  Aligned_cols=85  Identities=26%  Similarity=0.364  Sum_probs=74.0

Q ss_pred             CCCCCCcccccCceeEEE-E---------eeeEEEEeeCCCCccCCCCCcCccCccCcccccEEeccCCCCcccCccccc
Q psy17697         19 LTVESCFNTWLSVGKHHA-L---------AARVLKLKIGEKSNNIPHLPADAFRSTGLVNLHNLLLKDCNITDIDPDAFS   88 (110)
Q Consensus        19 ~cp~~c~c~~~~~~~~~~-l---------~l~~l~l~~~~~~n~l~~~~~~~f~~~~~~~L~~l~l~~n~l~~i~~~~f~   88 (110)
                      .||..|.|.+..+.+... +         .++.|++    ++|.++.+++..|.  ++++|+.|++++|+++.+++..|.
T Consensus         2 ~CP~~C~C~~~~l~~s~n~l~~ip~~~~~~l~~L~L----~~N~i~~~~~~~~~--~l~~L~~L~Ls~N~l~~l~~~~f~   75 (170)
T 3g39_A            2 ACPSQCSCSGTTVDCSGKSLASVPTGIPTTTQVLYL----YDNQITKLEPGVFD--RLTQLTRLDLDNNQLTVLPAGVFD   75 (170)
T ss_dssp             CCC-CCEEETTEEECTTSCCSSCCSCCCTTCSEEEC----CSSCCCCCCTTTTT--TCTTCSEEECCSSCCCCCCTTTTT
T ss_pred             cCcCcCCcCCCEEEeCCCCcCccCccCCCCCcEEEc----CCCcCCccChhhhc--CcccCCEEECCCCCcCccChhhcc
Confidence            699999999876666444 1         7889999    99999999999998  789999999999999999999899


Q ss_pred             CCcCCcEEeCCCCCCccccCC
Q psy17697         89 GLGILIELDLTKNRIHTLHPG  109 (110)
Q Consensus        89 ~l~~L~~l~Ls~N~l~~l~~~  109 (110)
                      .+++|+.|+|++|+|+.++++
T Consensus        76 ~l~~L~~L~L~~N~l~~~~~~   96 (170)
T 3g39_A           76 KLTQLTQLSLNDNQLKSIPRG   96 (170)
T ss_dssp             TCTTCCEEECCSSCCCCCCTT
T ss_pred             CCCCCCEEECCCCccCEeCHH
Confidence            999999999999999988764



>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 110
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-05
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 39.3 bits (90), Expect = 3e-05
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 50  SNNIPHLPADAFRSTGLVNLHNLLLKDCNITDIDPDAFSGLGILIELDLTKNRIHTLHPG 109
           +N I  +    F+   L NLH L+L +  I+ I P AF+ L  L  L L+KN++  L   
Sbjct: 40  NNKITEIKDGDFK--NLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQLKELPEK 97


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query110
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.47
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.44
d1xkua_ 305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.33
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.72
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.65
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.65
d1xwdc1 242 Follicle-stimulating hormone receptor {Human (Homo 98.63
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.63
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.6
d1p9ag_ 266 von Willebrand factor binding domain of glycoprote 98.6
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 98.53
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.52
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.52
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.5
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.5
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.27
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.05
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.03
d2omza2 384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.94
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.94
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 97.94
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 97.91
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.81
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.8
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.76
d1h6ta2 210 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.63
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.54
d1h6ua2 227 Internalin H {Listeria monocytogenes [TaxId: 1639] 97.47
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 97.39
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.37
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.17
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.32
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 94.37
d2astb2 284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 92.71
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 90.97
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 90.6
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 88.81
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 87.3
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Slit
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Probab=99.47  E-value=2.1e-14  Score=95.68  Aligned_cols=84  Identities=26%  Similarity=0.371  Sum_probs=50.1

Q ss_pred             CCCCCCcccccCceeEEE-E---------eeeEEEEeeCCCCccC-------------------------CCCCcCccCc
Q psy17697         19 LTVESCFNTWLSVGKHHA-L---------AARVLKLKIGEKSNNI-------------------------PHLPADAFRS   63 (110)
Q Consensus        19 ~cp~~c~c~~~~~~~~~~-l---------~l~~l~l~~~~~~n~l-------------------------~~~~~~~f~~   63 (110)
                      .||..|.|.+..+.|... +         .+++|++    ++|.|                         ..++.+.|. 
T Consensus         1 ~CP~~C~C~~~~v~Cs~~~L~~iP~~lp~~l~~L~L----s~N~i~~~~~~~~f~~l~~L~~L~L~~N~i~~~~~~~~~-   75 (192)
T d1w8aa_           1 DCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLL----NDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFE-   75 (192)
T ss_dssp             CCCTTSEEETTEEECTTSCCSSCCSCCCTTCSEEEC----CSCCCCSBCCSCSGGGCTTCCEEECCSSCCCCBCTTTTT-
T ss_pred             CcCCCCEEcCCEEEEeCCCcCccCCCCCCCCCEEEe----CCCCCcccccccccCCCceEeeeeccccccccccccccc-
Confidence            499999999887776533 1         4445555    55555                         444444444 


Q ss_pred             cCcccccEEeccCCCCcccCcccccCCcCCcEEeCCCCCCccccC
Q psy17697         64 TGLVNLHNLLLKDCNITDIDPDAFSGLGILIELDLTKNRIHTLHP  108 (110)
Q Consensus        64 ~~~~~L~~l~l~~n~l~~i~~~~f~~l~~L~~l~Ls~N~l~~l~~  108 (110)
                       +++.|+.+++++|+++.+++++|.++++|+.|+|++|+|+.+++
T Consensus        76 -~~~~L~~L~Ls~N~l~~l~~~~F~~l~~L~~L~L~~N~l~~i~~  119 (192)
T d1w8aa_          76 -GASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMP  119 (192)
T ss_dssp             -TCTTCCEEECCSCCCCEECSSSSTTCTTCCEEECCSSCCCEECT
T ss_pred             -cccccceeeeccccccccCHHHHhCCCcccccccCCccccccCH
Confidence             44555555555555666666556666666666666666665554



>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure