Psyllid ID: psy17946


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220---
MAILYRKGRLHHFQLFTMVPQHWCSFESSIEYFGLVQCEEKQNWFFDLLKTKRGISKTKIERIDTLQNAGARTVVDNELIGRWYWHRLIARLARLLGTKRRYKVVVDNPLRFQDYNIVPRTQPLPNLPEGPHHVLSANYYVNRDGSHEVKPPATLYLANAAQKQIGESHTHINIIQNMLLICLEQAHESHVMTRVGREVKISVVTEVLNLELNGKRKGNILVT
ccEEEEcccccEEEEEEEEcccccccccccEEEEEEEEcccccHHHHHHHHccccccccHHHHHHHHcccccEEEccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEcccccccccccEEEEEccccccccccccccccccccEEEHHHHHHHcHHHEEEcccEEEEEEEEEEEEEEEccEEcccEEcc
cEEEEEccccccEEEEEcccccccccHcHHHHHcccccHHHHHHHHHHHHHcccccHcHHHHHHHHHHccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHcccEEEEccccccccccEEEEEccHHHHHHccccccccHHHHHHHHHHHHHHHcccEEEcccEEEEEEEEEEEEEEEcccccccEEEc
mailyrkgrlhhfqlftmvpqhwcsfessIEYFGLVQCEEKQNWFFDLLKTKRGISKTKIERIDTLqnagartvvdnelIGRWYWHRLIARLARLLGTKRRykvvvdnplrfqdynivprtqplpnlpegphhvlsanyyvnrdgshevkppatLYLANAAQKQIGESHTHINIIQNMLLICLEQAHESHVMTRVGREVKISVVTEVLNLelngkrkgnilvt
MAILYRKGRLHHFQLFTMVPQHWCSFESSIEYFGLVQCEEKQNWFFDLLKtkrgisktkieridtlqnagartvvdneligrwYWHRLIARLARLLGTKRRYKVVvdnplrfqdyniVPRTQPLPNLPEGPHHVLSANYYVNRDGSHEVKPPATLYLANAAQKQIGESHTHINIIQNMLLICLEQAHESHVMTRVGREVKISVVTEvlnlelngkrkgnilvt
MAILYRKGRLHHFQLFTMVPQHWCSFESSIEYFGLVQCEEKQNWFFDLLKTKRGISKTKIERIDTLQNAGARTVVDNELIGRWYWHRLIARLARLLGTKRRYKVVVDNPLRFQDYNIVPRTQPLPNLPEGPHHVLSANYYVNRDGSHEVKPPATLYLANAAQKQIGESHTHINIIQNMLLICLEQAHESHVMTRVGREVKISVVTEVLNLELNGKRKGNILVT
**ILYRKGRLHHFQLFTMVPQHWCSFESSIEYFGLVQCEEKQNWFFDLLKTKRGISKTKIERIDTLQNAGARTVVDNELIGRWYWHRLIARLARLLGTKRRYKVVVDNPLRFQDYNIVPRTQPLPNLPEGPHHVLSANYYVNRDGSHEVKPPATLYLANAAQKQIGESHTHINIIQNMLLICLEQAHESHVMTRVGREVKISVVTEVLNLELNG*********
**ILYRKGRLHHFQLFTMVPQHWCSFESSIEYFGLVQCEEKQNWFFDLLKTKRGISKTKIERIDTLQNAGARTVVDNELIGRWYWHRLIARLARLLGTKRRYKVVVDNPLRFQDY*****T****NLPEGPHHVLSANYYVNRDGSHEVKPPAT************************LLICLEQAHESHVMTRVGREVKISVVTEVLNLELNGKRKGNILV*
MAILYRKGRLHHFQLFTMVPQHWCSFESSIEYFGLVQCEEKQNWFFDLLKTKRGISKTKIERIDTLQNAGARTVVDNELIGRWYWHRLIARLARLLGTKRRYKVVVDNPLRFQDYNIVPRTQPLPNLPEGPHHVLSANYYVNRDGSHEVKPPATLYLANAAQKQIGESHTHINIIQNMLLICLEQAHESHVMTRVGREVKISVVTEVLNLELNGKRKGNILVT
MAILYRKGRLHHFQLFTMVPQHWCSFESSIEYFGLVQCEEKQNWFFDLLKTKRGISKTKIERIDTLQNAGARTVVDNELIGRWYWHRLIARLARLLGTKRRYKVVVDNPLRFQDYNIVPRTQPLPNLPEGPHHVLSANYYVNRDGSHEVKPPATLYLANAAQKQIGESHTHINIIQNMLLICLEQAHESHVMTRVGREVKISVVTEVLNLELNGKRKG*ILV*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAILYRKGRLHHFQLFTMVPQHWCSFESSIEYFGLVQCEEKQNWFFDLLKTKRGISKTKIERIDTLQNAGARTVVDNELIGRWYWHRLIARLARLLGTKRRYKVVVDNPLRFQDYNIVPRTQPLPNLPEGPHHVLSANYYVNRDGSHEVKPPATLYLANAAQKQIGESHTHINIIQNMLLICLEQAHESHVMTRVGREVKISVVTEVLNLELNGKRKGNILVT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query223 2.2.26 [Sep-21-2011]
Q9Z1P6113 NADH dehydrogenase [ubiqu yes N/A 0.224 0.442 0.519 5e-07
Q05752113 NADH dehydrogenase [ubiqu yes N/A 0.188 0.371 0.568 3e-06
Q0MQA6113 NADH dehydrogenase [ubiqu N/A N/A 0.224 0.442 0.5 4e-06
Q0MQA7113 NADH dehydrogenase [ubiqu N/A N/A 0.224 0.442 0.5 5e-06
Q0MQA8113 NADH dehydrogenase [ubiqu yes N/A 0.224 0.442 0.5 5e-06
O95182113 NADH dehydrogenase [ubiqu yes N/A 0.224 0.442 0.5 5e-06
>sp|Q9Z1P6|NDUA7_MOUSE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 OS=Mus musculus GN=Ndufa7 PE=1 SV=3 Back     alignment and function desciption
 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/52 (51%), Positives = 32/52 (61%), Gaps = 2/52 (3%)

Query: 110 LRFQDYNIVPRTQPLPNLPEGPHHVLSANYYVNRDGSHEVKPPATLYLANAA 161
           LR+Q+  I  RTQP P LP GP H LS NYY  RDG  EV PP+ +  +  A
Sbjct: 26  LRYQE--IAKRTQPPPKLPVGPSHKLSNNYYCTRDGRREVVPPSIIMSSQKA 75




Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Mus musculus (taxid: 10090)
>sp|Q05752|NDUA7_BOVIN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 OS=Bos taurus GN=NDUFA7 PE=1 SV=2 Back     alignment and function description
>sp|Q0MQA6|NDUA7_PONPY NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 OS=Pongo pygmaeus GN=NDUFA7 PE=3 SV=3 Back     alignment and function description
>sp|Q0MQA7|NDUA7_GORGO NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 OS=Gorilla gorilla gorilla GN=NDUFA7 PE=3 SV=3 Back     alignment and function description
>sp|Q0MQA8|NDUA7_PANTR NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 OS=Pan troglodytes GN=NDUFA7 PE=3 SV=3 Back     alignment and function description
>sp|O95182|NDUA7_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 OS=Homo sapiens GN=NDUFA7 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query223
195397563103 GJ17063 [Drosophila virilis] gi|19414716 0.201 0.436 0.630 2e-08
170055888100 hypothetical protein CpipJ_CPIJ013804 [C 0.260 0.58 0.555 2e-08
443735010120 hypothetical protein CAPTEDRAFT_226766 [ 0.224 0.416 0.607 5e-07
195060185108 GH17584 [Drosophila grimshawi] gi|193896 0.201 0.416 0.586 5e-07
118777045100 Anopheles gambiae str. PEST AGAP012705-P 0.210 0.47 0.625 8e-07
91083977102 PREDICTED: similar to CG3621 CG3621-PA [ 0.255 0.558 0.508 1e-06
24639292103 CG3621 [Drosophila melanogaster] gi|3927 0.201 0.436 0.586 1e-06
195347854104 GM19202 [Drosophila sechellia] gi|195564 0.201 0.432 0.586 2e-06
17946507103 RE75088p [Drosophila melanogaster] 0.201 0.436 0.586 3e-06
194768741104 GF22195 [Drosophila ananassae] gi|190617 0.233 0.5 0.535 3e-06
>gi|195397563|ref|XP_002057398.1| GJ17063 [Drosophila virilis] gi|194147165|gb|EDW62884.1| GJ17063 [Drosophila virilis] Back     alignment and taxonomy information
 Score = 65.1 bits (157), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 34/46 (73%), Gaps = 1/46 (2%)

Query: 110 LRFQDYNIVPRTQPLPNLPEGPHHVLSANYYVNRDGSHEVKPPATL 155
           LRF+D  +  RTQP P LP+GP H+LSANYY  RDG HEV+PP  L
Sbjct: 28  LRFED-ALADRTQPQPELPDGPSHILSANYYCTRDGRHEVQPPIDL 72




Source: Drosophila virilis

Species: Drosophila virilis

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|170055888|ref|XP_001863783.1| hypothetical protein CpipJ_CPIJ013804 [Culex quinquefasciatus] gi|167875751|gb|EDS39134.1| hypothetical protein CpipJ_CPIJ013804 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|443735010|gb|ELU18865.1| hypothetical protein CAPTEDRAFT_226766 [Capitella teleta] Back     alignment and taxonomy information
>gi|195060185|ref|XP_001995765.1| GH17584 [Drosophila grimshawi] gi|193896551|gb|EDV95417.1| GH17584 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|118777045|ref|XP_307312.2| Anopheles gambiae str. PEST AGAP012705-PA [Anopheles gambiae str. PEST] gi|118777538|ref|XP_308132.2| AGAP003900-PA [Anopheles gambiae str. PEST] gi|116132703|gb|EAA03888.3| AGAP003900-PA [Anopheles gambiae str. PEST] gi|116133122|gb|EAA03125.3| AGAP012705-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|91083977|ref|XP_975169.1| PREDICTED: similar to CG3621 CG3621-PA [Tribolium castaneum] gi|270008257|gb|EFA04705.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7, 14.5kDa [Tribolium castaneum] Back     alignment and taxonomy information
>gi|24639292|ref|NP_569984.2| CG3621 [Drosophila melanogaster] gi|3927908|emb|CAA15701.1| EG:152A3.7 [Drosophila melanogaster] gi|7290278|gb|AAF45739.1| CG3621 [Drosophila melanogaster] gi|219990779|gb|ACL68763.1| SD16673p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195347854|ref|XP_002040466.1| GM19202 [Drosophila sechellia] gi|195564721|ref|XP_002105962.1| GD16591 [Drosophila simulans] gi|194121894|gb|EDW43937.1| GM19202 [Drosophila sechellia] gi|194203327|gb|EDX16903.1| GD16591 [Drosophila simulans] Back     alignment and taxonomy information
>gi|17946507|gb|AAL49285.1| RE75088p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|194768741|ref|XP_001966470.1| GF22195 [Drosophila ananassae] gi|190617234|gb|EDV32758.1| GF22195 [Drosophila ananassae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query223
FB|FBgn0025839103 CG3621 [Drosophila melanogaste 0.304 0.660 0.481 2e-10
MGI|MGI:1913666113 Ndufa7 "NADH dehydrogenase (ub 0.224 0.442 0.519 2.3e-08
RGD|1304597112 Ndufa7 "NADH dehydrogenase (ub 0.224 0.446 0.519 2.3e-08
UNIPROTKB|F1PLL0121 NDUFA7 "Uncharacterized protei 0.197 0.363 0.543 3e-08
UNIPROTKB|Q05752113 NDUFA7 "NADH dehydrogenase [ub 0.188 0.371 0.568 1.5e-07
UNIPROTKB|F1SA62121 NDUFA7 "Uncharacterized protei 0.188 0.347 0.568 1.5e-07
UNIPROTKB|O95182113 NDUFA7 "NADH dehydrogenase [ub 0.224 0.442 0.5 1.9e-07
UNIPROTKB|E1C645101 NDUFA7 "Uncharacterized protei 0.269 0.594 0.462 4.4e-07
WB|WBGene00009740168 F45H10.3 [Caenorhabditis elega 0.242 0.321 0.472 5.8e-07
ZFIN|ZDB-GENE-040801-169104 ndufa7 "NADH dehydrogenase (ub 0.327 0.701 0.333 1.6e-06
FB|FBgn0025839 CG3621 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 147 (56.8 bits), Expect = 2.0e-10, P = 2.0e-10
 Identities = 38/79 (48%), Positives = 47/79 (59%)

Query:    88 LIARL-ARLLGTKRRYKVVVDNPLRFQDYNIVPRTQPLPNLPEGPHHVLSANYYVNRDGS 146
             LI R+ A LLG  R + +     LRF+D  +  RTQP P +P+GP H+LSANYY  RDG 
Sbjct:    11 LIQRIRAFLLG--REHNLA----LRFED-GLADRTQPQPEIPDGPSHLLSANYYCQRDGR 63

Query:   147 HEVKPPATLYLANAAQKQI 165
              EV PP  L      QKQ+
Sbjct:    64 REVLPPIDLV---EQQKQL 79




GO:0005747 "mitochondrial respiratory chain complex I" evidence=ISS
GO:0008137 "NADH dehydrogenase (ubiquinone) activity" evidence=ISS
GO:0003954 "NADH dehydrogenase activity" evidence=ISS
GO:0006120 "mitochondrial electron transport, NADH to ubiquinone" evidence=ISS
MGI|MGI:1913666 Ndufa7 "NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7 (B14.5a)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1304597 Ndufa7 "NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PLL0 NDUFA7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q05752 NDUFA7 "NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SA62 NDUFA7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|O95182 NDUFA7 "NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C645 NDUFA7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00009740 F45H10.3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-169 ndufa7 "NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9Z1P6NDUA7_MOUSENo assigned EC number0.51920.22420.4424yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query223
pfam0734797 pfam07347, CI-B14_5a, NADH:ubiquinone oxidoreducta 3e-19
>gnl|CDD|148767 pfam07347, CI-B14_5a, NADH:ubiquinone oxidoreductase subunit B14 Back     alignment and domain information
 Score = 78.7 bits (194), Expect = 3e-19
 Identities = 35/71 (49%), Positives = 41/71 (57%), Gaps = 8/71 (11%)

Query: 87  RLIARL-ARLLGTKRRYKVVVDNPLRFQDYNIVPRTQPLPNLPEGPHHVLSANYYVNRDG 145
            L+ RL   LLG  R++K      LR+ D  I  RTQP P LP+GP H LSANYY  RDG
Sbjct: 2   PLLQRLRNFLLG--RQHK----LALRYAD-GISKRTQPPPKLPDGPSHKLSANYYCTRDG 54

Query: 146 SHEVKPPATLY 156
             EV PP  + 
Sbjct: 55  RREVTPPIDIV 65


5a (Complex I-B14.5a). This family contains the eukaryotic NADH:ubiquinone oxidoreductase subunit B14.5a (Complex I-B14.5a) (EC:1.6.5.3). This is approximately 100 residues long, and forms part of a multiprotein complex that resides on the inner mitochondrial membrane. The main function of the complex is the transport of electrons from NADH to ubiquinone, accompanied by translocation of protons from the mitochondrial matrix to the intermembrane space. Length = 97

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 223
PF0734797 CI-B14_5a: NADH:ubiquinone oxidoreductase subunit 100.0
KOG4630|consensus142 99.95
>PF07347 CI-B14_5a: NADH:ubiquinone oxidoreductase subunit B14 Back     alignment and domain information
Probab=100.00  E-value=5.6e-38  Score=242.09  Aligned_cols=75  Identities=47%  Similarity=0.779  Sum_probs=71.6

Q ss_pred             HHHHHHHHHhccccccccccCCCccCCCCCCCCCCCCCCCCCCCCCCCcccceeeccCCCCCCCCCeEEEeccchhhhhc
Q psy17946         87 RLIARLARLLGTKRRYKVVVDNPLRFQDYNIVPRTQPLPNLPEGPHHVLSANYYVNRDGSHEVKPPATLYLANAAQKQIG  166 (223)
Q Consensus        87 ~fI~~LRdFL~GRkh~ka~~kl~LRYaD~~IS~RTQPPPnLP~GPsHKLS~NYYYtRDaRREV~PPI~I~~~ns~qK~La  166 (223)
                      +|||+|||||+||+|     +++|||+| +||+||||||+||+||+||+|+||||+||+||||+||++||   +++|+|.
T Consensus         2 p~iq~lR~fl~GR~~-----~~~lRy~d-~~s~RTqPpP~lP~Gp~hkls~NyYy~RD~RRev~PP~~i~---s~~k~L~   72 (97)
T PF07347_consen    2 PFIQRLRNFLLGRKH-----KLQLRYAD-TISPRTQPPPNLPGGPSHKLSANYYYTRDARREVQPPIDIV---SSQKQLI   72 (97)
T ss_pred             hHHHHHHHHHccccc-----cccccccc-ccccCCCCCCCCCCCCccccccccccccccccccCCCeEee---ccccccc
Confidence            799999999999988     99999999 99999999999999999999999999999999999999998   6789998


Q ss_pred             cccc
Q psy17946        167 ESHT  170 (223)
Q Consensus       167 a~~~  170 (223)
                      ++++
T Consensus        73 a~~~   76 (97)
T PF07347_consen   73 AGKA   76 (97)
T ss_pred             cccc
Confidence            7763



5a (Complex I-B14.5a); InterPro: IPR009947 NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. This family contains the eukaryotic NADH:ubiquinone oxidoreductase subunit B14.5a (Complex I-B14.5a). This is approximately 100 residues long, and forms part of a multiprotein complex that resides on the inner mitochondrial membrane [].; GO: 0008137 NADH dehydrogenase (ubiquinone) activity, 0042773 ATP synthesis coupled electron transport, 0005743 mitochondrial inner membrane

>KOG4630|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00