Psyllid ID: psy17809

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290----
MELFEQHQGTHILQVEMTGSSVFDYIHQADHTELAEQLGLGLSQGHGLASPGSANSEEGSGMNTGTANPDVSSLMSLSSSSSYKGCDRSFCIRMKSTLTKRGCHFKSSGYRSLDGFAFALGSDGRFLYISETVSIYLGLSQWQVINKGQVLTHYYRLMNKNGGYTWVQSCATVVCSSKNADEQNIICVNYVISGREYENFIMDCCQLEDYIQQRGVKREEPSNNDPENDSPDADREDGRNSGDSRNHDHLSPPDIEDGTSEGDNSGDQRGRNHLDHVTQLHNISTPPEQSALTK
cHHHHHHHccccEEEEEEccEEEEEEccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccEEEEEccHHHHHHHccHHHHHHHcccccEEEEEEEEcccEEEEEEEEEEEEccccccccEEEEEEEEEccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccHHHHccccccEEEEccccHEEccccccHHHHHHHHccccccccccEcccccccccccEEEcccccccccccccccccEEccccccccccccccEEEEcccccccccccccccHHEEEcccEEEEEccHHHHHHHcccHHHHHHccccccHHHHHHHccccEEEEEEEEEEEEccccccccEEEEEEEEEcccccccEEEEHHHccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccc
melfeqhqgthILQVEMTGSSVFDYIHQADHTELAEQLglglsqghglaspgsanseegsgmntgtanpdvsslmslsssssykgcdrsfCIRMkstltkrgchfkssgyrsldgfafalgsdgrflYISETVSIYLGLSQWQVINKGQVLTHYYRLMnknggytwVQSCATVVcssknadeqnIICVNYVISGREYENFIMDCCQLEDYIQqrgvkreepsnndpendspdadredgrnsgdsrnhdhlsppdiedgtsegdnsgdqrgrnhldhvtqlhnistppeqsaltk
MELFEQHQGTHILQVEMTGSSVFDYIHQADHTELAEQLGLGLSQGHGLASPGSANSEEGSGMNTGTANPDVSSLMSLSSSSSYKGCDRSFCIRMKSTLTKRGCHFKSSGYRSLDGFAFALGSDGRFLYISETVSIYLGLSQWQVINKGQVLTHYYRLMNKNGGYTWVQSCATVVcssknadeqnIICVNYVISGREYENFIMDCCQLEDYIQQRGvkreepsnndpendspdadredgrnsgdsrnhdhlsppdiedgtseGDNSGDQRGRNHLDhvtqlhnistppeqsaltk
MELFEQHQGTHILQVEMTGSSVFDYIHQADHTELAEqlglglsqghglASPGSANSEEGSGMNTGTANPDVsslmslsssssYKGCDRSFCIRMKSTLTKRGCHFKSSGYRSLDGFAFALGSDGRFLYISETVSIYLGLSQWQVINKGQVLTHYYRLMNKNGGYTWVQSCATVVCSSKNADEQNIICVNYVISGREYENFIMDCCQLEDYIQQRGVKREEPSNNDPENDSPDADREDGRNSGDSRNHDHLSPPDIEDGTSEGDNSGDQRGRNHLDHVTQLHNISTPPEQSALTK
**********HILQVEMTGSSVFDYIHQADHTELAEQL**********************************************GCDRSFCIRMKSTLTKRGCHFKSSGYRSLDGFAFALGSDGRFLYISETVSIYLGLSQWQVINKGQVLTHYYRLMNKNGGYTWVQSCATVVCSSKNADEQNIICVNYVISGREYENFIMDCCQLEDYIQ**********************************************************************************
*ELFEQHQGTHILQVEMTGSSVFDYIHQADHTELAE**********************************VSSLMSLSSSSSYKGCDRSFCIRMKSTLTKRGCHFKSSGYRSLDGFAFALGSDGRFLYISETVSIYLGLSQWQVINKGQVLTHYYRLMNKNGGYTWVQSCATVVCSSKNADEQNIICVNYVISGREYENF**********************************************************************************************
*********THILQVEMTGSSVFDYIHQADHTELAEQLGLGLS********************TGTANPDVSS***********GCDRSFCIRMKSTLTKRGCHFKSSGYRSLDGFAFALGSDGRFLYISETVSIYLGLSQWQVINKGQVLTHYYRLMNKNGGYTWVQSCATVVCSSKNADEQNIICVNYVISGREYENFIMDCCQLEDYIQQRG********************************DHLSPPDIEDGTSEGDNSGDQRGRNHLDHVTQLHNIS**********
MELFEQHQGTHILQVEMTGSSVFDYIHQADHTELAEQLGLGLSQGHGLASPGSANSEEGSGMNTGTANPDVSSLMSLSSSSSYKGCDRSFCIRMKSTLTKRGCHFKSSGYRSLDGFAFALGSDGRFLYISETVSIYLGLSQWQVINKGQVLTHYYRLMNKNGGYTWVQSCATVVCSSKNADEQNIICVNYVISGREYENFIMDCCQLED*************************************************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELFEQHQGTHILQVEMTGSSVFDYIHQADHTELAEQLGLGLSQGHGLASPGSANSEEGSGMNTGTANPDVSSLMSLSSSSSYKGCDRSFCIRMKSTLTKRGCHFKSSGYRSLDGFAFALGSDGRFLYISETVSIYLGLSQWQVINKGQVLTHYYRLMNKNGGYTWVQSCATVVCSSKNADEQNIICVNYVISGREYENFIMDCCQLEDYIQQRGVKREEPSNNDPENDSPDADREDGRNSGDSRNHDHLSPPDIEDGTSEGDNSGDQRGRNHLDHVTQLHNISTPPEQSALTK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query294 2.2.26 [Sep-21-2011]
Q8IXF0 933 Neuronal PAS domain-conta yes N/A 0.697 0.219 0.331 5e-37
Q9QZQ0 925 Neuronal PAS domain-conta yes N/A 0.704 0.223 0.323 1e-36
Q24119 1022 Protein trachealess OS=Dr no N/A 0.404 0.116 0.565 3e-31
P97459594 Neuronal PAS domain-conta no N/A 0.731 0.361 0.301 6e-26
Q99742590 Neuronal PAS domain-conta no N/A 0.700 0.349 0.313 4e-24
P05709 697 Protein single-minded OS= no N/A 0.632 0.266 0.248 4e-15
Q98SW2 766 Hypoxia-inducible factor N/A N/A 0.561 0.215 0.254 7e-15
Q9XTA5 823 Hypoxia-inducible factor no N/A 0.557 0.199 0.259 4e-13
Q0PGG7 823 Hypoxia-inducible factor N/A N/A 0.557 0.199 0.259 4e-13
Q61221 836 Hypoxia-inducible factor no N/A 0.571 0.200 0.255 8e-13
>sp|Q8IXF0|NPAS3_HUMAN Neuronal PAS domain-containing protein 3 OS=Homo sapiens GN=NPAS3 PE=2 SV=1 Back     alignment and function desciption
 Score =  155 bits (391), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 102/308 (33%), Positives = 139/308 (45%), Gaps = 103/308 (33%)

Query: 1   MELFEQHQGTHILQ------------------------------VEMTGSSVFDYIHQAD 30
           +E+FE H G+HILQ                              VE+TGSSVFDY+H  D
Sbjct: 143 IEVFEAHLGSHILQSLDGFVFALNQEGKFLYISETVSIYLGLSQVELTGSSVFDYVHPGD 202

Query: 31  HTELAEQLGLGLSQGHGLASPGSANSEEGSGMNTGTA---NPDVSSLMSLSSSSSYKGCD 87
           H E+AEQLG+ L  G GL S G+A  E+G+   + ++    P+     S S  ++    +
Sbjct: 203 HVEMAEQLGMKLPPGRGLLSQGTA--EDGASSASSSSQSETPEPVESTSPSLLTTDNTLE 260

Query: 88  RSFCIRMKSTLTKRGCHFKSSGYRSL---------------------------------- 113
           RSF IRMKSTLTKRG H KSSGY+ +                                  
Sbjct: 261 RSFFIRMKSTLTKRGVHIKSSGYKVIHITGRLRLRVSLSHGRTVPSQIMGLVVVAHALPP 320

Query: 114 ----------DGFAFALGSDGRFLYISETVSIYLGLSQWQVI------------------ 145
                       F   +  D   +Y    +S Y+ L+   ++                  
Sbjct: 321 PTINEVRIDCHMFVTRVNMDLNIIYCENRISDYMDLTPVDIVGKRCYHFIHAEDVEGIRH 380

Query: 146 ------NKGQVLTHYYRLMNKNGGYTWVQSCATVVCSSKNADEQNIICVNYVISGREYEN 199
                 NKGQ +T YYR M KNGGY W+QS AT+  ++KNA+E+NII VNY++S  EY++
Sbjct: 381 SHLDLLNKGQCVTKYYRWMQKNGGYIWIQSSATIAINAKNANEKNIIWVNYLLSNPEYKD 440

Query: 200 FIMDCCQL 207
             MD  QL
Sbjct: 441 TPMDIAQL 448
May play a broad role in neurogenesis. May control regulatory pathways relevant to schizophrenia and to psychotic illness.
Homo sapiens (taxid: 9606)
>sp|Q9QZQ0|NPAS3_MOUSE Neuronal PAS domain-containing protein 3 OS=Mus musculus GN=Npas3 PE=2 SV=1 Back     alignment and function description
>sp|Q24119|TRH_DROME Protein trachealess OS=Drosophila melanogaster GN=trh PE=1 SV=4 Back     alignment and function description
>sp|P97459|NPAS1_MOUSE Neuronal PAS domain-containing protein 1 OS=Mus musculus GN=Npas1 PE=1 SV=1 Back     alignment and function description
>sp|Q99742|NPAS1_HUMAN Neuronal PAS domain-containing protein 1 OS=Homo sapiens GN=NPAS1 PE=2 SV=2 Back     alignment and function description
>sp|P05709|SIM_DROME Protein single-minded OS=Drosophila melanogaster GN=sim PE=1 SV=3 Back     alignment and function description
>sp|Q98SW2|HIF1A_ONCMY Hypoxia-inducible factor 1-alpha OS=Oncorhynchus mykiss GN=hif1a PE=2 SV=1 Back     alignment and function description
>sp|Q9XTA5|HIF1A_BOVIN Hypoxia-inducible factor 1-alpha OS=Bos taurus GN=HIF1A PE=2 SV=1 Back     alignment and function description
>sp|Q0PGG7|HIF1A_BOSMU Hypoxia-inducible factor 1-alpha OS=Bos mutus grunniens GN=HIF1A PE=2 SV=1 Back     alignment and function description
>sp|Q61221|HIF1A_MOUSE Hypoxia-inducible factor 1-alpha OS=Mus musculus GN=Hif1a PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query294
328712552 964 PREDICTED: protein trachealess-like [Acy 0.945 0.288 0.445 7e-63
112984028 849 trachealess [Bombyx mori] gi|2564053|dbj 0.948 0.328 0.425 9e-63
270015606 851 trachealess [Tribolium castaneum] 0.959 0.331 0.405 6e-60
320545371 966 trachealess, isoform C [Drosophila melan 0.887 0.270 0.417 5e-59
307182730 965 Protein trachealess [Camponotus floridan 0.921 0.280 0.406 8e-58
307202142 927 Protein trachealess [Harpegnathos saltat 0.945 0.299 0.406 2e-57
322788144 739 hypothetical protein SINV_02826 [Solenop 0.877 0.349 0.436 2e-57
189241974 820 PREDICTED: similar to Bm trachealess [Tr 0.952 0.341 0.400 2e-57
328787564 986 PREDICTED: protein trachealess-like isof 0.928 0.276 0.403 3e-56
332027679 953 Protein trachealess [Acromyrmex echinati 0.880 0.271 0.426 6e-56
>gi|328712552|ref|XP_001949586.2| PREDICTED: protein trachealess-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  246 bits (629), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 170/382 (44%), Positives = 209/382 (54%), Gaps = 104/382 (27%)

Query: 1   MELFEQHQGTHILQ------------------------------VEMTGSSVFDYIHQAD 30
           +ELFEQHQGTHILQ                              VEMTGSSVFDYIHQAD
Sbjct: 108 LELFEQHQGTHILQSLDGFAFALAADGRFLYISETVSIYLGLSQVEMTGSSVFDYIHQAD 167

Query: 31  HTELAEQLGLGLSQGHGLASPGSANSEEGSGM-NTGTANPDVSSLMSLS----------- 78
           H+ELAEQLGLGL+QG G+ASP  +++    G  N GTANPDVSS+MSLS           
Sbjct: 168 HSELAEQLGLGLTQGQGMASPSPSSAGSEEGSSNVGTANPDVSSVMSLSSTNAYKGLDRA 227

Query: 79  ------SSSSYKGCDRS--------FCIRMKSTLT---KRGCHFKSSGYRSL-------- 113
                 S+ + +GC              R++   T    R C     G  SL        
Sbjct: 228 FCIRMKSTLTKRGCHFKSSGYRVVLLICRLRPQYTFSHNRKCAPPLLGAVSLAIALPPPS 287

Query: 114 --------DGFAFALGSDGRFLYISETVSIYL--------GLSQWQV------------- 144
                   D F   L  D R  +    V+  L        G++ + +             
Sbjct: 288 VHEIRLETDMFVTRLYFDFRIAHCEPRVAEILDYTADELTGMNMYTLCHGEDVGKLRKCH 347

Query: 145 ---INKGQVLTHYYRLMNKNGGYTWVQSCATVVCSSKNADEQNIICVNYVISGREYENFI 201
              INKGQ++THYYR+MNKNGGYTW+Q+C TVVC+SKNA+EQNIICVNYV+S RE++N I
Sbjct: 348 LDLINKGQMMTHYYRVMNKNGGYTWMQTCGTVVCNSKNAEEQNIICVNYVVSAREFDNLI 407

Query: 202 MDCCQLEDYIQQRGVKREEPSNNDPENDSPDADREDGRNSGDSRNHDHLSPPDIEDGTSE 261
           MDCCQ+E++I+QR VKREE   NDPEN SPD    DGR     R  DHL+P D++DG S 
Sbjct: 408 MDCCQMEEHIRQRAVKREETGGNDPENGSPDGGGGDGRGGNPRR--DHLTPADLDDGHS- 464

Query: 262 GDNSGDQ-RGRNHLDHVTQLHN 282
            D  GD  RGRNH+D +TQL+N
Sbjct: 465 ADGQGDPTRGRNHVD-ITQLNN 485

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|112984028|ref|NP_001036830.1| trachealess [Bombyx mori] gi|2564053|dbj|BAA22946.1| Bm trachealess [Bombyx mori] Back     alignment and taxonomy information
>gi|270015606|gb|EFA12054.1| trachealess [Tribolium castaneum] Back     alignment and taxonomy information
>gi|320545371|ref|NP_001097461.2| trachealess, isoform C [Drosophila melanogaster] gi|318069090|gb|ABW08426.2| trachealess, isoform C [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|307182730|gb|EFN69854.1| Protein trachealess [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307202142|gb|EFN81642.1| Protein trachealess [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322788144|gb|EFZ13926.1| hypothetical protein SINV_02826 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|189241974|ref|XP_967112.2| PREDICTED: similar to Bm trachealess [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328787564|ref|XP_391937.3| PREDICTED: protein trachealess-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|332027679|gb|EGI67747.1| Protein trachealess [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query294
FB|FBgn0262139 1022 trh "trachealess" [Drosophila 0.418 0.120 0.556 5.5e-55
UNIPROTKB|F8VS42 906 NPAS3 "Neuronal PAS domain-con 0.489 0.158 0.372 4.6e-39
UNIPROTKB|F7HC48 932 NPAS3 "Uncharacterized protein 0.493 0.155 0.367 6.7e-39
UNIPROTKB|F6VP83 913 NPAS3 "Uncharacterized protein 0.493 0.158 0.367 9.9e-39
UNIPROTKB|Q8IXF0 933 NPAS3 "Neuronal PAS domain-con 0.493 0.155 0.367 1.1e-38
UNIPROTKB|F8VR32 938 NPAS3 "Neuronal PAS domain-con 0.493 0.154 0.367 1.1e-38
MGI|MGI:1351610 925 Npas3 "neuronal PAS domain pro 0.493 0.156 0.361 4.5e-38
UNIPROTKB|F1NG48 727 NPAS3 "Uncharacterized protein 0.425 0.171 0.393 1.7e-35
ZFIN|ZDB-GENE-060503-934 770 npas3b "neuronal PAS domain pr 0.636 0.242 0.296 5.4e-30
UNIPROTKB|E1B815 587 NPAS1 "Uncharacterized protein 0.329 0.165 0.414 1.4e-28
FB|FBgn0262139 trh "trachealess" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 347 (127.2 bits), Expect = 5.5e-55, Sum P(3) = 5.5e-55
 Identities = 74/133 (55%), Positives = 89/133 (66%)

Query:   140 SQWQVINKGQVLTHYYRLMNKNGGYTWVQSCATVVCSSKNADEQNIICVNYVISGREYEN 199
             S   +I KGQVLT YYRLMNK+GGYTW+Q+CATVVCS+KNADEQNIICVNYVIS RE EN
Sbjct:   453 SHSDLIEKGQVLTGYYRLMNKSGGYTWLQTCATVVCSTKNADEQNIICVNYVISNRENEN 512

Query:   200 FIMDCCQLEDYIQQRGVKREEPSNNDPENDSPDADREDGRNSGDSRNHDHLSPPDIEDGT 259
              I+DCCQLE       +K EE   ND  + SP  D      SG+  +H  LS  D++  +
Sbjct:   513 MILDCCQLEP--SPDSIKHEEGLGNDKSSGSPGGDA-----SGEGNSH--LSAGDMKLNS 563

Query:   260 SEGDNSG-DQRGR 271
              + D+ G   RGR
Sbjct:   564 PKTDSEGHSHRGR 576
GO:0072175 "epithelial tube formation" evidence=IMP
GO:0005634 "nucleus" evidence=ISS;NAS;IDA;TAS
GO:0000981 "sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=ISS
GO:0007424 "open tracheal system development" evidence=NAS;IMP;TAS
GO:0007431 "salivary gland development" evidence=NAS;IMP
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0001077 "RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription" evidence=IPI
GO:0046982 "protein heterodimerization activity" evidence=TAS;IPI
GO:0035277 "spiracle morphogenesis, open tracheal system" evidence=IMP
GO:0007443 "Malpighian tubule morphogenesis" evidence=IMP
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=NAS;TAS;IPI
GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=NAS
GO:0007425 "epithelial cell fate determination, open tracheal system" evidence=IMP;TAS
GO:0007435 "salivary gland morphogenesis" evidence=IMP;TAS
GO:0004871 "signal transducer activity" evidence=IEA
GO:0007165 "signal transduction" evidence=IEA
GO:0048813 "dendrite morphogenesis" evidence=IMP
GO:0043565 "sequence-specific DNA binding" evidence=IDA
GO:0046331 "lateral inhibition" evidence=IMP
UNIPROTKB|F8VS42 NPAS3 "Neuronal PAS domain-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F7HC48 NPAS3 "Uncharacterized protein" [Callithrix jacchus (taxid:9483)] Back     alignment and assigned GO terms
UNIPROTKB|F6VP83 NPAS3 "Uncharacterized protein" [Macaca mulatta (taxid:9544)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IXF0 NPAS3 "Neuronal PAS domain-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F8VR32 NPAS3 "Neuronal PAS domain-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1351610 Npas3 "neuronal PAS domain protein 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NG48 NPAS3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-934 npas3b "neuronal PAS domain protein 3b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1B815 NPAS1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query294
pfam0844790 pfam08447, PAS_3, PAS fold 2e-06
cd00130103 cd00130, PAS, PAS domain; PAS motifs appear in arc 3e-05
smart0008643 smart00086, PAC, Motif C-terminal to PAS motifs (l 9e-05
>gnl|CDD|219844 pfam08447, PAS_3, PAS fold Back     alignment and domain information 
 Score = 45.1 bits (107), Expect = 2e-06
 Identities = 12/45 (26%), Positives = 22/45 (48%), Gaps = 1/45 (2%)

Query: 145 INKGQVLTHYYRLMNKNGGYTWVQSCATVVCSSKNADEQNIICVN 189
           + KG+  +  YR+  K+G Y WV++    +   +N     +I V 
Sbjct: 47  LKKGEPYSGEYRIRRKDGEYRWVEARGRPIR-DENGKPVRVIGVA 90

The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya. Length = 90
>gnl|CDD|238075 cd00130, PAS, PAS domain; PAS motifs appear in archaea, eubacteria and eukarya Back     alignment and domain information
>gnl|CDD|197509 smart00086, PAC, Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 294
KOG3558|consensus 768 100.0
KOG3560|consensus 712 100.0
KOG3559|consensus 598 100.0
PF14598111 PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W 99.88
KOG3561|consensus 803 99.76
KOG3753|consensus 1114 98.97
PF0844791 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold 98.17
PF14598111 PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W 96.86
KOG3561|consensus 803 96.75
PF13426104 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_ 95.04
PF00989113 PAS: PAS fold; InterPro: IPR013767 PAS domains are 93.58
smart0008643 PAC Motif C-terminal to PAS motifs (likely to cont 93.58
PF00989113 PAS: PAS fold; InterPro: IPR013767 PAS domains are 92.84
PF0844791 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold 91.73
PRK09776 1092 putative diguanylate cyclase; Provisional 90.19
cd00130103 PAS PAS domain; PAS motifs appear in archaea, euba 90.18
KOG3558|consensus 768 87.39
PF08448110 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold 85.75
cd00130103 PAS PAS domain; PAS motifs appear in archaea, euba 80.11
>KOG3558|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.8e-59  Score=470.22  Aligned_cols=213  Identities=44%  Similarity=0.666  Sum_probs=179.5

Q ss_pred             chhhhhhCCcceeeeecCCccccccCcccHHHHHHHhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccccccCCC
Q psy17809          2 ELFEQHQGTHILQVEMTGSSVFDYIHQADHTELAEQLGLGLSQGHGLASPGSANSEEGSGMNTGTANPDVSSLMSLSSSS   81 (294)
Q Consensus         2 ~~~e~~LG~h~~QvDl~GqSVfD~IHP~Dh~E~reQL~~~~~~~~~~~~P~~~~~~~~s~~~~~t~~p~v~a~~~~~~~~   81 (294)
                      |.|+.|||  ++||||||+||||||||+||+||+|||++.+..      |....+                  +      
T Consensus       146 EtVS~yLG--LSQvELTG~SvFDfiHP~DheE~~eqL~l~~~~------p~~~es------------------~------  193 (768)
T KOG3558|consen  146 ETVSIYLG--LSQVELTGSSVFDFIHPCDHEEIAEQLGLRLTT------PEVKES------------------T------  193 (768)
T ss_pred             chhHhhhC--ccceeeecchhhhccCccCHHHHHHHhccccCC------Cccccc------------------c------
Confidence            78999999  889999999999999999999999999987531      211100                  0      


Q ss_pred             CCCCCCcceeeeccccccCCcc--cccCCCceeee--e------------------------e--EEeec----------
Q psy17809         82 SYKGCDRSFCIRMKSTLTKRGC--HFKSSGYRSLD--G------------------------F--AFALG----------  121 (294)
Q Consensus        82 ~~~~~~RsF~cRMKc~Lt~Rg~--~lkssgyKViH--G------------------------~--aialP----------  121 (294)
                       ....+|+||+|||||||+||+  |||+++|||||  |                        |  |+++|          
T Consensus       194 -~~~teRsFflRMKsTLT~RGRtlnlKSa~yKvlh~tgh~rv~~~~sh~s~~~g~~~Pl~~lV~~a~alp~ps~~EipL~  272 (768)
T KOG3558|consen  194 -DTSTERSFFLRMKSTLTKRGRTLNLKSAGYKVLHCTGHLRVYNNPSHNSPLCGYKEPLLGLVALAEALPPPSYTEIPLD  272 (768)
T ss_pred             -cCccceeEEEEeeeeeccCCceeeeeccceeEEEEeeeeeeccCCCCCCcccCccccchheeeeeccCCCCcccccccC
Confidence             013489999999999999994  99999999999  1                        2  33444          


Q ss_pred             ---------cCceEEeeccccceeecc------------------------ceeeEeeecceeeeEEEeeeeCCcEEEEE
Q psy17809        122 ---------SDGRFLYISETVSIYLGL------------------------SQWQVINKGQVLTHYYRLMNKNGGYTWVQ  168 (294)
Q Consensus       122 ---------lD~kf~~~D~Rvs~~LGy------------------------sH~~LL~KGQ~~t~~YR~l~K~G~wVWlq  168 (294)
                               |||||+|||+||+++|||                        +|++||.|||++|+|||||+|+|||||+|
T Consensus       273 ~~~FvtRhs~DmkityCedRisdlm~y~PeeLvGrS~Ye~~Ha~Ds~~v~KSh~dL~~KGQv~TgyYR~lak~GGyvWlQ  352 (768)
T KOG3558|consen  273 CHMFVTRHSLDMKITYCEDRISDLMDYEPEELVGRSCYEFVHALDSDRVRKSHHDLLTKGQVVTGYYRLLAKNGGYVWLQ  352 (768)
T ss_pred             CceeEEeeecceeEEEEchhHHHHhcCCHHHhhchhHHHhhhHhhhhHHHHHHHHHHhcCccchhHHHHHHhcCCeEEEE
Confidence                     999999999999999999                        79999999999999999999999999999


Q ss_pred             EEEEEeecCCCCCcCcEEEEeEEecCccccceecccccccccccccCccccCCCCCCCCCCCCCCCcCCCCCCCCCCCCC
Q psy17809        169 SCATVVCSSKNADEQNIICVNYVISGREYENFIMDCCQLEDYIQQRGVKREEPSNNDPENDSPDADREDGRNSGDSRNHD  248 (294)
Q Consensus       169 T~~~vv~n~kn~~~e~IVcvn~vlS~~E~~~~~l~~~Q~~~~~~~~~~k~e~~~~~d~~~~~~~~~~~~~~~~~~~~~~~  248 (294)
                      |+|||+||+||.++++|||||||||.+|+++++|+++|+|+.+.  +||.|....+|.-...|+.    -....|++|.+
T Consensus       353 TqATVi~~tkn~q~q~IicVnYVlS~~e~~~~vl~~~Q~e~~~~--~i~~~~~~~~dk~~~eP~~----~~~t~g~~ii~  426 (768)
T KOG3558|consen  353 TQATVIYNTKNPQEQNIICVNYVLSNIEEEDLVLDLDQLPASVK--PIKEESSDGSDKSKPEPEI----LAPTPGTPIIS  426 (768)
T ss_pred             eeeEEEecCCCCCcceEEEEEeeeccccccCceeeHhhCccccc--cccccccCcccccCCCccc----cCCCCCCcccc
Confidence            99999999999999999999999999999999999999999876  5777777677776666643    33445555555


Q ss_pred             CCCCC
Q psy17809        249 HLSPP  253 (294)
Q Consensus       249 ~~~~~  253 (294)
                      ...+.
T Consensus       427 ~~~~~  431 (768)
T KOG3558|consen  427 LENGD  431 (768)
T ss_pred             ccCCc
Confidence            44444

>KOG3560|consensus Back     alignment and domain information
>KOG3559|consensus Back     alignment and domain information
>PF14598 PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W_A 3F1P_A 3H82_A 3F1N_A 4F3L_B 4DJ3_A 2KDK_A Back     alignment and domain information
>KOG3561|consensus Back     alignment and domain information
>KOG3753|consensus Back     alignment and domain information
>PF08447 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>PF14598 PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W_A 3F1P_A 3H82_A 3F1N_A 4F3L_B 4DJ3_A 2KDK_A Back     alignment and domain information
>KOG3561|consensus Back     alignment and domain information
>PF13426 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_B 3P7N_B 1LL8_A 3MJQ_A 3BWL_A 4EET_B 4EEP_A Back     alignment and domain information
>PF00989 PAS: PAS fold; InterPro: IPR013767 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain [] Back     alignment and domain information
>smart00086 PAC Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain) Back     alignment and domain information
>PF00989 PAS: PAS fold; InterPro: IPR013767 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain [] Back     alignment and domain information
>PF08447 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>PRK09776 putative diguanylate cyclase; Provisional Back     alignment and domain information
>cd00130 PAS PAS domain; PAS motifs appear in archaea, eubacteria and eukarya Back     alignment and domain information
>KOG3558|consensus Back     alignment and domain information
>PF08448 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>cd00130 PAS PAS domain; PAS motifs appear in archaea, eubacteria and eukarya Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query294
4h6j_A113 Identification Of Cys 255 In Hif-1 As A Novel Site 1e-10
3f1n_A117 Crystal Structure Of A High Affinity Heterodimer Of 7e-08
1p97_A114 Nmr Structure Of The C-Terminal Pas Domain Of Hif2a 8e-08
2a24_A107 Haddock Structure Of Hif-2aARNT PAS-B Heterodimer L 1e-07
>pdb|4H6J|A Chain A, Identification Of Cys 255 In Hif-1 As A Novel Site For Development Of Covalent Inhibitors Of Hif-1 ARNT PASB DOMAIN PROTEIN-Protein Interaction Length = 113 Back     alignment and structure 
Iteration: 1

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 38/51 (74%)
Query: 144 VINKGQVLTHYYRLMNKNGGYTWVQSCATVVCSSKNADEQNIICVNYVISG 194
           +  KGQV T  YR++ K GGY WV++ ATV+ ++KN+  Q I+CVNYV+SG
Sbjct: 59  MFTKGQVTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSG 109
>pdb|3F1N|A Chain A, Crystal Structure Of A High Affinity Heterodimer Of Hif2 Alpha And Arnt C-Terminal Pas Domains, With Internally Bound Ethylene Glycol. Length = 117 Back     alignment and structure
>pdb|1P97|A Chain A, Nmr Structure Of The C-Terminal Pas Domain Of Hif2a Length = 114 Back     alignment and structure
>pdb|2A24|A Chain A, Haddock Structure Of Hif-2aARNT PAS-B Heterodimer Length = 107 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query294
4f3l_B387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 2e-27
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 6e-05
4f3l_A361 Mclock, circadian locomoter output cycles protein 2e-26
4f3l_A361 Mclock, circadian locomoter output cycles protein 7e-06
4dj2_A320 Period circadian protein homolog 1; PAS domains, c 2e-23
4dj2_A 320 Period circadian protein homolog 1; PAS domains, c 2e-05
3gdi_A309 Period circadian protein homolog 2; tandem PAS dom 6e-23
3gdi_A 309 Period circadian protein homolog 2; tandem PAS dom 2e-05
3rty_A339 Period circadian protein; PAS domain, signalling, 4e-22
3rty_A 339 Period circadian protein; PAS domain, signalling, 2e-04
3f1p_A117 Endothelial PAS domain-containing protein 1; PAS d 3e-20
4dj3_A317 Period circadian protein homolog 3; PAS domain, ci 4e-20
4dj3_A317 Period circadian protein homolog 3; PAS domain, ci 4e-05
3f1p_B121 ARYL hydrocarbon receptor nuclear translocator; PA 8e-19
2kdk_A121 ARYL hydrocarbon receptor nuclear translocator-LI 2e-18
1oj5_A132 Steroid receptor coactivator 1A; transcriptional c 5e-07
2vlg_A111 Sporulation kinase A; histidine kinase, two-compon 7e-07
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 387 Back     alignment and structure
 Score =  108 bits (272), Expect = 2e-27
 Identities = 37/267 (13%), Positives = 77/267 (28%), Gaps = 79/267 (29%)

Query: 11  HILQVEMTGSSVFDYIHQADHTELAEQLGLGL---SQGHGLASPGSANSEEGSGMNTGTA 67
           +  Q ++ G S+FDY+H  D  ++ EQL        +    A  G     + +   +   
Sbjct: 121 NYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLC 180

Query: 68  NPDVSS----LMSLSSSSSYKGCDRSFCIRMKSTLTKRGCHFKSSGY--------RSLDG 115
           +    S    +     S   +  D +     K    K  C   S+GY          LD 
Sbjct: 181 SGARRSFFCRMKCNRPSVKVEDKDFASTCSKKKADRKSFCTIHSTGYLKSWPPTKMGLDE 240

Query: 116 ---------------------------------------FAFALGSDGRFLYISETVSIY 136
                                                  +      DG+F+++ +  +  
Sbjct: 241 DNEPDNEGCNLSCLVAIGRLHSHMVPQPANGEIRVKSMEYVSRHAIDGKFVFVDQRATAI 300

Query: 137 LGLSQWQVIN-------------------------KGQVLTHYYRLMNKNGGYTWVQSCA 171
           L     +++                          + ++ T+ Y+   K+G +  ++S  
Sbjct: 301 LAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRW 360

Query: 172 TVVCSSKNADEQNIICVNYVISGREYE 198
               +    + + I+  N V+     E
Sbjct: 361 FSFMNPWTKEVEYIVSTNTVVLANVLE 387
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 387 Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 361 Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 361 Back     alignment and structure
>4dj2_A Period circadian protein homolog 1; PAS domains, circadian clock protein, protein binding; 2.75A {Mus musculus} Length = 320 Back     alignment and structure
>4dj2_A Period circadian protein homolog 1; PAS domains, circadian clock protein, protein binding; 2.75A {Mus musculus} Length = 320 Back     alignment and structure
>3gdi_A Period circadian protein homolog 2; tandem PAS domains, biological rhythms, cytoplasm, nucleus, phosphoprotein, transcription; 2.40A {Mus musculus} Length = 309 Back     alignment and structure
>3gdi_A Period circadian protein homolog 2; tandem PAS domains, biological rhythms, cytoplasm, nucleus, phosphoprotein, transcription; 2.40A {Mus musculus} Length = 309 Back     alignment and structure
>3rty_A Period circadian protein; PAS domain, signalling, timeless, circadian clock protein; 2.85A {Drosophila melanogaster} PDB: 1wa9_A 3gec_A Length = 339 Back     alignment and structure
>3rty_A Period circadian protein; PAS domain, signalling, timeless, circadian clock protein; 2.85A {Drosophila melanogaster} PDB: 1wa9_A 3gec_A Length = 339 Back     alignment and structure
>3f1p_A Endothelial PAS domain-containing protein 1; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} PDB: 3f1o_A* 3f1n_A 3h7w_A* 3h82_A* 1p97_A 2a24_A Length = 117 Back     alignment and structure
>4dj3_A Period circadian protein homolog 3; PAS domain, circadian rhythm, protein binding; 2.50A {Mus musculus} Length = 317 Back     alignment and structure
>4dj3_A Period circadian protein homolog 3; PAS domain, circadian rhythm, protein binding; 2.50A {Mus musculus} Length = 317 Back     alignment and structure
>3f1p_B ARYL hydrocarbon receptor nuclear translocator; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} PDB: 3f1o_B* 3f1n_B 3h7w_B* 3h82_B* 1x0o_A 2hv1_A 2b02_A* 2k7s_A 2a24_B Length = 121 Back     alignment and structure
>2kdk_A ARYL hydrocarbon receptor nuclear translocator-LI 2; circadian clock, PAS domain, transcription, activator, biolo rhythms, DNA-binding, nucleus; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>1oj5_A Steroid receptor coactivator 1A; transcriptional coactivator, complex, LXXLL motif, transcriptional regulation; 2.2A {Mus musculus} SCOP: d.110.3.8 Length = 132 Back     alignment and structure
>2vlg_A Sporulation kinase A; histidine kinase, two-component regulatory system, two-component signal transduction, transferase, phosphorylation, SCOD; 1.7A {Bacillus subtilis} Length = 111 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query294
4dj2_A320 Period circadian protein homolog 1; PAS domains, c 100.0
4dj3_A317 Period circadian protein homolog 3; PAS domain, ci 100.0
3gdi_A309 Period circadian protein homolog 2; tandem PAS dom 100.0
4f3l_B387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 99.97
3rty_A339 Period circadian protein; PAS domain, signalling, 99.96
4f3l_A361 Mclock, circadian locomoter output cycles protein 99.92
1oj5_A132 Steroid receptor coactivator 1A; transcriptional c 99.82
3f1p_A117 Endothelial PAS domain-containing protein 1; PAS d 98.82
2vlg_A111 Sporulation kinase A; histidine kinase, two-compon 98.76
3f1p_B121 ARYL hydrocarbon receptor nuclear translocator; PA 98.75
2kdk_A121 ARYL hydrocarbon receptor nuclear translocator-LI 98.6
3h9w_A115 Diguanylate cyclase with PAS/PAC sensor; alpha-bet 97.78
3mr0_A142 Sensory box histidine kinase/response regulator; P 96.66
3icy_A118 Sensor protein; sensory box histidine kinase/respo 96.61
3nja_A125 Probable ggdef family protein; structural genomics 96.26
3f1p_B121 ARYL hydrocarbon receptor nuclear translocator; PA 96.15
3f1p_A117 Endothelial PAS domain-containing protein 1; PAS d 96.1
1n9l_A109 PHOT-LOV1, putative blue light receptor; phototrop 95.96
4eet_B115 Phototropin-2; LOV, blue light photoreceptor, sign 95.91
4hia_A176 LOV protein; PAS, HTH, signaling protein; HET: FMN 95.4
2gj3_A120 Nitrogen fixation regulatory protein; PAS domain, 95.37
3mqq_A120 Transcriptional regulator, LUXR family; PAS domain 95.36
4dj2_A320 Period circadian protein homolog 1; PAS domains, c 95.21
3gdi_A309 Period circadian protein homolog 2; tandem PAS dom 95.04
2kdk_A121 ARYL hydrocarbon receptor nuclear translocator-LI 95.0
3ue6_A166 Aureochrome1; PAS/LOV domain, FMN-binding blue-lig 94.99
3rty_A339 Period circadian protein; PAS domain, signalling, 94.98
4dj3_A317 Period circadian protein homolog 3; PAS domain, ci 94.94
2pr5_A132 Blue-light photoreceptor; light-oxygen-voltage, LO 94.91
3t50_A128 Blue-light-activated histidine kinase; PAS superfa 94.74
3ewk_A227 Sensor protein; PAS domain, alpha/beta fold, kinas 94.7
3eeh_A125 Putative light and redox sensing histidine kinase; 94.56
4f3l_B387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 94.43
3lyx_A124 Sensory BOX/ggdef domain protein; structural genom 94.24
3p7n_A258 Sensor histidine kinase; LOV domain, light-activat 94.22
2wkq_A 332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 94.19
4f3l_A361 Mclock, circadian locomoter output cycles protein 94.17
2v0u_A146 NPH1-1, LOV2; kinase, transferase, ATP-binding, se 93.57
3d72_A149 Vivid PAS protein VVD; circadian, photoreceptor, b 92.89
1byw_A110 Protein (human ERG potassium channel); PAS domain, 92.85
3luq_A114 Sensor protein; PAS, histidine, kinase, PSI, MCSG, 92.81
2z6d_A130 Phototropin-2; PAS-fold, LOV-fold, alternative spl 92.78
3olo_A118 Two-component sensor histidine kinase; structural 92.4
2r78_A117 Sensor protein; sensory box sensor histidine kinas 92.22
2vlg_A111 Sporulation kinase A; histidine kinase, two-compon 92.06
3sw1_A162 Sensory box protein; light-oxygen-voltage, LOV, PA 91.49
3icy_A118 Sensor protein; sensory box histidine kinase/respo 90.94
2l0w_A138 Potassium voltage-gated channel, subfamily H (EAG 90.59
3h9w_A115 Diguanylate cyclase with PAS/PAC sensor; alpha-bet 89.28
3mjq_A126 Uncharacterized protein; NESG, structural genomics 88.61
3ewk_A227 Sensor protein; PAS domain, alpha/beta fold, kinas 88.43
3mfx_A129 Sensory BOX/ggdef family protein; alpha-beta prote 88.41
4eho_A635 Bacteriophytochrome, PAS/PAC sensor; photoreceptor 87.2
1oj5_A132 Steroid receptor coactivator 1A; transcriptional c 86.7
3bwl_A126 Sensor protein; structural genomics, APC87707.1, P 85.01
3mr0_A142 Sensory box histidine kinase/response regulator; P 84.34
3nja_A125 Probable ggdef family protein; structural genomics 84.23
>4dj2_A Period circadian protein homolog 1; PAS domains, circadian clock protein, protein binding; 2.75A {Mus musculus} Back     alignment and structure
Probab=100.00  E-value=1.9e-34  Score=272.52  Aligned_cols=172  Identities=14%  Similarity=0.121  Sum_probs=126.3

Q ss_pred             chhhhhhCCcceeeeecCCccccccCcccHHHHHHHhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccccccCCC
Q psy17809          2 ELFEQHQGTHILQVEMTGSSVFDYIHQADHTELAEQLGLGLSQGHGLASPGSANSEEGSGMNTGTANPDVSSLMSLSSSS   81 (294)
Q Consensus         2 ~~~e~~LG~h~~QvDl~GqSVfD~IHP~Dh~E~reQL~~~~~~~~~~~~P~~~~~~~~s~~~~~t~~p~v~a~~~~~~~~   81 (294)
                      |.|+++||  +.|.||+|+|+||||||+||++|++||....       -|..     .++    +  +. +      +..
T Consensus        54 ~sv~~~Lg--~~~~~l~g~s~~d~iHp~D~~~f~~qL~~~~-------lp~~-----~~~----~--~~-~------~~~  106 (320)
T 4dj2_A           54 EQAGVLLR--CKRDVFRGARFSELLAPQDVGVFYGSTTPSR-------LPTW-----GTG----T--SA-G------SGL  106 (320)
T ss_dssp             THHHHHHT--SCSTTTTTSBGGGGBCHHHHHHHHHHCCTTT-------CCBT-----TC---------------------
T ss_pred             cHHHHHhC--cCHHHHcCCcHHHhcCHHHHHHHHHhhcccC-------CCCc-----ccC----c--cc-c------ccc
Confidence            67899999  5599999999999999999999999998531       1100     000    0  00 0      001


Q ss_pred             CCCCCCcceeeeccccccCCcccccCCCceeee--e-----------------eEEeec---------------------
Q psy17809         82 SYKGCDRSFCIRMKSTLTKRGCHFKSSGYRSLD--G-----------------FAFALG---------------------  121 (294)
Q Consensus        82 ~~~~~~RsF~cRMKc~Lt~Rg~~lkssgyKViH--G-----------------~aialP---------------------  121 (294)
                      .....+|+|||||||.++++    +..+|+++|  |                 |+++.|                     
T Consensus       107 ~~~~~~rsF~CRmr~~l~k~----~~~~Y~~~~~~g~lk~~~~~~g~~~~~~~li~a~~~~s~~~~~~i~~~~~~Fitrh  182 (320)
T 4dj2_A          107 KDFTQEKSVFCRIRGGPDRD----PGPRYQPFRLTPYVTKIRVSDGAPAQPCCLLIAERIHSGYEAPRIPPDKRIFTTRH  182 (320)
T ss_dssp             -----CCCEEEEECCC-----------CCEEEEEEEEEEEECC---CCCEEEEEEEEEECCCSSSSSCCCGGGCEEEEEE
T ss_pred             ccCCCceeEEEEEEEeccCC----CcccEEEEEEEEEecccccCCCCcccceeeeeeeeccCccccccccCCCceEEEEe
Confidence            12367899999999998664    234677776  2                 222221                     


Q ss_pred             -cCceEEeeccccceeecc------------------------ceeeEee-eccee-eeEEEeeeeCCcEEEEEEEEEEe
Q psy17809        122 -SDGRFLYISETVSIYLGL------------------------SQWQVIN-KGQVL-THYYRLMNKNGGYTWVQSCATVV  174 (294)
Q Consensus       122 -lD~kf~~~D~Rvs~~LGy------------------------sH~~LL~-KGQ~~-t~~YR~l~K~G~wVWlqT~~~vv  174 (294)
                       +||+|+|||+++..+|||                        .|..+++ +|+.. +..|||++|+|+|||++|.|+++
T Consensus       183 ~~dG~~~yvd~~~~~lLGY~peELig~s~~~~vHPdD~~~~~~~~~~~l~~~g~~~~~~~yR~~~kdG~~vwvet~~~~~  262 (320)
T 4dj2_A          183 TPSCLFQDVDERAAPLLGYLPQDLLGAPVLLFLHPEDRPLMLAIHKKILQLAGQPFDHSPIRFCARNGEYVTMDTSWAGF  262 (320)
T ss_dssp             CTTCBEEEECTTHHHHHSCCHHHHTTSBGGGGBCGGGHHHHHHHHHHHTTSSSCCEECCCEEEECSSSCEEEEECEEEEE
T ss_pred             cCCceEEEcCcceeccCCcChHHHcCCcHHHhCCHHHHHHHHHHHHHHHhcCCCcccceEEEEEccCCCEEEEEEEEEEE
Confidence             799999999999999999                        3445665 67776 57899999999999999999999


Q ss_pred             ecCCCCCcCcEEEEeEEecCccccceeccccccc
Q psy17809        175 CSSKNADEQNIICVNYVISGREYENFIMDCCQLE  208 (294)
Q Consensus       175 ~n~kn~~~e~IVcvn~vlS~~E~~~~~l~~~Q~~  208 (294)
                      +|||+++++||||+|+|+++++..+    ++|.+
T Consensus       263 ~np~s~~~e~II~~h~v~~gp~~~d----vf~~~  292 (320)
T 4dj2_A          263 VHPWSRKVAFVLGRHKVRTAPLNED----VFTPP  292 (320)
T ss_dssp             ECTTTCSEEEEEEEEEESSCCSSCC----CSSCC
T ss_pred             ECCCCCCccEEEEEEEEccCCCCCC----cccCC
Confidence            9999999999999999999999876    56655
>4dj3_A Period circadian protein homolog 3; PAS domain, circadian rhythm, protein binding; 2.50A {Mus musculus} Back     alignment and structure
>3gdi_A Period circadian protein homolog 2; tandem PAS domains, biological rhythms, cytoplasm, nucleus, phosphoprotein, transcription; 2.40A {Mus musculus} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>3rty_A Period circadian protein; PAS domain, signalling, timeless, circadian clock protein; 2.85A {Drosophila melanogaster} PDB: 1wa9_A 3gec_A Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>1oj5_A Steroid receptor coactivator 1A; transcriptional coactivator, complex, LXXLL motif, transcriptional regulation; 2.2A {Mus musculus} SCOP: d.110.3.8 Back     alignment and structure
>3f1p_A Endothelial PAS domain-containing protein 1; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.7 PDB: 3f1o_A* 3f1n_A 3h7w_A* 3h82_A* 1p97_A 2a24_A 4h6j_A Back     alignment and structure
>2vlg_A Sporulation kinase A; histidine kinase, two-component regulatory system, two-component signal transduction, transferase, phosphorylation, SCOD; 1.7A {Bacillus subtilis} Back     alignment and structure
>3f1p_B ARYL hydrocarbon receptor nuclear translocator; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.0 PDB: 3f1o_B* 3f1n_B 3h7w_B* 3h82_B* 1x0o_A 2hv1_A 4h6j_B 2b02_A* 2k7s_A 2a24_B Back     alignment and structure
>2kdk_A ARYL hydrocarbon receptor nuclear translocator-LI 2; circadian clock, PAS domain, transcription, activator, biolo rhythms, DNA-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3h9w_A Diguanylate cyclase with PAS/PAC sensor; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.90A {Marinobacter aquaeolei} Back     alignment and structure
>3mr0_A Sensory box histidine kinase/response regulator; PAS fold, structural genomics, PSI-2; HET: PG5; 1.49A {Burkholderia thailandensis} Back     alignment and structure
>3icy_A Sensor protein; sensory box histidine kinase/response regulator domain, kinase, chlorobium tepidum TLS, PSI-2; 2.68A {Chlorobaculum tepidum} Back     alignment and structure
>3nja_A Probable ggdef family protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.37A {Chromobacterium violaceum} Back     alignment and structure
>3f1p_B ARYL hydrocarbon receptor nuclear translocator; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.0 PDB: 3f1o_B* 3f1n_B 3h7w_B* 3h82_B* 1x0o_A 2hv1_A 4h6j_B 2b02_A* 2k7s_A 2a24_B Back     alignment and structure
>3f1p_A Endothelial PAS domain-containing protein 1; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.7 PDB: 3f1o_A* 3f1n_A 3h7w_A* 3h82_A* 1p97_A 2a24_A 4h6j_A Back     alignment and structure
>1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* Back     alignment and structure
>4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* Back     alignment and structure
>4hia_A LOV protein; PAS, HTH, signaling protein; HET: FMN; 1.95A {Rhodobacter sphaeroides} PDB: 4hnb_A* 4hj4_A* 4hj6_A* 4hj3_A* Back     alignment and structure
>2gj3_A Nitrogen fixation regulatory protein; PAS domain, FAD, redox sensor, atomic resolution, transferase; HET: FAD; 1.04A {Azotobacter vinelandii} Back     alignment and structure
>3mqq_A Transcriptional regulator, LUXR family; PAS domain, PSI, MCSG, structural genomics, center for structural genomics; 1.65A {Burkholderia thailandensis} PDB: 3mqo_A Back     alignment and structure
>4dj2_A Period circadian protein homolog 1; PAS domains, circadian clock protein, protein binding; 2.75A {Mus musculus} Back     alignment and structure
>3gdi_A Period circadian protein homolog 2; tandem PAS domains, biological rhythms, cytoplasm, nucleus, phosphoprotein, transcription; 2.40A {Mus musculus} Back     alignment and structure
>2kdk_A ARYL hydrocarbon receptor nuclear translocator-LI 2; circadian clock, PAS domain, transcription, activator, biolo rhythms, DNA-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* Back     alignment and structure
>3rty_A Period circadian protein; PAS domain, signalling, timeless, circadian clock protein; 2.85A {Drosophila melanogaster} PDB: 1wa9_A 3gec_A Back     alignment and structure
>4dj3_A Period circadian protein homolog 3; PAS domain, circadian rhythm, protein binding; 2.50A {Mus musculus} Back     alignment and structure
>2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* Back     alignment and structure
>3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} Back     alignment and structure
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Back     alignment and structure
>3eeh_A Putative light and redox sensing histidine kinase; structural genomic MCSG, protein structure initiative, midwest center for STRU genomics; HET: PG5; 1.95A {Haloarcula marismortui} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>3lyx_A Sensory BOX/ggdef domain protein; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* Back     alignment and structure
>3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* Back     alignment and structure
>1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 Back     alignment and structure
>3luq_A Sensor protein; PAS, histidine, kinase, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: PGE; 2.49A {Geobacter sulfurreducens} Back     alignment and structure
>2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* Back     alignment and structure
>3olo_A Two-component sensor histidine kinase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, TRA; 2.09A {Nostoc SP} Back     alignment and structure
>2r78_A Sensor protein; sensory box sensor histidine kinase/response regulator, structural genomics, PSI, MCSG; 1.60A {Geobacter sulfurreducens pca} Back     alignment and structure
>2vlg_A Sporulation kinase A; histidine kinase, two-component regulatory system, two-component signal transduction, transferase, phosphorylation, SCOD; 1.7A {Bacillus subtilis} Back     alignment and structure
>3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} Back     alignment and structure
>3icy_A Sensor protein; sensory box histidine kinase/response regulator domain, kinase, chlorobium tepidum TLS, PSI-2; 2.68A {Chlorobaculum tepidum} Back     alignment and structure
>2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A Back     alignment and structure
>3h9w_A Diguanylate cyclase with PAS/PAC sensor; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.90A {Marinobacter aquaeolei} Back     alignment and structure
>3mjq_A Uncharacterized protein; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium; 2.60A {Desulfitobacterium hafniense} Back     alignment and structure
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Back     alignment and structure
>3mfx_A Sensory BOX/ggdef family protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Shewanella oneidensis} Back     alignment and structure
>1oj5_A Steroid receptor coactivator 1A; transcriptional coactivator, complex, LXXLL motif, transcriptional regulation; 2.2A {Mus musculus} SCOP: d.110.3.8 Back     alignment and structure
>3bwl_A Sensor protein; structural genomics, APC87707.1, PAS domain, HTR-like protei protein structure initiative; HET: MSE I3A; 1.73A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>3mr0_A Sensory box histidine kinase/response regulator; PAS fold, structural genomics, PSI-2; HET: PG5; 1.49A {Burkholderia thailandensis} Back     alignment and structure
>3nja_A Probable ggdef family protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.37A {Chromobacterium violaceum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 294
d1oj5a_109 d.110.3.8 (A:) PAS domain of steroid receptor coac 4e-07
d1p97a_114 d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-t 0.001
>d1oj5a_ d.110.3.8 (A:) PAS domain of steroid receptor coactivator 1A, NCo-A1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Profilin-like
superfamily: PYP-like sensor domain (PAS domain)
family: PAS domain of steroid receptor coactivator 1A, NCo-A1
domain: PAS domain of steroid receptor coactivator 1A, NCo-A1
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 45.4 bits (107), Expect = 4e-07
 Identities = 8/69 (11%), Positives = 21/69 (30%)

Query: 125 RFLYISETVSIYLGLSQWQVINKGQVLTHYYRLMNKNGGYTWVQSCATVVCSSKNADEQN 184
            F         Y      +V+ +G   +  YR +  +G      +   +        +  
Sbjct: 40  AFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTRCKLCYPQSPDMQPF 99

Query: 185 IICVNYVIS 193
           I+ ++ +  
Sbjct: 100 IMGIHIIDR 108
>d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query294
d1oj5a_109 PAS domain of steroid receptor coactivator 1A, NCo 99.74
d1p97a_114 Hypoxia-inducible factor Hif2a, C-terminal domain 99.31
d1n9la_109 Putative blue light receptor, phot-lov1 domain {Gr 97.43
d1bywa_110 Erg potassium channel, N-terminal domain {Human (H 97.36
d1jnua_104 Photoreceptor phy3 flavin-binding domain, lov2 {Ma 97.0
d2oola2114 Sensor protein PhyB2 {Rhodopseudomonas palustris [ 96.88
d1p97a_114 Hypoxia-inducible factor Hif2a, C-terminal domain 95.91
d1oj5a_109 PAS domain of steroid receptor coactivator 1A, NCo 95.65
d1xj3a1106 Histidine kinase FixL heme domain {Bradyrhizobium 92.84
d1v9ya_113 Direct oxygen sensor protein, DOS {Escherichia col 92.54
d1ew0a_130 Histidine kinase FixL heme domain {Rhizobium melil 90.03
d1ll8a_114 N-terminal PAS domain of Pas kinase {Human (Homo s 86.4
d1n9la_109 Putative blue light receptor, phot-lov1 domain {Gr 82.09
d1ll8a_114 N-terminal PAS domain of Pas kinase {Human (Homo s 81.12
d1jnua_104 Photoreceptor phy3 flavin-binding domain, lov2 {Ma 80.1
>d1oj5a_ d.110.3.8 (A:) PAS domain of steroid receptor coactivator 1A, NCo-A1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Profilin-like
superfamily: PYP-like sensor domain (PAS domain)
family: PAS domain of steroid receptor coactivator 1A, NCo-A1
domain: PAS domain of steroid receptor coactivator 1A, NCo-A1
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.74  E-value=4.1e-19  Score=140.26  Aligned_cols=73  Identities=12%  Similarity=0.194  Sum_probs=63.4

Q ss_pred             cCceEEeeccccceeecc---------------------------ceeeEeeecceeeeEEEeeeeCCcEEEEEEEEEEe
Q psy17809        122 SDGRFLYISETVSIYLGL---------------------------SQWQVINKGQVLTHYYRLMNKNGGYTWVQSCATVV  174 (294)
Q Consensus       122 lD~kf~~~D~Rvs~~LGy---------------------------sH~~LL~KGQ~~t~~YR~l~K~G~wVWlqT~~~vv  174 (294)
                      +||||+|||+++..++||                           .|+.++.+|++.+..|||+.|+|.||||+|.++++
T Consensus        10 ~~g~~~~vd~~~~~~~gy~~~eelig~s~~~f~HPeD~~~~~~~~~~~~~~~~g~~~~~~yR~~~kdG~~vWv~t~~~~~   89 (109)
T d1oj5a_          10 TTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTRCKLC   89 (109)
T ss_dssp             TTCCEEEEECHHHHTTCCSCHHHHHHHHHHHHTSCBTTBCCHHHHHHHHHHHHSEEECCCEEEECTTSCEEEEEEEEEEE
T ss_pred             CCceEEEECHHHhhHhhcCCHHHHcCCcHHHeECcccchHHHhhHHHHHHHhhcccchhhhhhhhccCcEEEEEEEEEEE
Confidence            799999999999999999                           23446678999999999999999999999999999


Q ss_pred             ecCCCCCcCcEEEEeEEecC
Q psy17809        175 CSSKNADEQNIICVNYVISG  194 (294)
Q Consensus       175 ~n~kn~~~e~IVcvn~vlS~  194 (294)
                      +|++++++++|||+|+|+++
T Consensus        90 ~~~~~~~~~~Ii~~h~i~~~  109 (109)
T d1oj5a_          90 YPQSPDMQPFIMGIHIIDRE  109 (109)
T ss_dssp             CC----CCCEEEEEEEEECC
T ss_pred             ECCCCCcccEEEEEEEEecC
Confidence            99999999999999999875
>d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n9la_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1bywa_ d.110.3.6 (A:) Erg potassium channel, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnua_ d.110.3.6 (A:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d2oola2 d.110.3.9 (A:26-139) Sensor protein PhyB2 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oj5a_ d.110.3.8 (A:) PAS domain of steroid receptor coactivator 1A, NCo-A1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xj3a1 d.110.3.2 (A:154-259) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1v9ya_ d.110.3.2 (A:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ew0a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1ll8a_ d.110.3.5 (A:) N-terminal PAS domain of Pas kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n9la_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1ll8a_ d.110.3.5 (A:) N-terminal PAS domain of Pas kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnua_ d.110.3.6 (A:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure