Psyllid ID: psy17699
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 149 | ||||||
| 302772721 | 340 | hypothetical protein SELMODRAFT_92401 [S | 0.315 | 0.138 | 0.617 | 5e-09 | |
| 302823291 | 321 | hypothetical protein SELMODRAFT_236713 [ | 0.315 | 0.146 | 0.617 | 5e-09 | |
| 58385914 | 332 | AGAP004880-PB [Anopheles gambiae str. PE | 0.322 | 0.144 | 0.562 | 3e-08 | |
| 322785993 | 86 | hypothetical protein SINV_10962 [Solenop | 0.281 | 0.488 | 0.642 | 4e-08 | |
| 170058421 | 331 | l-lactate dehydrogenase [Culex quinquefa | 0.315 | 0.141 | 0.574 | 5e-08 | |
| 156255210 | 331 | lactate dehydrogenase [Bombyx mori] gi|1 | 0.322 | 0.145 | 0.520 | 5e-08 | |
| 170063026 | 331 | l-lactate dehydrogenase [Culex quinquefa | 0.315 | 0.141 | 0.574 | 5e-08 | |
| 312381230 | 479 | hypothetical protein AND_06519 [Anophele | 0.315 | 0.098 | 0.553 | 5e-08 | |
| 289740453 | 332 | lactate dehydrogenase [Glossina morsitan | 0.315 | 0.141 | 0.553 | 6e-08 | |
| 307169552 | 332 | L-lactate dehydrogenase [Camponotus flor | 0.281 | 0.126 | 0.642 | 9e-08 |
| >gi|302772721|ref|XP_002969778.1| hypothetical protein SELMODRAFT_92401 [Selaginella moellendorffii] gi|300162289|gb|EFJ28902.1| hypothetical protein SELMODRAFT_92401 [Selaginella moellendorffii] | Back alignment and taxonomy information |
|---|
Score = 65.9 bits (159), Expect = 5e-09, Method: Compositional matrix adjust.
Identities = 29/47 (61%), Positives = 38/47 (80%)
Query: 65 SEGHHGIEEEVFLSLPCVMADNGVTHIVNQPLTQEEIEKLKKSAQAI 111
++G HGIE +VFLSLPCV+ NGV HIV Q LT+ E+ KLK+SAQ++
Sbjct: 285 AKGRHGIEHDVFLSLPCVLGRNGVLHIVEQTLTENEVLKLKESAQSL 331
|
Source: Selaginella moellendorffii Species: Selaginella moellendorffii Genus: Selaginella Family: Selaginellaceae Order: Selaginellales Class: Isoetopsida Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|302823291|ref|XP_002993299.1| hypothetical protein SELMODRAFT_236713 [Selaginella moellendorffii] gi|300138872|gb|EFJ05624.1| hypothetical protein SELMODRAFT_236713 [Selaginella moellendorffii] | Back alignment and taxonomy information |
|---|
| >gi|58385914|ref|XP_314306.2| AGAP004880-PB [Anopheles gambiae str. PEST] gi|158292996|ref|XP_001688555.1| AGAP004880-PC [Anopheles gambiae str. PEST] gi|158292998|ref|XP_001688556.1| AGAP004880-PA [Anopheles gambiae str. PEST] gi|55240259|gb|EAA09690.2| AGAP004880-PB [Anopheles gambiae str. PEST] gi|157016894|gb|EDO64032.1| AGAP004880-PC [Anopheles gambiae str. PEST] gi|157016895|gb|EDO64033.1| AGAP004880-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|322785993|gb|EFZ12609.1| hypothetical protein SINV_10962 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|170058421|ref|XP_001864915.1| l-lactate dehydrogenase [Culex quinquefasciatus] gi|167877547|gb|EDS40930.1| l-lactate dehydrogenase [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|156255210|ref|NP_001095933.1| lactate dehydrogenase [Bombyx mori] gi|151933948|gb|ABS18410.1| lactate dehydrogenase [Bombyx mori] gi|164523643|gb|ABY60854.1| lactate dehydrogenase [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|170063026|ref|XP_001866924.1| l-lactate dehydrogenase [Culex quinquefasciatus] gi|167880810|gb|EDS44193.1| l-lactate dehydrogenase [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|312381230|gb|EFR27023.1| hypothetical protein AND_06519 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|289740453|gb|ADD18974.1| lactate dehydrogenase [Glossina morsitans morsitans] | Back alignment and taxonomy information |
|---|
| >gi|307169552|gb|EFN62194.1| L-lactate dehydrogenase [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 149 | ||||||
| FB|FBgn0001258 | 332 | ImpL3 "Ecdysone-inducible gene | 0.630 | 0.283 | 0.432 | 1.7e-09 | |
| ZFIN|ZDB-GENE-991026-5 | 333 | ldha "lactate dehydrogenase A4 | 0.644 | 0.288 | 0.359 | 2.7e-08 | |
| UNIPROTKB|Q5E9B1 | 334 | LDHB "L-lactate dehydrogenase | 0.308 | 0.137 | 0.521 | 2.7e-08 | |
| UNIPROTKB|J9NSR4 | 328 | J9NSR4 "L-lactate dehydrogenas | 0.657 | 0.298 | 0.36 | 3.4e-08 | |
| UNIPROTKB|P00337 | 333 | LDHB "L-lactate dehydrogenase | 0.308 | 0.138 | 0.5 | 3.5e-08 | |
| WB|WBGene00002262 | 333 | ldh-1 [Caenorhabditis elegans | 0.308 | 0.138 | 0.5 | 4.5e-08 | |
| UNIPROTKB|J9P3N9 | 334 | J9P3N9 "L-lactate dehydrogenas | 0.308 | 0.137 | 0.5 | 4.5e-08 | |
| UNIPROTKB|J9JHZ0 | 330 | J9JHZ0 "L-lactate dehydrogenas | 0.308 | 0.139 | 0.5 | 5.7e-08 | |
| UNIPROTKB|E2R761 | 334 | LDHB "Uncharacterized protein" | 0.308 | 0.137 | 0.5 | 5.8e-08 | |
| UNIPROTKB|P07195 | 334 | LDHB "L-lactate dehydrogenase | 0.308 | 0.137 | 0.5 | 5.8e-08 |
| FB|FBgn0001258 ImpL3 "Ecdysone-inducible gene L3" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 144 (55.7 bits), Expect = 1.7e-09, P = 1.7e-09
Identities = 42/97 (43%), Positives = 56/97 (57%)
Query: 16 HKISVVFSAGNDIKFMLNTIEGPRGGLTHNIQVPLLDFDSNVESCEKSKSEGHHGIEEEV 75
HK VV SA IK T G T ++ +L S+V + S G HGI+++V
Sbjct: 231 HK-QVVDSAYEVIKLKGYT-SWAIGLSTASLASAILRNTSSVAAVSTSVL-GEHGIDKDV 287
Query: 76 FLSLPCVMADNGVTHIVNQPLTQEEIEKLKKSAQAIS 112
FLSLPCV+ NGVT +V Q LT E+E+L+KSA +S
Sbjct: 288 FLSLPCVLNANGVTSVVKQILTPTEVEQLQKSANIMS 324
|
|
| ZFIN|ZDB-GENE-991026-5 ldha "lactate dehydrogenase A4" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5E9B1 LDHB "L-lactate dehydrogenase B chain" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NSR4 J9NSR4 "L-lactate dehydrogenase" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P00337 LDHB "L-lactate dehydrogenase B chain" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00002262 ldh-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P3N9 J9P3N9 "L-lactate dehydrogenase" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9JHZ0 J9JHZ0 "L-lactate dehydrogenase" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R761 LDHB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P07195 LDHB "L-lactate dehydrogenase B chain" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 149 | |||
| cd05293 | 312 | cd05293, LDH_1, A subgroup of L-lactate dehydrogen | 9e-18 | |
| PLN02602 | 350 | PLN02602, PLN02602, lactate dehydrogenase | 2e-13 | |
| TIGR01771 | 299 | TIGR01771, L-LDH-NAD, L-lactate dehydrogenase | 5e-09 | |
| cd00650 | 263 | cd00650, LDH_MDH_like, NAD-dependent, lactate dehy | 1e-08 | |
| cd05290 | 307 | cd05290, LDH_3, A subgroup of L-lactate dehydrogen | 1e-08 | |
| cd05292 | 308 | cd05292, LDH_2, A subgroup of L-lactate dehydrogen | 1e-08 | |
| cd00300 | 300 | cd00300, LDH_like, L-lactate dehydrogenase-like en | 3e-08 | |
| cd01339 | 300 | cd01339, LDH-like_MDH, L-lactate dehydrogenase-lik | 4e-08 | |
| cd05291 | 306 | cd05291, HicDH_like, L-2-hydroxyisocapronate dehyd | 3e-06 | |
| COG0039 | 313 | COG0039, Mdh, Malate/lactate dehydrogenases [Energ | 3e-06 | |
| PRK06223 | 307 | PRK06223, PRK06223, malate dehydrogenase; Reviewed | 4e-06 | |
| PRK00066 | 315 | PRK00066, ldh, L-lactate dehydrogenase; Reviewed | 8e-06 | |
| TIGR01763 | 305 | TIGR01763, MalateDH_bact, malate dehydrogenase, NA | 1e-05 | |
| pfam02866 | 173 | pfam02866, Ldh_1_C, lactate/malate dehydrogenase, | 0.001 | |
| PTZ00082 | 321 | PTZ00082, PTZ00082, L-lactate dehydrogenase; Provi | 0.002 |
| >gnl|CDD|133429 cd05293, LDH_1, A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
Score = 77.3 bits (191), Expect = 9e-18
Identities = 29/47 (61%), Positives = 40/47 (85%)
Query: 65 SEGHHGIEEEVFLSLPCVMADNGVTHIVNQPLTQEEIEKLKKSAQAI 111
+G HGIE+EVFLSLPC++ +NG+TH++ QPLT+EE EKL+KSA +
Sbjct: 260 VKGLHGIEDEVFLSLPCILGENGITHVIKQPLTEEEQEKLQKSADTL 306
|
L-lactate dehydrogenases (LDH) are tetrameric enzymes catalyzing the last step of glycolysis in which pyruvate is converted to L-lactate. This subgroup is composed of eukaryotic LDHs. Vertebrate LDHs are non-allosteric. This is in contrast to some bacterial LDHs that are activated by an allosteric effector such as fructose-1,6-bisphosphate. LDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others. Length = 312 |
| >gnl|CDD|178212 PLN02602, PLN02602, lactate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|233566 TIGR01771, L-LDH-NAD, L-lactate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|133419 cd00650, LDH_MDH_like, NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family | Back alignment and domain information |
|---|
| >gnl|CDD|133426 cd05290, LDH_3, A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|133428 cd05292, LDH_2, A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|133418 cd00300, LDH_like, L-lactate dehydrogenase-like enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|133424 cd01339, LDH-like_MDH, L-lactate dehydrogenase-like malate dehydrogenase proteins | Back alignment and domain information |
|---|
| >gnl|CDD|133427 cd05291, HicDH_like, L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|223117 COG0039, Mdh, Malate/lactate dehydrogenases [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|180477 PRK06223, PRK06223, malate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|178836 PRK00066, ldh, L-lactate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233562 TIGR01763, MalateDH_bact, malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >gnl|CDD|202437 pfam02866, Ldh_1_C, lactate/malate dehydrogenase, alpha/beta C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|173376 PTZ00082, PTZ00082, L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 149 | |||
| PF02866 | 174 | Ldh_1_C: lactate/malate dehydrogenase, alpha/beta | 99.93 | |
| COG0039 | 313 | Mdh Malate/lactate dehydrogenases [Energy producti | 99.93 | |
| PTZ00082 | 321 | L-lactate dehydrogenase; Provisional | 99.93 | |
| TIGR01763 | 305 | MalateDH_bact malate dehydrogenase, NAD-dependent. | 99.92 | |
| cd05292 | 308 | LDH_2 A subgroup of L-lactate dehydrogenases. L-la | 99.92 | |
| TIGR01771 | 299 | L-LDH-NAD L-lactate dehydrogenase. This model repr | 99.92 | |
| PLN02602 | 350 | lactate dehydrogenase | 99.92 | |
| TIGR01756 | 313 | LDH_protist lactate dehydrogenase. This model repr | 99.92 | |
| PTZ00117 | 319 | malate dehydrogenase; Provisional | 99.92 | |
| cd01336 | 325 | MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli | 99.92 | |
| PLN00135 | 309 | malate dehydrogenase | 99.91 | |
| cd05291 | 306 | HicDH_like L-2-hydroxyisocapronate dehydrogenases | 99.91 | |
| PTZ00325 | 321 | malate dehydrogenase; Provisional | 99.91 | |
| cd01338 | 322 | MDH_choloroplast_like Chloroplast-like malate dehy | 99.9 | |
| cd05290 | 307 | LDH_3 A subgroup of L-lactate dehydrogenases. L-la | 99.9 | |
| TIGR01759 | 323 | MalateDH-SF1 malate dehydrogenase. This model repr | 99.9 | |
| cd05293 | 312 | LDH_1 A subgroup of L-lactate dehydrogenases. L-la | 99.9 | |
| cd00704 | 323 | MDH Malate dehydrogenase. Malate dehydrogenase (MD | 99.9 | |
| TIGR01772 | 312 | MDH_euk_gproteo malate dehydrogenase, NAD-dependen | 99.9 | |
| KOG1495|consensus | 332 | 99.9 | ||
| PRK00066 | 315 | ldh L-lactate dehydrogenase; Reviewed | 99.9 | |
| cd00300 | 300 | LDH_like L-lactate dehydrogenase-like enzymes. Mem | 99.9 | |
| cd01339 | 300 | LDH-like_MDH L-lactate dehydrogenase-like malate d | 99.89 | |
| PRK05442 | 326 | malate dehydrogenase; Provisional | 99.89 | |
| PRK05086 | 312 | malate dehydrogenase; Provisional | 99.88 | |
| cd05294 | 309 | LDH-like_MDH_nadp A lactate dehydrogenases-like st | 99.88 | |
| TIGR01758 | 324 | MDH_euk_cyt malate dehydrogenase, NAD-dependent. T | 99.88 | |
| cd01337 | 310 | MDH_glyoxysomal_mitochondrial Glyoxysomal and mito | 99.87 | |
| PLN00106 | 323 | malate dehydrogenase | 99.86 | |
| PRK06223 | 307 | malate dehydrogenase; Reviewed | 99.85 | |
| TIGR01757 | 387 | Malate-DH_plant malate dehydrogenase, NADP-depende | 99.85 | |
| PLN00112 | 444 | malate dehydrogenase (NADP); Provisional | 99.84 | |
| cd05295 | 452 | MDH_like Malate dehydrogenase-like. These MDH-like | 99.8 | |
| cd00650 | 263 | LDH_MDH_like NAD-dependent, lactate dehydrogenase- | 99.68 | |
| KOG1494|consensus | 345 | 99.1 | ||
| cd05298 | 437 | GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; | 98.69 | |
| KOG1496|consensus | 332 | 97.98 | ||
| COG1486 | 442 | CelF Alpha-galactosidases/6-phospho-beta-glucosida | 97.12 | |
| PRK15076 | 431 | alpha-galactosidase; Provisional | 95.8 | |
| PF11975 | 232 | Glyco_hydro_4C: Family 4 glycosyl hydrolase C-term | 95.7 | |
| cd05297 | 423 | GH4_alpha_glucosidase_galactosidase Glycoside Hydr | 95.59 | |
| cd05296 | 419 | GH4_P_beta_glucosidase Glycoside Hydrolases Family | 95.51 | |
| cd05197 | 425 | GH4_glycoside_hydrolases Glycoside Hydrases Family | 95.42 |
| >PF02866 Ldh_1_C: lactate/malate dehydrogenase, alpha/beta C-terminal domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR022383 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
Probab=99.93 E-value=3.2e-26 Score=178.22 Aligned_cols=100 Identities=31% Similarity=0.343 Sum_probs=94.7
Q ss_pred hhhhccchhh-ccc-CcceeeHHHHHHHHHHhhhcCCCCCeEEEeeeeccCcCCCccc-eEEEeeEEEcCCceeEEec-C
Q psy17699 19 SVVFSAGNDI-KFM-LNTIEGPRGGLTHNIQVPLLDFDSNVESCEKSKSEGHHGIEEE-VFLSLPCVMADNGVTHIVN-Q 94 (149)
Q Consensus 19 ~~V~~ag~eI-~~K-G~T~ygiA~aia~IveaIL~D~de~~IlpvS~~l~G~YGi~~d-V~lSvP~vIGr~GVe~vl~-l 94 (149)
+.|+++|++| ++| |+|+||||.++++|+++|+.|+ +.++|+|++++|+||++++ +|||+||+||++|++++++ +
T Consensus 69 ~~v~~~g~~ii~~k~g~t~~s~A~a~~~~v~ail~~~--~~i~~~sv~~~g~yg~~~~~v~~s~P~~ig~~Gv~~i~~~~ 146 (174)
T PF02866_consen 69 ERVRKAGYEIIKAKGGSTSYSIAAAAARIVEAILKDE--RRILPVSVYLDGEYGIPDGCVYFSVPVVIGKNGVEKIVEDL 146 (174)
T ss_dssp HHHHHHHHHHHHHHSSSCHHHHHHHHHHHHHHHHTTH--TEEEEEEEEEESGGGEESSSEEEEEEEEEETTEEEEEECSB
T ss_pred cccEeccceeeeeccccCcCCHHHHHHHHHHHHhhcc--cccccceeccccccCcccccceecceEEEcCCeeEEEeCCC
Confidence 4588999999 988 9999999999999999999997 8999999999999999833 9999999999999999999 9
Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHHh
Q psy17699 95 PLTQEEIEKLKKSAQAISQDYMYFLT 120 (149)
Q Consensus 95 ~Ls~eEqe~L~~Sa~~Ik~~i~~~~~ 120 (149)
+||++|+++|++|++.|++.+++.++
T Consensus 147 ~L~~~E~~~l~~sa~~l~~~i~~~~~ 172 (174)
T PF02866_consen 147 PLSEEEQEKLKESAKELKKEIEKGLE 172 (174)
T ss_dssp SSTHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred CCCHHHHHHHHHHHHHHHHHHHHHHh
Confidence 99999999999999999999998875
|
L-lactate dehydrogenase is also found as a lens crystallin in bird and crocodile eyes. L-2-hydroxyisocaproate dehydrogenases are also members of the family. Malate dehydrogenases catalyse the interconversion of malate to oxaloacetate []. The enzyme participates in the citric acid cycle. This entry represents the C-terminal, and is thought to be an is an unusual alpha+beta fold.; GO: 0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor, 0055114 oxidation-reduction process; PDB: 4MDH_B 5MDH_A 1GV0_A 1GUZ_D 2EWD_B 2FRM_D 2FNZ_B 2FN7_B 2FM3_A 1LTH_T .... |
| >COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] | Back alignment and domain information |
|---|
| >PTZ00082 L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >cd05292 LDH_2 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >TIGR01771 L-LDH-NAD L-lactate dehydrogenase | Back alignment and domain information |
|---|
| >PLN02602 lactate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01756 LDH_protist lactate dehydrogenase | Back alignment and domain information |
|---|
| >PTZ00117 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases | Back alignment and domain information |
|---|
| >PLN00135 malate dehydrogenase | Back alignment and domain information |
|---|
| >cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PTZ00325 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases | Back alignment and domain information |
|---|
| >cd05290 LDH_3 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >TIGR01759 MalateDH-SF1 malate dehydrogenase | Back alignment and domain information |
|---|
| >cd05293 LDH_1 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >cd00704 MDH Malate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >KOG1495|consensus | Back alignment and domain information |
|---|
| >PRK00066 ldh L-lactate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd00300 LDH_like L-lactate dehydrogenase-like enzymes | Back alignment and domain information |
|---|
| >cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins | Back alignment and domain information |
|---|
| >PRK05442 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05086 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity | Back alignment and domain information |
|---|
| >TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases | Back alignment and domain information |
|---|
| >PLN00106 malate dehydrogenase | Back alignment and domain information |
|---|
| >PRK06223 malate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent | Back alignment and domain information |
|---|
| >PLN00112 malate dehydrogenase (NADP); Provisional | Back alignment and domain information |
|---|
| >cd05295 MDH_like Malate dehydrogenase-like | Back alignment and domain information |
|---|
| >cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family | Back alignment and domain information |
|---|
| >KOG1494|consensus | Back alignment and domain information |
|---|
| >cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases | Back alignment and domain information |
|---|
| >KOG1496|consensus | Back alignment and domain information |
|---|
| >COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15076 alpha-galactosidase; Provisional | Back alignment and domain information |
|---|
| >PF11975 Glyco_hydro_4C: Family 4 glycosyl hydrolase C-terminal domain; InterPro: IPR022616 This domain is found primarily in bacterial family 4 glycosyl hydrolases | Back alignment and domain information |
|---|
| >cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases | Back alignment and domain information |
|---|
| >cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase | Back alignment and domain information |
|---|
| >cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 149 | ||||
| 1t2f_A | 333 | Human B Lactate Dehydrogenase Complexed With Nad+ A | 1e-08 | ||
| 1i0z_A | 333 | Human Heart L-Lactate Dehydrogenase H Chain, Ternar | 1e-08 | ||
| 5ldh_A | 334 | Structure Of The Active Ternary Complex Of Pig Hear | 2e-08 | ||
| 2ldx_A | 331 | Characterization Of The Antigenic Sites On The Refi | 1e-07 | ||
| 2v65_A | 331 | Apo Ldh From The Psychrophile C. Gunnari Length = 3 | 2e-07 | ||
| 4aj4_A | 332 | Rat Ldha In Complex With 4-((2-Allylsulfanyl-1,3-Be | 2e-07 | ||
| 4aj1_A | 331 | Rat Ldha In Complex With N-(2-(Methylamino)-1,3- Be | 2e-07 | ||
| 3h3f_A | 331 | Rabbit Muscle L-Lactate Dehydrogenase In Complex Wi | 2e-07 | ||
| 1i10_A | 331 | Human Muscle L-Lactate Dehydrogenase M Chain, Terna | 2e-07 | ||
| 4ajp_A | 337 | Human Ldha In Complex With 2-((4-(4-((3-((2-Methyl- | 2e-07 | ||
| 1v6a_A | 332 | Crystal Structure Of L-Lactate Dehydrogenase From C | 5e-07 | ||
| 9ldt_A | 332 | Design And Synthesis Of New Enzymes Based On The La | 9e-07 | ||
| 2i6t_A | 303 | Orthorhombic Structure Of The Ldh Domain Of Human U | 4e-06 | ||
| 6ldh_A | 330 | Refined Crystal Structure Of Dogfish M4 Apo-Lactate | 7e-06 | ||
| 1ldm_A | 329 | Refined Crystal Structure Of Dogfish M4 Apo-Lactate | 7e-06 | ||
| 3ldh_A | 330 | A Comparison Of The Structures Of Apo Dogfish M4 La | 2e-04 |
| >pdb|1T2F|A Chain A, Human B Lactate Dehydrogenase Complexed With Nad+ And 4- Hydroxy-1,2,5-Oxadiazole-3-Carboxylic Acid Length = 333 | Back alignment and structure |
|
| >pdb|1I0Z|A Chain A, Human Heart L-Lactate Dehydrogenase H Chain, Ternary Complex With Nadh And Oxamate Length = 333 | Back alignment and structure |
| >pdb|5LDH|A Chain A, Structure Of The Active Ternary Complex Of Pig Heart Lactate Dehydrogenase With S-Lac-Nad At 2.7 Angstroms Resolution Length = 334 | Back alignment and structure |
| >pdb|2LDX|A Chain A, Characterization Of The Antigenic Sites On The Refined 3- Angstroms Resolution Structure Of Mouse Testicular Lactate Dehydrogenase C4 Length = 331 | Back alignment and structure |
| >pdb|2V65|A Chain A, Apo Ldh From The Psychrophile C. Gunnari Length = 331 | Back alignment and structure |
| >pdb|4AJ4|A Chain A, Rat Ldha In Complex With 4-((2-Allylsulfanyl-1,3-Benzothizol-6-Yl) Amino)-4-Oxo-Butanoic Acid Length = 332 | Back alignment and structure |
| >pdb|4AJ1|A Chain A, Rat Ldha In Complex With N-(2-(Methylamino)-1,3- Benzothiazol-6-Yl)acetamide Length = 331 | Back alignment and structure |
| >pdb|3H3F|A Chain A, Rabbit Muscle L-Lactate Dehydrogenase In Complex With Nadh And Oxamate Length = 331 | Back alignment and structure |
| >pdb|1I10|A Chain A, Human Muscle L-Lactate Dehydrogenase M Chain, Ternary Complex With Nadh And Oxamate Length = 331 | Back alignment and structure |
| >pdb|4AJP|A Chain A, Human Ldha In Complex With 2-((4-(4-((3-((2-Methyl-1,3- Benzothiazol-6yl)amino)-3-Oxo-Propyl)amino)-4-Oxo-Butyl) Phenyl)methyl)propanedioic Acid Length = 337 | Back alignment and structure |
| >pdb|1V6A|A Chain A, Crystal Structure Of L-Lactate Dehydrogenase From Cyprinus Carpio Length = 332 | Back alignment and structure |
| >pdb|9LDT|A Chain A, Design And Synthesis Of New Enzymes Based On The Lactate Dehydrogenase Framework Length = 332 | Back alignment and structure |
| >pdb|2I6T|A Chain A, Orthorhombic Structure Of The Ldh Domain Of Human Ubiquitin- Conjugating Enzyme E2-Like Isoform A Length = 303 | Back alignment and structure |
| >pdb|6LDH|A Chain A, Refined Crystal Structure Of Dogfish M4 Apo-Lactate Dehydrogenase Length = 330 | Back alignment and structure |
| >pdb|1LDM|A Chain A, Refined Crystal Structure Of Dogfish M4 Apo-Lactate Dehydrogenase Length = 329 | Back alignment and structure |
| >pdb|3LDH|A Chain A, A Comparison Of The Structures Of Apo Dogfish M4 Lactate Dehydrogenase And Its Ternary Complexes Length = 330 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 149 | |||
| 4aj2_A | 331 | L-lactate dehydrogenase A chain; oxidoreductase-in | 8e-15 | |
| 2i6t_A | 303 | Ubiquitin-conjugating enzyme E2-like isoform A; L- | 3e-13 | |
| 2xxj_A | 310 | L-LDH, L-lactate dehydrogenase; oxidoreductase, hy | 3e-12 | |
| 1lld_A | 319 | L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N | 4e-12 | |
| 1y6j_A | 318 | L-lactate dehydrogenase; southeast collaboratory f | 4e-12 | |
| 1ldn_A | 316 | L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA | 4e-12 | |
| 1a5z_A | 319 | L-lactate dehydrogenase; oxidoreductase, glycolysi | 8e-12 | |
| 3d0o_A | 317 | L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly | 9e-12 | |
| 2zqz_A | 326 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ro | 9e-12 | |
| 3pqe_A | 326 | L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas | 9e-12 | |
| 1ez4_A | 318 | Lactate dehydrogenase; rossmann fold, oxidoreducta | 2e-11 | |
| 3ldh_A | 330 | Lactate dehydrogenase; oxidoreductase, CHOH donor, | 2e-11 | |
| 1o6z_A | 303 | MDH, malate dehydrogenase; halophilic, ION-binding | 4e-11 | |
| 1hyh_A | 309 | L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 | 1e-10 | |
| 2v6b_A | 304 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ra | 4e-10 | |
| 1oju_A | 294 | MDH, malate dehydrogenase; hyperthermophilic, oxid | 1e-09 | |
| 1guz_A | 310 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 2e-09 | |
| 3nep_X | 314 | Malate dehydrogenase; halophIle, molecular adpatat | 2e-08 | |
| 2d4a_B | 308 | Malate dehydrogenase; archaea, hyperthermophIle, o | 4e-08 | |
| 1ur5_A | 309 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 6e-08 | |
| 2ewd_A | 317 | Lactate dehydrogenase,; protein-substrate_cofactor | 6e-08 | |
| 1pzg_A | 331 | LDH, lactate dehydrogenase; apicomplexa, APAD, tet | 8e-08 | |
| 3gvi_A | 324 | Malate dehydrogenase; NAD, oxidoreductase, tricarb | 9e-08 | |
| 1hye_A | 313 | L-lactate/malate dehydrogenase; nucleotide binding | 9e-08 | |
| 3tl2_A | 315 | Malate dehydrogenase; center for structural genomi | 1e-07 | |
| 2hjr_A | 328 | Malate dehydrogenase; malaria, structural genomics | 2e-07 | |
| 1t2d_A | 322 | LDH-P, L-lactate dehydrogenase; ternary complex, o | 2e-07 | |
| 3p7m_A | 321 | Malate dehydrogenase; putative dehydrogenase, enzy | 3e-07 | |
| 1b8p_A | 329 | Protein (malate dehydrogenase); oxidoreductase; 1. | 6e-05 | |
| 5mdh_A | 333 | Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH | 9e-05 |
| >4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Length = 331 | Back alignment and structure |
|---|
Score = 68.7 bits (169), Expect = 8e-15
Identities = 21/46 (45%), Positives = 34/46 (73%)
Query: 66 EGHHGIEEEVFLSLPCVMADNGVTHIVNQPLTQEEIEKLKKSAQAI 111
+G +GI+E+VFLS+PC++ NG++ +V LT +E +LKKSA +
Sbjct: 277 KGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTL 322
|
| >2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Length = 303 | Back alignment and structure |
|---|
| >2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Length = 310 | Back alignment and structure |
|---|
| >1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Length = 319 | Back alignment and structure |
|---|
| >1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Length = 318 | Back alignment and structure |
|---|
| >1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Length = 316 | Back alignment and structure |
|---|
| >1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Length = 319 | Back alignment and structure |
|---|
| >3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Length = 317 | Back alignment and structure |
|---|
| >2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Length = 326 | Back alignment and structure |
|---|
| >3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Length = 326 | Back alignment and structure |
|---|
| >1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Length = 318 | Back alignment and structure |
|---|
| >3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Length = 330 | Back alignment and structure |
|---|
| >1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Length = 303 | Back alignment and structure |
|---|
| >1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Length = 309 | Back alignment and structure |
|---|
| >2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Length = 304 | Back alignment and structure |
|---|
| >1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ojs_A* 2x0i_A* 2x0j_A* Length = 294 | Back alignment and structure |
|---|
| >1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Length = 310 | Back alignment and structure |
|---|
| >3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Length = 314 | Back alignment and structure |
|---|
| >2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Length = 308 | Back alignment and structure |
|---|
| >1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Length = 309 | Back alignment and structure |
|---|
| >2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Length = 317 | Back alignment and structure |
|---|
| >1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Length = 331 | Back alignment and structure |
|---|
| >3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Length = 324 | Back alignment and structure |
|---|
| >1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Length = 313 | Back alignment and structure |
|---|
| >3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Length = 315 | Back alignment and structure |
|---|
| >2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Length = 328 | Back alignment and structure |
|---|
| >1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Length = 322 | Back alignment and structure |
|---|
| >3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Length = 321 | Back alignment and structure |
|---|
| >1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Length = 329 | Back alignment and structure |
|---|
| >5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Length = 333 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 149 | |||
| 2x0j_A | 294 | Malate dehydrogenase; oxidoreductase, hyperthermop | 99.93 | |
| 3pqe_A | 326 | L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas | 99.92 | |
| 3vku_A | 326 | L-LDH, L-lactate dehydrogenase; rossmann fold, NAD | 99.92 | |
| 3tl2_A | 315 | Malate dehydrogenase; center for structural genomi | 99.92 | |
| 3gvi_A | 324 | Malate dehydrogenase; NAD, oxidoreductase, tricarb | 99.92 | |
| 1oju_A | 294 | MDH, malate dehydrogenase; hyperthermophilic, oxid | 99.92 | |
| 3nep_X | 314 | Malate dehydrogenase; halophIle, molecular adpatat | 99.91 | |
| 4aj2_A | 331 | L-lactate dehydrogenase A chain; oxidoreductase-in | 99.91 | |
| 3p7m_A | 321 | Malate dehydrogenase; putative dehydrogenase, enzy | 99.91 | |
| 3ldh_A | 330 | Lactate dehydrogenase; oxidoreductase, CHOH donor, | 99.89 | |
| 1o6z_A | 303 | MDH, malate dehydrogenase; halophilic, ION-binding | 99.88 | |
| 1ldn_A | 316 | L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA | 99.88 | |
| 1ez4_A | 318 | Lactate dehydrogenase; rossmann fold, oxidoreducta | 99.88 | |
| 1guz_A | 310 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 99.88 | |
| 2xxj_A | 310 | L-LDH, L-lactate dehydrogenase; oxidoreductase, hy | 99.87 | |
| 2zqz_A | 326 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ro | 99.87 | |
| 1ur5_A | 309 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 99.87 | |
| 1hye_A | 313 | L-lactate/malate dehydrogenase; nucleotide binding | 99.87 | |
| 2i6t_A | 303 | Ubiquitin-conjugating enzyme E2-like isoform A; L- | 99.87 | |
| 2d4a_B | 308 | Malate dehydrogenase; archaea, hyperthermophIle, o | 99.87 | |
| 3d0o_A | 317 | L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly | 99.87 | |
| 1a5z_A | 319 | L-lactate dehydrogenase; oxidoreductase, glycolysi | 99.87 | |
| 1y6j_A | 318 | L-lactate dehydrogenase; southeast collaboratory f | 99.87 | |
| 1t2d_A | 322 | LDH-P, L-lactate dehydrogenase; ternary complex, o | 99.86 | |
| 5mdh_A | 333 | Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH | 99.86 | |
| 3hhp_A | 312 | Malate dehydrogenase; MDH, citric acid cycle, TCA | 99.86 | |
| 1pzg_A | 331 | LDH, lactate dehydrogenase; apicomplexa, APAD, tet | 99.86 | |
| 3fi9_A | 343 | Malate dehydrogenase; structural genomics, oxidore | 99.86 | |
| 2hjr_A | 328 | Malate dehydrogenase; malaria, structural genomics | 99.86 | |
| 2v6b_A | 304 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ra | 99.85 | |
| 1y7t_A | 327 | Malate dehydrogenase; NAD-dependent-MDH-NADPH comp | 99.85 | |
| 2ewd_A | 317 | Lactate dehydrogenase,; protein-substrate_cofactor | 99.84 | |
| 7mdh_A | 375 | Protein (malate dehydrogenase); chloroplastic mala | 99.84 | |
| 1hyh_A | 309 | L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 | 99.84 | |
| 1b8p_A | 329 | Protein (malate dehydrogenase); oxidoreductase; 1. | 99.83 | |
| 1mld_A | 314 | Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D | 99.82 | |
| 1smk_A | 326 | Malate dehydrogenase, glyoxysomal; tricarboxylic c | 99.81 | |
| 1lld_A | 319 | L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N | 99.69 | |
| 4h7p_A | 345 | Malate dehydrogenase; ssgcid, structural G seattle | 99.69 | |
| 1up7_A | 417 | 6-phospho-beta-glucosidase; hydrolase, family4 hyd | 99.67 | |
| 1s6y_A | 450 | 6-phospho-beta-glucosidase; hydrolase, structural | 99.58 | |
| 1u8x_X | 472 | Maltose-6'-phosphate glucosidase; structural genom | 99.55 | |
| 3fef_A | 450 | Putative glucosidase LPLD; gulosidase, structural | 99.09 | |
| 1obb_A | 480 | Maltase, alpha-glucosidase; glycosidase, sulfinic | 97.51 | |
| 3u95_A | 477 | Glycoside hydrolase, family 4; hydrolysis, cytosol | 97.33 |
| >2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* | Back alignment and structure |
|---|
Probab=99.93 E-value=2.4e-26 Score=192.79 Aligned_cols=97 Identities=25% Similarity=0.290 Sum_probs=91.8
Q ss_pred hhhhhccchhh-cccCcceeeHHHHHHHHHHhhhcCCCCCeEEEeeeeccCcCCCccceEEEeeEEEcCCceeEEecCCC
Q psy17699 18 ISVVFSAGNDI-KFMLNTIEGPRGGLTHNIQVPLLDFDSNVESCEKSKSEGHHGIEEEVFLSLPCVMADNGVTHIVNQPL 96 (149)
Q Consensus 18 ~~~V~~ag~eI-~~KG~T~ygiA~aia~IveaIL~D~de~~IlpvS~~l~G~YGi~~dV~lSvP~vIGr~GVe~vl~l~L 96 (149)
.+.++++|+|| ++||+|+||||+++++|+++|++|+ ++++|||++++|+||++ |+|+|+||+||++|++ +++++|
T Consensus 195 ~~~~~~~g~eIi~~kGst~~a~a~a~~~~~~ail~d~--~~v~~~s~~l~g~yG~~-~v~~s~P~~lg~~Gve-i~~l~L 270 (294)
T 2x0j_A 195 ENDVRFVAAEVIKRKGATIFGPAVAIYRMVKAVVEDT--GEIIPTSMILQGEYGIE-NVAVGVPAKLGKNGAE-VADIKL 270 (294)
T ss_dssp HHHHHTHHHHHHHHHSSCCHHHHHHHHHHHHHHHTTC--CCEEEEEEEEESGGGCE-EEEEEEEEEEETTEEE-ECCCCC
T ss_pred HHHHhhhheEEEecCcccchhHHHHHHHHHHHHHcCC--CcEEEEEEEEecCCCCc-cEEEEEEEEEeCCEEE-EeCCCC
Confidence 35689999999 9999999999999999999999996 89999999999999997 9999999999999995 889999
Q ss_pred CHHHHHHHHHHHHHHHHHHHHH
Q psy17699 97 TQEEIEKLKKSAQAISQDYMYF 118 (149)
Q Consensus 97 s~eEqe~L~~Sa~~Ik~~i~~~ 118 (149)
|++|+++|++|++.||++++++
T Consensus 271 ~~~E~~~l~~s~~~lk~~i~~l 292 (294)
T 2x0j_A 271 SDEEIEKLRNSAKILRERLEEL 292 (294)
T ss_dssp CHHHHHHHHHHHHHHHHHHHTT
T ss_pred CHHHHHHHHHHHHHHHHHHHHh
Confidence 9999999999999999998864
|
| >3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* | Back alignment and structure |
|---|
| >3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* | Back alignment and structure |
|---|
| >1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* | Back alignment and structure |
|---|
| >3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} | Back alignment and structure |
|---|
| >4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... | Back alignment and structure |
|---|
| >3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} | Back alignment and structure |
|---|
| >3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 | Back alignment and structure |
|---|
| >1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A | Back alignment and structure |
|---|
| >1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* | Back alignment and structure |
|---|
| >1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* | Back alignment and structure |
|---|
| >2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A | Back alignment and structure |
|---|
| >2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* | Back alignment and structure |
|---|
| >1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* | Back alignment and structure |
|---|
| >2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A | Back alignment and structure |
|---|
| >2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* | Back alignment and structure |
|---|
| >1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* | Back alignment and structure |
|---|
| >5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* | Back alignment and structure |
|---|
| >3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* | Back alignment and structure |
|---|
| >1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* | Back alignment and structure |
|---|
| >3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* | Back alignment and structure |
|---|
| >2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A | Back alignment and structure |
|---|
| >7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* | Back alignment and structure |
|---|
| >1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A | Back alignment and structure |
|---|
| >1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* | Back alignment and structure |
|---|
| >1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A | Back alignment and structure |
|---|
| >1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* | Back alignment and structure |
|---|
| >4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} | Back alignment and structure |
|---|
| >1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, Na dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A | Back alignment and structure |
|---|
| >1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 | Back alignment and structure |
|---|
| >1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 | Back alignment and structure |
|---|
| >3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 | Back alignment and structure |
|---|
| >3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 149 | ||||
| d1i0za2 | 172 | d.162.1.1 (A:161-332) Lactate dehydrogenase {Human | 7e-10 | |
| d2ldxa2 | 172 | d.162.1.1 (A:160-331) Lactate dehydrogenase {Mouse | 1e-09 | |
| d1ldma2 | 169 | d.162.1.1 (A:161-329) Lactate dehydrogenase {Dogfi | 5e-08 | |
| d1ojua2 | 152 | d.162.1.1 (A:164-331) Lactate dehydrogenase {Archa | 8e-08 | |
| d1hyha2 | 163 | d.162.1.1 (A:167-329) L-2-hydroxyisocapronate dehy | 1e-07 | |
| d1uxja2 | 164 | d.162.1.1 (A:144-307) Malate dehydrogenase {Chloro | 1e-07 | |
| d1hyea2 | 168 | d.162.1.1 (A:146-313) MJ0490, lactate/malate dehyd | 1e-07 | |
| d5mdha2 | 179 | d.162.1.1 (A:155-333) Malate dehydrogenase {Pig (S | 2e-07 | |
| d1guza2 | 163 | d.162.1.1 (A:143-305) Malate dehydrogenase {Chloro | 3e-07 | |
| d1llca2 | 172 | d.162.1.1 (A:165-334) Lactate dehydrogenase {Lacto | 3e-07 | |
| d1ldna2 | 168 | d.162.1.1 (A:163-330) Lactate dehydrogenase {Bacil | 3e-07 | |
| d1llda2 | 170 | d.162.1.1 (A:150-319) Lactate dehydrogenase {Bifid | 5e-07 | |
| d1t2da2 | 165 | d.162.1.1 (A:151-315) Lactate dehydrogenase {Malar | 5e-07 | |
| d1b8pa2 | 171 | d.162.1.1 (A:159-329) Malate dehydrogenase {Aquasp | 6e-07 | |
| d1y7ta2 | 173 | d.162.1.1 (A:154-332) Malate dehydrogenase {Thermu | 6e-07 | |
| d1y6ja2 | 169 | d.162.1.1 (A:149-317) Lactate dehydrogenase {Clost | 6e-07 | |
| d1a5za2 | 172 | d.162.1.1 (A:164-333) Lactate dehydrogenase {Therm | 1e-06 | |
| d1ez4a2 | 171 | d.162.1.1 (A:163-334) Lactate dehydrogenase {Lacto | 1e-06 | |
| d1o6za2 | 161 | d.162.1.1 (A:163-330) Malate dehydrogenase {Archae | 4e-06 | |
| d7mdha2 | 188 | d.162.1.1 (A:198-385) Malate dehydrogenase {Sorghu | 6e-06 | |
| d1mlda2 | 169 | d.162.1.1 (A:145-313) Malate dehydrogenase {Pig (S | 2e-05 | |
| d1pzga2 | 174 | d.162.1.1 (A:164-334) Lactate dehydrogenase {Toxop | 2e-05 | |
| d2cmda2 | 167 | d.162.1.1 (A:146-312) Malate dehydrogenase {Escher | 1e-04 |
| >d1i0za2 d.162.1.1 (A:161-332) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Length = 172 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: LDH C-terminal domain-like superfamily: LDH C-terminal domain-like family: Lactate & malate dehydrogenases, C-terminal domain domain: Lactate dehydrogenase species: Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]
Score = 52.5 bits (125), Expect = 7e-10
Identities = 23/58 (39%), Positives = 37/58 (63%)
Query: 54 DSNVESCEKSKSEGHHGIEEEVFLSLPCVMADNGVTHIVNQPLTQEEIEKLKKSAQAI 111
+ + + +G +GIE EVFLSLPC++ G+T ++NQ L +E+ +LKKSA +
Sbjct: 106 NLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTL 163
|
| >d2ldxa2 d.162.1.1 (A:160-331) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 | Back information, alignment and structure |
|---|
| >d1ldma2 d.162.1.1 (A:161-329) Lactate dehydrogenase {Dogfish (Squalus acanthias) [TaxId: 7797]} Length = 169 | Back information, alignment and structure |
|---|
| >d1ojua2 d.162.1.1 (A:164-331) Lactate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 152 | Back information, alignment and structure |
|---|
| >d1hyha2 d.162.1.1 (A:167-329) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Length = 163 | Back information, alignment and structure |
|---|
| >d1uxja2 d.162.1.1 (A:144-307) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Length = 164 | Back information, alignment and structure |
|---|
| >d1hyea2 d.162.1.1 (A:146-313) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 168 | Back information, alignment and structure |
|---|
| >d5mdha2 d.162.1.1 (A:155-333) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 179 | Back information, alignment and structure |
|---|
| >d1guza2 d.162.1.1 (A:143-305) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Length = 163 | Back information, alignment and structure |
|---|
| >d1llca2 d.162.1.1 (A:165-334) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Length = 172 | Back information, alignment and structure |
|---|
| >d1ldna2 d.162.1.1 (A:163-330) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 168 | Back information, alignment and structure |
|---|
| >d1llda2 d.162.1.1 (A:150-319) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Length = 170 | Back information, alignment and structure |
|---|
| >d1t2da2 d.162.1.1 (A:151-315) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 165 | Back information, alignment and structure |
|---|
| >d1b8pa2 d.162.1.1 (A:159-329) Malate dehydrogenase {Aquaspirillum arcticum [TaxId: 87645]} Length = 171 | Back information, alignment and structure |
|---|
| >d1y7ta2 d.162.1.1 (A:154-332) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 173 | Back information, alignment and structure |
|---|
| >d1y6ja2 d.162.1.1 (A:149-317) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Length = 169 | Back information, alignment and structure |
|---|
| >d1a5za2 d.162.1.1 (A:164-333) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 172 | Back information, alignment and structure |
|---|
| >d1ez4a2 d.162.1.1 (A:163-334) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Length = 171 | Back information, alignment and structure |
|---|
| >d1o6za2 d.162.1.1 (A:163-330) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 161 | Back information, alignment and structure |
|---|
| >d7mdha2 d.162.1.1 (A:198-385) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Length = 188 | Back information, alignment and structure |
|---|
| >d1mlda2 d.162.1.1 (A:145-313) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 169 | Back information, alignment and structure |
|---|
| >d1pzga2 d.162.1.1 (A:164-334) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Length = 174 | Back information, alignment and structure |
|---|
| >d2cmda2 d.162.1.1 (A:146-312) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 167 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 149 | |||
| d1ojua2 | 152 | Lactate dehydrogenase {Archaeon Archaeoglobus fulg | 99.96 | |
| d1uxja2 | 164 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 99.92 | |
| d1llda2 | 170 | Lactate dehydrogenase {Bifidobacterium longum, str | 99.91 | |
| d1y6ja2 | 169 | Lactate dehydrogenase {Clostridium thermocellum [T | 99.9 | |
| d1guza2 | 163 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 99.9 | |
| d1ez4a2 | 171 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 99.89 | |
| d1i0za2 | 172 | Lactate dehydrogenase {Human (Homo sapiens), heart | 99.89 | |
| d5mdha2 | 179 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 99.89 | |
| d1t2da2 | 165 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 99.89 | |
| d1a5za2 | 172 | Lactate dehydrogenase {Thermotoga maritima [TaxId: | 99.88 | |
| d1ldma2 | 169 | Lactate dehydrogenase {Dogfish (Squalus acanthias) | 99.88 | |
| d1pzga2 | 174 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 99.88 | |
| d1hyea2 | 168 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 99.88 | |
| d7mdha2 | 188 | Malate dehydrogenase {Sorghum (Sorghum vulgare), c | 99.88 | |
| d1ldna2 | 168 | Lactate dehydrogenase {Bacillus stearothermophilus | 99.87 | |
| d1llca2 | 172 | Lactate dehydrogenase {Lactobacillus casei [TaxId: | 99.86 | |
| d2ldxa2 | 172 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 99.85 | |
| d1y7ta2 | 173 | Malate dehydrogenase {Thermus thermophilus [TaxId: | 99.85 | |
| d1hyha2 | 163 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 99.84 | |
| d1o6za2 | 161 | Malate dehydrogenase {Archaeon Haloarcula marismor | 99.84 | |
| d2cmda2 | 167 | Malate dehydrogenase {Escherichia coli [TaxId: 562 | 99.82 | |
| d1b8pa2 | 171 | Malate dehydrogenase {Aquaspirillum arcticum [TaxI | 99.81 | |
| d1mlda2 | 169 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 99.78 | |
| d1up7a2 | 253 | 6-phospho-beta-glucosidase {Thermotoga maritima [T | 96.99 | |
| d1s6ya2 | 270 | 6-phospho-beta-glucosidase {Bacillus stearothermop | 96.93 | |
| d1u8xx2 | 276 | Maltose-6'-phosphate glucosidase GlvA {Bacillus su | 96.41 | |
| d1obba2 | 308 | Alpha-glucosidase AglA {Thermotoga maritima [TaxId | 95.77 | |
| d1vjta2 | 278 | Putative alpha-glucosidase TM0752 {Thermotoga mari | 95.6 |
| >d1ojua2 d.162.1.1 (A:164-331) Lactate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: LDH C-terminal domain-like superfamily: LDH C-terminal domain-like family: Lactate & malate dehydrogenases, C-terminal domain domain: Lactate dehydrogenase species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]
Probab=99.96 E-value=2.3e-30 Score=198.25 Aligned_cols=97 Identities=25% Similarity=0.290 Sum_probs=91.6
Q ss_pred hhhhhccchhh-cccCcceeeHHHHHHHHHHhhhcCCCCCeEEEeeeeccCcCCCccceEEEeeEEEcCCceeEEecCCC
Q psy17699 18 ISVVFSAGNDI-KFMLNTIEGPRGGLTHNIQVPLLDFDSNVESCEKSKSEGHHGIEEEVFLSLPCVMADNGVTHIVNQPL 96 (149)
Q Consensus 18 ~~~V~~ag~eI-~~KG~T~ygiA~aia~IveaIL~D~de~~IlpvS~~l~G~YGi~~dV~lSvP~vIGr~GVe~vl~l~L 96 (149)
.+.+|++|++| ++||+|+||||.++++|+++|++|+ +.++|||++++|+||++ |+|+|+||+||++|++ +++++|
T Consensus 53 ~~~v~~~g~eIi~~kG~t~~gia~a~~~iv~aIl~d~--~~v~pvs~~l~geyG~~-dv~lsvP~vig~~Gve-i~~l~L 128 (152)
T d1ojua2 53 ENDVRFVAAEVIKRKGATIFGPAVAIYRMVKAVVEDT--GEIIPTSMILQGEYGIE-NVAVGVPAKLGKNGAE-VADIKL 128 (152)
T ss_dssp HHHHHTTHHHHHHHHSSCCHHHHHHHHHHHHHHHTTC--CCEEEEEEEEESGGGCE-EEEEEEEEEEETTEEE-ECCCCC
T ss_pred HHHHHHHHHHhhhhccceeccHHHHHHHHHHHHHhcC--CCceeeeEEeccccCCC-CEEEEeEEEECCCceE-EEcCCC
Confidence 35689999999 9999999999999999999999996 89999999999999997 9999999999999996 899999
Q ss_pred CHHHHHHHHHHHHHHHHHHHHH
Q psy17699 97 TQEEIEKLKKSAQAISQDYMYF 118 (149)
Q Consensus 97 s~eEqe~L~~Sa~~Ik~~i~~~ 118 (149)
|++|+++|++|++.||++++++
T Consensus 129 ~~~E~~~l~~Sa~~ik~~i~~l 150 (152)
T d1ojua2 129 SDEEIEKLRNSAKILRERLEEL 150 (152)
T ss_dssp CHHHHHHHHHHHHHHHHHHHTT
T ss_pred CHHHHHHHHHHHHHHHHHHHHc
Confidence 9999999999999999998753
|
| >d1uxja2 d.162.1.1 (A:144-307) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1llda2 d.162.1.1 (A:150-319) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d1y6ja2 d.162.1.1 (A:149-317) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1guza2 d.162.1.1 (A:143-305) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d1ez4a2 d.162.1.1 (A:163-334) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1i0za2 d.162.1.1 (A:161-332) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d5mdha2 d.162.1.1 (A:155-333) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1t2da2 d.162.1.1 (A:151-315) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1a5za2 d.162.1.1 (A:164-333) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ldma2 d.162.1.1 (A:161-329) Lactate dehydrogenase {Dogfish (Squalus acanthias) [TaxId: 7797]} | Back information, alignment and structure |
|---|
| >d1pzga2 d.162.1.1 (A:164-334) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1hyea2 d.162.1.1 (A:146-313) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d7mdha2 d.162.1.1 (A:198-385) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} | Back information, alignment and structure |
|---|
| >d1ldna2 d.162.1.1 (A:163-330) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1llca2 d.162.1.1 (A:165-334) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d2ldxa2 d.162.1.1 (A:160-331) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1y7ta2 d.162.1.1 (A:154-332) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1hyha2 d.162.1.1 (A:167-329) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1o6za2 d.162.1.1 (A:163-330) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d2cmda2 d.162.1.1 (A:146-312) Malate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b8pa2 d.162.1.1 (A:159-329) Malate dehydrogenase {Aquaspirillum arcticum [TaxId: 87645]} | Back information, alignment and structure |
|---|
| >d1mlda2 d.162.1.1 (A:145-313) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1up7a2 d.162.1.2 (A:163-415) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1s6ya2 d.162.1.2 (A:173-445) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1u8xx2 d.162.1.2 (X:170-445) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1obba2 d.162.1.2 (A:173-480) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vjta2 d.162.1.2 (A:192-469) Putative alpha-glucosidase TM0752 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|