Psyllid ID: psy18035

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100----
MGFANINYLISFPIVQQTFKFVKELGKFTKLQSTCLLGGDSMDNQFARLHASPDIVVATPGRFLHIVVEMELKLSSIQYVVFDEADRLFEMGFDVEQQSPCDTS
ccccccEEEEEcHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHccccEEEEcccHHHHHHHHcccccccEEEEEEEccccccccccHHHHHHHcccc
ccccccEEEEEcccHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHcccEEEEEcccHHHHHHHcccccHHHEEEEEEHHHHHHHHccccHHHHHHHccc
MGFANINYLISFPIVQQTFKFVKELGKFTklqstcllggdsmdNQFArlhaspdivvatpgRFLHIVVEMELKLSSIQYVVFDEADRLFemgfdveqqspcdts
MGFANINYLISFPIVQQTFKFVKELGKFTKLQSTCLLGGDSMDNQFARLHASPDIVVATPGRFLHIVVEMELKLSSIQYVVFDEADRLFEMgfdveqqspcdts
MGFANINYLISFPIVQQTFKFVKELGKFTKLQSTCLLGGDSMDNQFARLHASPDIVVATPGRFLHIVVEMELKLSSIQYVVFDEADRLFEMGFDVEQQSPCDTS
**FANINYLISFPIVQQTFKFVKELGKFTKLQSTCLLGGDSMDNQFARLHASPDIVVATPGRFLHIVVEMELKLSSIQYVVFDEADRLFEMGFD**********
***ANINYLISFPIVQQTFKFVKELGKFTKLQSTCLLGGDSMDNQFARLHASPDIVVATPGRFLHIVVEMELKLSSIQYVVFDEADRLFEMGFDVEQQSPCD**
MGFANINYLISFPIVQQTFKFVKELGKFTKLQSTCLLGGDSMDNQFARLHASPDIVVATPGRFLHIVVEMELKLSSIQYVVFDEADRLFEMGFDV*********
**FANINYLISFPIVQQTFKFVKELGKFTKLQSTCLLGGDSMDNQFARLHASPDIVVATPGRFLHIVVEMELKLSSIQYVVFDEADRLFEMGFDVEQQSPCD**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGFANINYLISFPIVQQTFKFVKELGKFTKLQSTCLLGGDSMDNQFARLHASPDIVVATPGRFLHIVVEMELKLSSIQYVVFDEADRLFEMGFDVEQQSPCDTS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query104 2.2.26 [Sep-21-2011]
Q8TDD1 881 ATP-dependent RNA helicas yes N/A 0.788 0.093 0.658 1e-28
Q8K4L0 874 ATP-dependent RNA helicas yes N/A 0.788 0.093 0.658 3e-28
A1DNG2 934 ATP-dependent RNA helicas N/A N/A 0.740 0.082 0.701 2e-26
Q5BFU7 936 ATP-dependent RNA helicas yes N/A 0.740 0.082 0.701 2e-26
Q2UHC1 929 ATP-dependent RNA helicas yes N/A 0.740 0.082 0.701 3e-26
Q8NJM2 869 ATP-dependent RNA helicas yes N/A 0.740 0.088 0.688 3e-26
Q0CMM8 928 ATP-dependent RNA helicas N/A N/A 0.740 0.082 0.701 3e-26
Q2H0R2 762 ATP-dependent RNA helicas N/A N/A 0.740 0.101 0.675 4e-26
A2QRY2 932 ATP-dependent RNA helicas yes N/A 0.740 0.082 0.688 5e-26
A6QUM7 900 ATP-dependent RNA helicas N/A N/A 0.769 0.088 0.65 8e-26
>sp|Q8TDD1|DDX54_HUMAN ATP-dependent RNA helicase DDX54 OS=Homo sapiens GN=DDX54 PE=1 SV=2 Back     alignment and function desciption
 Score =  124 bits (312), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 54/82 (65%), Positives = 67/82 (81%)

Query: 17  QTFKFVKELGKFTKLQSTCLLGGDSMDNQFARLHASPDIVVATPGRFLHIVVEMELKLSS 76
           QT KF KELGKFT L++  +LGGD M++QFA LH +PDI++ATPGR +H+ VEM LKL S
Sbjct: 181 QTLKFTKELGKFTGLKTALILGGDRMEDQFAALHENPDIIIATPGRLVHVAVEMSLKLQS 240

Query: 77  IQYVVFDEADRLFEMGFDVEQQ 98
           ++YVVFDEADRLFEMGF  + Q
Sbjct: 241 VEYVVFDEADRLFEMGFAEQLQ 262
Has RNA-dependent ATPase activity. Represses the transcriptional activity of nuclear receptors.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q8K4L0|DDX54_MOUSE ATP-dependent RNA helicase DDX54 OS=Mus musculus GN=Ddx54 PE=1 SV=1 Back     alignment and function description
>sp|A1DNG2|DBP10_NEOFI ATP-dependent RNA helicase dbp10 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp10 PE=3 SV=1 Back     alignment and function description
>sp|Q5BFU7|DBP10_EMENI ATP-dependent RNA helicase dbp10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp10 PE=3 SV=1 Back     alignment and function description
>sp|Q2UHC1|DBP10_ASPOR ATP-dependent RNA helicase dbp10 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp10 PE=3 SV=1 Back     alignment and function description
>sp|Q8NJM2|DBP10_ASPFU ATP-dependent RNA helicase dbp10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp10 PE=3 SV=1 Back     alignment and function description
>sp|Q0CMM8|DBP10_ASPTN ATP-dependent RNA helicase dbp10 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp10 PE=3 SV=1 Back     alignment and function description
>sp|Q2H0R2|DBP10_CHAGB ATP-dependent RNA helicase DBP10 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP10 PE=3 SV=1 Back     alignment and function description
>sp|A2QRY2|DBP10_ASPNC ATP-dependent RNA helicase dbp10 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp10 PE=3 SV=1 Back     alignment and function description
>sp|A6QUM7|DBP10_AJECN ATP-dependent RNA helicase DBP10 OS=Ajellomyces capsulata (strain NAm1 / WU24) GN=DBP10 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query104
242015175 723 ATP-dependent RNA helicase DDX54, putati 0.740 0.106 0.766 8e-30
332025035 776 ATP-dependent RNA helicase DDX54 [Acromy 0.788 0.105 0.695 4e-29
156396703 700 predicted protein [Nematostella vectensi 0.846 0.125 0.681 8e-29
167518760 787 hypothetical protein [Monosiga brevicoll 0.740 0.097 0.740 9e-29
270000966 761 hypothetical protein TcasGA2_TC011242 [T 0.740 0.101 0.714 1e-28
383849107 770 PREDICTED: ATP-dependent RNA helicase DD 0.740 0.1 0.714 1e-28
157121423 784 DEAD box ATP-dependent RNA helicase [Aed 0.740 0.098 0.753 2e-28
443712578 902 hypothetical protein CAPTEDRAFT_148777 [ 0.740 0.085 0.727 2e-28
442750425 767 Putative atp-dependent rna helicase [Ixo 0.740 0.100 0.740 2e-28
241999744 771 ATP-dependent RNA helicase, putative [Ix 0.740 0.099 0.740 2e-28
>gi|242015175|ref|XP_002428249.1| ATP-dependent RNA helicase DDX54, putative [Pediculus humanus corporis] gi|212512810|gb|EEB15511.1| ATP-dependent RNA helicase DDX54, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  134 bits (337), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 59/77 (76%), Positives = 69/77 (89%)

Query: 17  QTFKFVKELGKFTKLQSTCLLGGDSMDNQFARLHASPDIVVATPGRFLHIVVEMELKLSS 76
           QT KF+KELGKFTKL++  +LGGDSMD QF  +H +PDI+VATPGRFLHI VEMELKL+S
Sbjct: 114 QTVKFIKELGKFTKLKALAILGGDSMDQQFGAIHENPDIIVATPGRFLHICVEMELKLTS 173

Query: 77  IQYVVFDEADRLFEMGF 93
           ++YVVFDEADRLFEMGF
Sbjct: 174 VEYVVFDEADRLFEMGF 190

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332025035|gb|EGI65222.1| ATP-dependent RNA helicase DDX54 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|156396703|ref|XP_001637532.1| predicted protein [Nematostella vectensis] gi|156224645|gb|EDO45469.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|167518760|ref|XP_001743720.1| hypothetical protein [Monosiga brevicollis MX1] gi|163777682|gb|EDQ91298.1| predicted protein [Monosiga brevicollis MX1] Back     alignment and taxonomy information
>gi|270000966|gb|EEZ97413.1| hypothetical protein TcasGA2_TC011242 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383849107|ref|XP_003700188.1| PREDICTED: ATP-dependent RNA helicase DDX54-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|157121423|ref|XP_001659898.1| DEAD box ATP-dependent RNA helicase [Aedes aegypti] gi|108874627|gb|EAT38852.1| AAEL009285-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|443712578|gb|ELU05832.1| hypothetical protein CAPTEDRAFT_148777 [Capitella teleta] Back     alignment and taxonomy information
>gi|442750425|gb|JAA67372.1| Putative atp-dependent rna helicase [Ixodes ricinus] Back     alignment and taxonomy information
>gi|241999744|ref|XP_002434515.1| ATP-dependent RNA helicase, putative [Ixodes scapularis] gi|215497845|gb|EEC07339.1| ATP-dependent RNA helicase, putative [Ixodes scapularis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query104
FB|FBgn0052344 827 CG32344 [Drosophila melanogast 0.740 0.093 0.714 1.6e-26
UNIPROTKB|F8VRX4208 DDX54 "ATP-dependent RNA helic 0.769 0.384 0.679 4e-26
ZFIN|ZDB-GENE-021220-2 862 ddx54 "DEAD (Asp-Glu-Ala-Asp) 0.769 0.092 0.679 2.7e-25
MGI|MGI:1919240 874 Ddx54 "DEAD (Asp-Glu-Ala-Asp) 0.769 0.091 0.679 4.5e-25
UNIPROTKB|E1BGI6 877 DDX54 "Uncharacterized protein 0.769 0.091 0.679 4.5e-25
RGD|1562539 906 Ddx54 "DEAD (Asp-Glu-Ala-Asp) 0.769 0.088 0.679 4.8e-25
UNIPROTKB|F1NTK9 822 DDX54 "Uncharacterized protein 0.769 0.097 0.679 5.1e-25
UNIPROTKB|Q8TDD1 881 DDX54 "ATP-dependent RNA helic 0.769 0.090 0.679 5.8e-25
WB|WBGene00022378 871 Y94H6A.5 [Caenorhabditis elega 0.740 0.088 0.675 7.3e-25
ASPGD|ASPL0000054300 936 AN0583 [Emericella nidulans (t 0.740 0.082 0.701 7e-23
FB|FBgn0052344 CG32344 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 309 (113.8 bits), Expect = 1.6e-26, P = 1.6e-26
 Identities = 55/77 (71%), Positives = 70/77 (90%)

Query:    17 QTFKFVKELGKFTKLQSTCLLGGDSMDNQFARLHASPDIVVATPGRFLHIVVEMELKLSS 76
             QT+KF+KELG+F +L+S  +LGGDSMD+QF+ +H  PD++VATPGRFLH+ VEM+LKL+S
Sbjct:   124 QTYKFIKELGRFMELKSILVLGGDSMDSQFSAIHTCPDVIVATPGRFLHLCVEMDLKLNS 183

Query:    77 IQYVVFDEADRLFEMGF 93
             I+YVVFDEADRLFEMGF
Sbjct:   184 IEYVVFDEADRLFEMGF 200
GO:0004386 "helicase activity" evidence=ISS
GO:0004004 "ATP-dependent RNA helicase activity" evidence=ISS
GO:0005634 "nucleus" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0003723 "RNA binding" evidence=IEA
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|F8VRX4 DDX54 "ATP-dependent RNA helicase DDX54" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-021220-2 ddx54 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 54" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1919240 Ddx54 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 54" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BGI6 DDX54 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1562539 Ddx54 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 54" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NTK9 DDX54 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TDD1 DDX54 "ATP-dependent RNA helicase DDX54" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00022378 Y94H6A.5 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ASPGD|ASPL0000054300 AN0583 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8K4L0DDX54_MOUSE3, ., 6, ., 4, ., 1, 30.65850.78840.0938yesN/A
Q8TDD1DDX54_HUMAN3, ., 6, ., 4, ., 1, 30.65850.78840.0930yesN/A
Q6CIR0DBP10_KLULA3, ., 6, ., 4, ., 1, 30.59740.74030.0791yesN/A
Q6FNA2DBP10_CANGA3, ., 6, ., 4, ., 1, 30.550.76920.0825yesN/A
A3LZT3DBP10_PICST3, ., 6, ., 4, ., 1, 30.57140.74030.0827yesN/A
Q5BFU7DBP10_EMENI3, ., 6, ., 4, ., 1, 30.70120.74030.0822yesN/A
A2QRY2DBP10_ASPNC3, ., 6, ., 4, ., 1, 30.68830.74030.0826yesN/A
Q6C7X8DBP10_YARLI3, ., 6, ., 4, ., 1, 30.57140.74030.0831yesN/A
Q12389DBP10_YEAST3, ., 6, ., 4, ., 1, 30.56250.76920.0804yesN/A
P0CR06DBP10_CRYNJ3, ., 6, ., 4, ., 1, 30.57350.65380.0847yesN/A
Q54CD8DDX54_DICDI3, ., 6, ., 4, ., 1, 30.55120.750.0714yesN/A
O49289RH29_ARATH3, ., 6, ., 4, ., 1, 30.54320.76920.0946yesN/A
Q4HZ42DBP10_GIBZE3, ., 6, ., 4, ., 1, 30.66230.74030.0858yesN/A
Q757U8DBP10_ASHGO3, ., 6, ., 4, ., 1, 30.5750.76920.0833yesN/A
Q2UHC1DBP10_ASPOR3, ., 6, ., 4, ., 1, 30.70120.74030.0828yesN/A
Q6BL34DBP10_DEBHA3, ., 6, ., 4, ., 1, 30.61250.76920.0858yesN/A
Q09719DBP10_SCHPO3, ., 6, ., 4, ., 1, 30.59130.86530.1061yesN/A
Q8NJM2DBP10_ASPFU3, ., 6, ., 4, ., 1, 30.68830.74030.0886yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.40.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query104
cd00268203 cd00268, DEADc, DEAD-box helicases 1e-28
COG0513 513 COG0513, SrmB, Superfamily II DNA and RNA helicase 1e-22
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 3e-19
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 2e-16
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 1e-15
PRK10590 456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 9e-15
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 2e-14
PRK04837 423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 4e-13
PRK11192 434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 1e-12
PRK11776 460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 8e-11
PTZ00110 545 PTZ00110, PTZ00110, helicase; Provisional 2e-10
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 2e-10
PRK04537 572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 1e-08
PTZ00424 401 PTZ00424, PTZ00424, helicase 45; Provisional 2e-08
PLN00206 518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 3e-08
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information 
 Score =  102 bits (256), Expect = 1e-28
 Identities = 35/78 (44%), Positives = 50/78 (64%)

Query: 16  QQTFKFVKELGKFTKLQSTCLLGGDSMDNQFARLHASPDIVVATPGRFLHIVVEMELKLS 75
            Q  +  ++LGK T L+   + GG S+D Q  +L   P IVVATPGR L ++   +L LS
Sbjct: 83  LQIAEVARKLGKHTNLKVVVIYGGTSIDKQIRKLKRGPHIVVATPGRLLDLLERGKLDLS 142

Query: 76  SIQYVVFDEADRLFEMGF 93
            ++Y+V DEADR+ +MGF
Sbjct: 143 KVKYLVLDEADRMLDMGF 160

A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP- binding region. Length = 203
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 104
KOG0331|consensus 519 99.97
KOG0339|consensus 731 99.96
KOG0330|consensus 476 99.95
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.94
KOG0338|consensus 691 99.94
KOG0335|consensus 482 99.94
KOG0348|consensus 708 99.93
KOG0342|consensus 543 99.92
KOG0345|consensus 567 99.91
KOG0341|consensus 610 99.91
KOG0347|consensus 731 99.91
KOG0336|consensus 629 99.91
KOG0333|consensus 673 99.9
KOG0343|consensus 758 99.9
PTZ00110 545 helicase; Provisional 99.9
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 99.9
KOG0328|consensus 400 99.9
KOG0326|consensus 459 99.89
KOG0350|consensus 620 99.89
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 99.88
KOG0334|consensus 997 99.87
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 99.87
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.87
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 99.87
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 99.87
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 99.86
KOG0337|consensus 529 99.86
KOG4284|consensus 980 99.86
KOG0346|consensus 569 99.86
KOG0329|consensus 387 99.84
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 99.84
KOG0340|consensus 442 99.84
KOG0327|consensus 397 99.81
PTZ00424 401 helicase 45; Provisional 99.78
KOG0349|consensus 725 99.75
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.74
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.7
PRK09401 1176 reverse gyrase; Reviewed 99.69
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.69
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.64
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.63
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.6
PRK14701 1638 reverse gyrase; Provisional 99.59
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.59
KOG0332|consensus 477 99.56
PRK13767 876 ATP-dependent helicase; Provisional 99.56
KOG0344|consensus 593 99.54
PRK02362 737 ski2-like helicase; Provisional 99.54
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.54
PRK00254 720 ski2-like helicase; Provisional 99.51
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.51
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 99.5
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 99.48
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.43
PRK01172 674 ski2-like helicase; Provisional 99.42
PRK10689 1147 transcription-repair coupling factor; Provisional 99.41
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.38
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.36
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.33
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.3
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.24
smart00487201 DEXDc DEAD-like helicases superfamily. 99.18
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 99.16
PHA02558 501 uvsW UvsW helicase; Provisional 99.15
PRK13766 773 Hef nuclease; Provisional 99.15
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.14
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.14
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.12
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.1
COG1204 766 Superfamily II helicase [General function predicti 99.08
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.07
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 99.06
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.05
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 99.03
COG1205 851 Distinct helicase family with a unique C-terminal 99.02
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.02
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 98.97
PRK05580 679 primosome assembly protein PriA; Validated 98.92
PHA02653 675 RNA helicase NPH-II; Provisional 98.91
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 98.88
TIGR01587 358 cas3_core CRISPR-associated helicase Cas3. This mo 98.71
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 98.66
TIGR00595 505 priA primosomal protein N'. All proteins in this f 98.65
TIGR03158 357 cas3_cyano CRISPR-associated helicase, Cyano-type. 98.47
COG1202 830 Superfamily II helicase, archaea-specific [General 98.44
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 98.44
KOG0354|consensus 746 98.38
KOG0952|consensus 1230 98.37
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 98.17
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 98.01
PRK12326 764 preprotein translocase subunit SecA; Reviewed 97.98
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 97.92
TIGR00348 667 hsdR type I site-specific deoxyribonuclease, HsdR 97.85
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 97.79
PF00176 299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 97.77
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 97.75
KOG0385|consensus 971 97.68
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 97.63
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 97.57
PF06862 442 DUF1253: Protein of unknown function (DUF1253); In 97.53
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 97.5
KOG0351|consensus 941 97.49
PF04851184 ResIII: Type III restriction enzyme, res subunit; 97.44
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 97.44
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 97.42
KOG3089|consensus271 97.38
CHL00122 870 secA preprotein translocase subunit SecA; Validate 97.36
KOG0947|consensus 1248 97.34
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 97.26
KOG0951|consensus 1674 97.25
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 97.24
PRK14873 665 primosome assembly protein PriA; Provisional 97.13
COG1198 730 PriA Primosomal protein N' (replication factor Y) 97.01
PRK04914 956 ATP-dependent helicase HepA; Validated 96.97
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 96.66
KOG0352|consensus 641 96.58
KOG2340|consensus 698 96.58
KOG0389|consensus 941 96.54
KOG0387|consensus 923 96.53
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 96.51
PRK09694 878 helicase Cas3; Provisional 96.39
KOG0948|consensus 1041 95.95
KOG0949|consensus 1330 95.87
KOG4439|consensus 901 95.87
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 95.72
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 95.29
COG0610 962 Type I site-specific restriction-modification syst 95.26
KOG1001|consensus 674 95.24
PRK10689 1147 transcription-repair coupling factor; Provisional 95.15
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 95.1
KOG0392|consensus 1549 95.04
KOG0951|consensus 1674 94.94
KOG0391|consensus 1958 94.78
TIGR00643630 recG ATP-dependent DNA helicase RecG. 94.72
COG4096 875 HsdR Type I site-specific restriction-modification 94.67
KOG0384|consensus 1373 94.45
KOG0390|consensus 776 94.2
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 94.18
COG4098 441 comFA Superfamily II DNA/RNA helicase required for 93.86
COG1200677 RecG RecG-like helicase [DNA replication, recombin 93.77
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 93.59
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 93.47
KOG0353|consensus 695 93.2
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 93.13
COG0553 866 HepA Superfamily II DNA/RNA helicases, SNF2 family 92.79
smart00488289 DEXDc2 DEAD-like helicases superfamily. 92.69
smart00489289 DEXDc3 DEAD-like helicases superfamily. 92.69
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 92.66
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 92.55
KOG0950|consensus 1008 92.52
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 92.36
PRK05580 679 primosome assembly protein PriA; Validated 92.2
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 91.82
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 91.8
KOG0388|consensus 1185 91.75
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 91.56
TIGR00595 505 priA primosomal protein N'. All proteins in this f 91.54
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 91.47
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 91.28
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 91.17
KOG0344|consensus 593 91.1
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 90.7
PTZ00110545 helicase; Provisional 90.66
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 90.62
KOG1002|consensus 791 90.56
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 90.42
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 90.31
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 90.22
KOG0331|consensus519 90.19
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 90.13
KOG0952|consensus 1230 90.11
KOG0386|consensus 1157 89.98
COG4889 1518 Predicted helicase [General function prediction on 89.75
COG1198 730 PriA Primosomal protein N' (replication factor Y) 89.63
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 89.36
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 89.23
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 89.02
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 88.74
PHA02653 675 RNA helicase NPH-II; Provisional 88.64
cd0556689 PTS_IIB_galactitol PTS_IIB_galactitol: subunit IIB 88.47
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 88.37
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 87.78
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 87.7
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 87.4
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 87.2
PF0230290 PTS_IIB: PTS system, Lactose/Cellobiose specific I 87.2
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 87.0
COG4098441 comFA Superfamily II DNA/RNA helicase required for 86.6
PTZ00424401 helicase 45; Provisional 86.48
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 85.73
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 85.62
PRK13767 876 ATP-dependent helicase; Provisional 85.45
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 85.41
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 84.89
smart0049082 HELICc helicase superfamily c-terminal domain. 84.72
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 84.11
TIGR01198 233 pgl 6-phosphogluconolactonase. This enzyme of the 83.57
PRK09401 1176 reverse gyrase; Reviewed 83.47
KOG1123|consensus 776 82.97
cd06353 258 PBP1_BmpA_Med_like Periplasmic binding domain of t 82.88
TIGR03420 226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 82.46
cd01400 219 6PGL 6PGL: 6-Phosphogluconolactonase (6PGL) subfam 82.17
PF02608 306 Bmp: Basic membrane protein; InterPro: IPR003760 T 81.4
PRK08084 235 DNA replication initiation factor; Provisional 80.39
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 80.25
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 80.2
>KOG0331|consensus Back     alignment and domain information 
Probab=99.97  E-value=3e-30  Score=187.77  Aligned_cols=101  Identities=35%  Similarity=0.571  Sum_probs=98.3

Q ss_pred             CCCeeEEEehh---HHHHHHHHHHHHhccCCceEEEEEcCccHHHHHHHhcCCCcEEEeCcHHHHHHHHhCCCCCCCccE
Q psy18035          3 FANINYLISFP---IVQQTFKFVKELGKFTKLQSTCLLGGDSMDNQFARLHASPDIVVATPGRFLHIVVEMELKLSSIQY   79 (104)
Q Consensus         3 ~~~~~~lil~P---La~Qi~~~~~~l~~~~~~~~~~~~g~~~~~~~~~~l~~~~~IlV~TP~~l~~l~~~~~~~l~~l~~   79 (104)
                      .++|++|||+|   ||.||.+++.++++.+++++.++|||.+...|.+.+.++.+|+||||||+.++++.+.+++++++|
T Consensus       163 ~~~P~vLVL~PTRELA~QV~~~~~~~~~~~~~~~~cvyGG~~~~~Q~~~l~~gvdiviaTPGRl~d~le~g~~~l~~v~y  242 (519)
T KOG0331|consen  163 GDGPIVLVLAPTRELAVQVQAEAREFGKSLRLRSTCVYGGAPKGPQLRDLERGVDVVIATPGRLIDLLEEGSLNLSRVTY  242 (519)
T ss_pred             CCCCeEEEEcCcHHHHHHHHHHHHHHcCCCCccEEEEeCCCCccHHHHHHhcCCcEEEeCChHHHHHHHcCCccccceeE
Confidence            35899999999   999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEchhhhhhhcCcHHHHHhhhhc
Q psy18035         80 VVFDEADRLFEMGFDVEQQSPCDT  103 (104)
Q Consensus        80 lVlDEaD~ll~~gf~~~i~~i~~~  103 (104)
                      +|+||||+||++||+++++.|++.
T Consensus       243 lVLDEADrMldmGFe~qI~~Il~~  266 (519)
T KOG0331|consen  243 LVLDEADRMLDMGFEPQIRKILSQ  266 (519)
T ss_pred             EEeccHHhhhccccHHHHHHHHHh
Confidence            999999999999999999999975

>KOG0339|consensus Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG3089|consensus Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>cd05566 PTS_IIB_galactitol PTS_IIB_galactitol: subunit IIB of enzyme II (EII) of the galactitol-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PF02302 PTS_IIB: PTS system, Lactose/Cellobiose specific IIB subunit; InterPro: IPR003501 The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>TIGR01198 pgl 6-phosphogluconolactonase Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>cd06353 PBP1_BmpA_Med_like Periplasmic binding domain of the basic membrane lipoprotein Med in Bacillus and its close homologs from other bacteria and Archaea Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>cd01400 6PGL 6PGL: 6-Phosphogluconolactonase (6PGL) subfamily; 6PGL catalyzes the second step of the oxidative phase of the pentose phosphate pathway, the hydrolyzation of 6-phosphoglucono-1,5-lactone (delta form) to 6-phosphogluconate Back     alignment and domain information
>PF02608 Bmp: Basic membrane protein; InterPro: IPR003760 This is a family of basic membrane lipoproteins from Borrelia and various putative lipoproteins from other bacteria Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query104
3fe2_A242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 4e-10
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 5e-10
2z0m_A 337 Crystal Structure Of Hypothetical Atp-Dependent Rna 3e-09
3iuy_A228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 4e-09
3ber_A249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 8e-09
1wrb_A253 Crystal Structure Of The N-Terminal Reca-Like Domai 1e-08
2pl3_A236 Human Dead-Box Rna Helicase Ddx10, Dead Domain In C 5e-08
1q0u_A219 Crystal Structure Of The Bstdead N-Terminal Domain 5e-08
2i4i_A 417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 4e-07
3bor_A237 Crystal Structure Of The Deadc Domain Of Human Tran 6e-07
3ly5_A262 Ddx18 Dead-Domain Length = 262 9e-07
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 1e-06
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 1e-06
2j0u_B 374 The Crystal Structure Of Eif4aiii-Barentsz Complex 1e-06
1vec_A206 Crystal Structure Of The N-Terminal Domain Of RckP5 3e-06
1s2m_A 400 Crystal Structure Of The Dead Box Protein Dhh1p Len 4e-06
2j0u_A 374 The Crystal Structure Of Eif4aiii-Barentsz Complex 4e-06
2j0q_A 410 The Crystal Structure Of The Exon Junction Complex 5e-06
2xb2_A 411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 5e-06
2hxy_A 391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 5e-06
2hyi_C 413 Structure Of The Human Exon Junction Complex With A 5e-06
2db3_A 434 Structural Basis For Rna Unwinding By The Dead-Box 6e-06
3i5x_A 563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 1e-05
3sqx_A 512 Structure Of Mss116p (Nte And C-Tail Double Deletio 1e-05
3pew_A 395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 1e-05
3pey_A 395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 1e-05
2kbe_A226 Solution Structure Of Amino-Terminal Domain Of Dbp5 2e-05
3eiq_A 414 Crystal Structure Of Pdcd4-eif4a Length = 414 2e-05
1xtk_A 390 Structure Of Decd To Dead Mutation Of Human Uap56 L 3e-05
2zu6_A 388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 3e-05
3sqw_A 579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 3e-05
1t6n_A220 Crystal Structure Of The N-Terminal Domain Of Human 9e-05
1xtj_A 386 Structure Of Human Uap56 In Complex With Adp Length 9e-05
1xti_A 391 Structure Of Wildtype Human Uap56 Length = 391 9e-05
1hv8_A 367 Crystal Structure Of A Dead Box Protein From The Hy 1e-04
2g9n_A221 Structure Of The Dead Domain Of Human Eukaryotic In 4e-04
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure 
Iteration: 1

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 43/81 (53%)
Query: 14  IVQQTFKFVKELGKFTKLQSTCLLGGDSMDNQFARLHASPDIVVATPGRFLHIVVEMELK 73
           + QQ  +   E  +  +L+STC+ GG     Q   L    +I +ATPGR +  +   +  
Sbjct: 114 LAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTN 173
Query: 74  LSSIQYVVFDEADRLFEMGFD 94
           L    Y+V DEADR+ +MGF+
Sbjct: 174 LRRTTYLVLDEADRMLDMGFE 194
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure
>pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 Back     alignment and structure
>pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 Back     alignment and structure
>pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|2KBE|A Chain A, Solution Structure Of Amino-Terminal Domain Of Dbp5p Length = 226 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query104
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 1e-29
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 1e-23
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 3e-22
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 3e-22
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 2e-21
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 4e-21
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 6e-21
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 2e-20
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 2e-20
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 4e-20
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 7e-20
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 7e-19
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 1e-18
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 2e-18
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 4e-18
3bor_A237 Human initiation factor 4A-II; translation initiat 6e-18
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 6e-18
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 8e-18
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 1e-17
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 1e-17
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 1e-17
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 3e-16
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 1e-14
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 2e-14
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 3e-14
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 5e-14
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 8e-14
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 1e-13
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 1e-13
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 2e-13
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 9e-12
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 9e-07
3b6e_A216 Interferon-induced helicase C domain-containing P; 7e-05
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 8e-05
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 3e-04
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 6e-04
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 8e-04
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 9e-04
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
 Score =  105 bits (263), Expect = 1e-29
 Identities = 26/78 (33%), Positives = 49/78 (62%), Gaps = 2/78 (2%)

Query: 17  QTFKFVKELGKFTKLQSTCLLGGDSMDNQFARLHASPDIVVATPGRFL-HIVVEMELKLS 75
           QTF+ ++++GK     +  ++GG  + ++  R++ + +I+V TPGR L H+   +    +
Sbjct: 112 QTFEVLRKVGKNHDFSAGLIIGGKDLKHEAERIN-NINILVCTPGRLLQHMDETVSFHAT 170

Query: 76  SIQYVVFDEADRLFEMGF 93
            +Q +V DEADR+ +MGF
Sbjct: 171 DLQMLVLDEADRILDMGF 188
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query104
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.89
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.89
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.87
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.86
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.86
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.85
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.85
3bor_A237 Human initiation factor 4A-II; translation initiat 99.84
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.84
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.83
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.83
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.83
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.82
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.82
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.81
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.8
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.8
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.78
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.76
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.76
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.74
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.74
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.73
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 99.72
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.72
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 99.72
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.72
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.71
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.69
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.68
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.68
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 99.67
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 99.65
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.64
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.62
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.61
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 99.6
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.59
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.59
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.58
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.57
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.54
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.52
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.49
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.45
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.42
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.41
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.41
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.4
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.39
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 99.37
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.36
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.32
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.31
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.29
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.26
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.23
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.22
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.2
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.19
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.17
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 98.97
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 98.94
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 98.94
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 98.81
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 98.8
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 98.77
3h1t_A 590 Type I site-specific restriction-modification syst 98.74
1yks_A 440 Genome polyprotein [contains: flavivirin protease 98.73
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 98.7
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 98.55
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 98.52
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 98.51
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 98.47
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 98.36
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 98.3
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 98.14
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 98.13
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 97.92
3jux_A 822 Protein translocase subunit SECA; protein transloc 97.71
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 96.33
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 96.23
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 95.32
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 95.24
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 95.23
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 94.56
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 94.32
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 94.15
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 93.67
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 92.86
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 92.82
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 92.42
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 92.39
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 92.31
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 91.88
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 91.57
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 91.27
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 91.14
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 91.02
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 90.86
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 90.84
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 90.27
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 90.21
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 89.83
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 89.8
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 89.73
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 88.64
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 88.54
1yks_A 440 Genome polyprotein [contains: flavivirin protease 87.2
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 86.84
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 86.42
3lhi_A 232 Putative 6-phosphogluconolactonase; structural gen 85.9
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 85.69
3lwd_A 226 6-phosphogluconolactonase; structural genomics, JO 85.41
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 85.32
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 84.37
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 84.03
3nwp_A 233 6-phosphogluconolactonase; structural genomics, jo 83.41
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 83.34
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 81.73
4gl2_A 699 Interferon-induced helicase C domain-containing P; 81.58
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 81.27
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 81.09
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
Probab=99.89  E-value=9.8e-23  Score=135.99  Aligned_cols=100  Identities=31%  Similarity=0.528  Sum_probs=94.8

Q ss_pred             CCeeEEEehh---HHHHHHHHHHHHhccCCceEEEEEcCccHHHHHHHhcCCCcEEEeCcHHHHHHHHhCCCCCCCccEE
Q psy18035          4 ANINYLISFP---IVQQTFKFVKELGKFTKLQSTCLLGGDSMDNQFARLHASPDIVVATPGRFLHIVVEMELKLSSIQYV   80 (104)
Q Consensus         4 ~~~~~lil~P---La~Qi~~~~~~l~~~~~~~~~~~~g~~~~~~~~~~l~~~~~IlV~TP~~l~~l~~~~~~~l~~l~~l   80 (104)
                      ++++++|++|   |+.|+++.++++.+..++++..++||.+...+...+.++++|+|+||+++.+++..+...+++++++
T Consensus       101 ~~~~~lil~Pt~~L~~Q~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~I~v~Tp~~l~~~l~~~~~~~~~~~~l  180 (242)
T 3fe2_A          101 DGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYL  180 (242)
T ss_dssp             CCCSEEEECSSHHHHHHHHHHHHHHHHHTTCCEEEECTTSCHHHHHHHHHHCCSEEEECHHHHHHHHHHTSCCCTTCCEE
T ss_pred             CCCEEEEEeCcHHHHHHHHHHHHHHHhhcCceEEEEECCCChHHHHHHhcCCCCEEEECHHHHHHHHHcCCCCcccccEE
Confidence            5789999999   9999999999999999999999999999999999998899999999999999999998999999999


Q ss_pred             EEchhhhhhhcCcHHHHHhhhhc
Q psy18035         81 VFDEADRLFEMGFDVEQQSPCDT  103 (104)
Q Consensus        81 VlDEaD~ll~~gf~~~i~~i~~~  103 (104)
                      |+||||.+++.||.+++..|++.
T Consensus       181 ViDEah~l~~~~~~~~~~~i~~~  203 (242)
T 3fe2_A          181 VLDEADRMLDMGFEPQIRKIVDQ  203 (242)
T ss_dssp             EETTHHHHHHTTCHHHHHHHHTT
T ss_pred             EEeCHHHHhhhCcHHHHHHHHHh
Confidence            99999999999999999998764
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3lhi_A Putative 6-phosphogluconolactonase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.33A {Neisseria gonorrhoeae} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3lwd_A 6-phosphogluconolactonase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; 1.75A {Chromohalobacter salexigens} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3nwp_A 6-phosphogluconolactonase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, hydrolase; HET: MSE P6G PG4; 1.40A {Shewanella baltica} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 104
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 7e-17
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 3e-06
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 3e-05
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 7e-05
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 2e-04
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 5e-04
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Putative DEAD box RNA helicase
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

 Score = 70.1 bits (171), Expect = 7e-17
 Identities = 27/93 (29%), Positives = 43/93 (46%), Gaps = 1/93 (1%)

Query: 1   MGFANINYLISFPIVQQTFKFVKELGKFTKLQSTCLLGGDSMDNQFARLHASPDIVVATP 60
            G   I    +  +  Q    ++ L     L+   + GG ++  Q   L  + +IVV TP
Sbjct: 71  NGIEAIILTPTRELAIQVADEIESLKGNKNLKIAKIYGGKAIYPQIKALK-NANIVVGTP 129

Query: 61  GRFLHIVVEMELKLSSIQYVVFDEADRLFEMGF 93
           GR L  +    L L +++Y + DEAD +  MGF
Sbjct: 130 GRILDHINRGTLNLKNVKYFILDEADEMLNMGF 162
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query104
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.95
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.93
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.92
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.92
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.91
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.9
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.9
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.89
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.76
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.5
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.41
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.18
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.17
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.16
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 98.94
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 98.88
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 98.42
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 98.13
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 97.93
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 97.69
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 97.44
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 97.39
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 97.37
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 96.98
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 96.32
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 95.59
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 95.58
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 94.74
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 94.21
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 94.14
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 93.62
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 93.61
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 93.11
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 92.78
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 92.72
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 91.86
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 89.06
d1vl1a_ 218 6-phosphogluconolactonase {Thermotoga maritima [Ta 88.04
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 85.25
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.95  E-value=8.8e-28  Score=158.39  Aligned_cols=101  Identities=25%  Similarity=0.439  Sum_probs=96.8

Q ss_pred             CCCeeEEEehh---HHHHHHHHHHHHhccCCceEEEEEcCccHHHHHHHhcCCCcEEEeCcHHHHHHHHhCCCCCCCccE
Q psy18035          3 FANINYLISFP---IVQQTFKFVKELGKFTKLQSTCLLGGDSMDNQFARLHASPDIVVATPGRFLHIVVEMELKLSSIQY   79 (104)
Q Consensus         3 ~~~~~~lil~P---La~Qi~~~~~~l~~~~~~~~~~~~g~~~~~~~~~~l~~~~~IlV~TP~~l~~l~~~~~~~l~~l~~   79 (104)
                      .++|+++|++|   ||.|+++++++++++.++++..++||.+..++...+..++||+||||||+.++++.+.++++++++
T Consensus        83 ~~~~~~lil~PtreLa~Qi~~~~~~l~~~~~i~~~~~~g~~~~~~~~~~l~~~~~Ilv~TPgrl~~~~~~~~~~~~~l~~  162 (222)
T d2j0sa1          83 VRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKM  162 (222)
T ss_dssp             SCSCCEEEECSSHHHHHHHHHHHHHHTTTTTCCEEEECTTSCHHHHHHHHHHCCSEEEECHHHHHHHHHTTSSCCTTCCE
T ss_pred             ccCceeEEecchHHHHHHHHHHHHHHhCccceeEEEEeecccchhhHHHhccCCeEEeCCCCcHHhccccccccccccee
Confidence            45799999999   999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEchhhhhhhcCcHHHHHhhhhc
Q psy18035         80 VVFDEADRLFEMGFDVEQQSPCDT  103 (104)
Q Consensus        80 lVlDEaD~ll~~gf~~~i~~i~~~  103 (104)
                      +|+||||+|++.||.+++..|++.
T Consensus       163 lVlDEaD~ll~~~f~~~i~~I~~~  186 (222)
T d2j0sa1         163 LVLDEADEMLNKGFKEQIYDVYRY  186 (222)
T ss_dssp             EEEETHHHHTSTTTHHHHHHHHTT
T ss_pred             eeecchhHhhhcCcHHHHHHHHHh
Confidence            999999999999999999999864
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1vl1a_ c.124.1.1 (A:) 6-phosphogluconolactonase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure